>cd04163 Era Era subfamily. Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria. It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA. It also contacts several assembly elements of the 30S subunit. Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism. Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding. Both domains are important for Era function. Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.

Probab=93.85 E-value=0.11 Score=29.53 Aligned_cols=65 Identities=22% Similarity=0.297 Sum_probs=43.2 Q ss_pred CCEEEECCCCCCCH----------HHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCC Q ss_conf 88899738888898----------999998620125435787768899999999999981987675389995658987 Q gi|254780725|r 275 FPLVILDVPHVWNS----------WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPK 342 (427) Q Consensus 275 yd~VIiD~p~~~~~----------~~~~~L~~AD~vviV~~p~~~slr~a~~ll~~l~~~~~~~~~~~iVlNr~~~~~ 342 (427) T Consensus 51 ~~~~l~DtpG~~~~~~~~~~~~~~~~~~~l~~~D~il~vvD~~~~~~~~d~~i~~~l~~~~---~~~iivlNK~Dl~~ 125 (168) T cd04163 51 AQIIFVDTPGIHKPKKKLGERMVKAAWSALKDVDLVLFVVDASEPIGEGDEFILELLKKSK---TPVILVLNKIDLVK 125 (168) T ss_pred EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHCC---CCEEEEEECEEECC T ss_conf 7899995898665145677899999998651365589999789898667799999999809---98599997887047

HHsearch alignment for GI: 254780725 and conserved domain: cd04163