HHsearch alignment for GI: 254780725 and conserved domain: pfam06564

>pfam06564 YhjQ YhjQ protein. This family consists of several bacterial YhjQ proteins. The function of this family is unknown. However, the family does contain a P-loop sequence motif suggesting a nucleotide binding function.
Probab=100.00  E-value=1.8e-35  Score=237.19  Aligned_cols=225  Identities=15%  Similarity=0.226  Sum_probs=167.8

Q ss_pred             EEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCC--CCCHHHHHCCCCCHHHHHHHHHHHC
Q ss_conf             37999746988775689999999999626994999978798986033438998--7898886318456124337653202
Q gi|254780725|r  162 CSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDP--INSISDAIYPVGRIDKAFVSRLPVF  239 (427)
Q Consensus       162 rvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~~l~~~~--~~~l~d~l~~~~rlD~~~l~~~l~~  239 (427)
T Consensus         2 kiIai~s~KGGVGKTT~t~nLa~aLa~-~G~rVLlID~Dpq-~~l~~~~g~~~~~~~g~~~~~l~~~~-----~~~~~~~   74 (244)
T pfam06564         2 AVLALQGVRGGVGTTSLTAALGWALQQ-LGESVLVIDASPD-NLLRLHFNVDFDHSDGWARAELDGRP-----WRDAALR   74 (244)
T ss_pred             EEEEEECCCCCCCHHHHHHHHHHHHHH-CCCCEEEEECCCC-CCCCCCCCCCCCCCCCHHHHHHCCCC-----HHHHHEE
T ss_conf             299996699986199999999999997-7995899968987-42102358886434414899875997-----7774445


Q ss_pred             CCCCEEEEECCCCC-CCHHCC-----CHHHHHHHHHHHH--HCCCEEEECCCCCCCHHHHHHHHHCCCCCCCCCCCHHHH
Q ss_conf             48980687248761-203207-----9999999899985--128889973888889899999862012543578776889
Q gi|254780725|r  240 YAENLSILTAPAML-SRTYDF-----DEKMIVPVLDILE--QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGL  311 (427)
Q Consensus       240 ~~~gL~lL~a~~~~-~~~~~~-----~~~~l~~ll~~l~--~~yd~VIiD~p~~~~~~~~~~L~~AD~vviV~~p~~~sl  311 (427)
T Consensus        75 ~~~gl~llP~g~l~~~~~~~~~~~~~~~~~l~~~l~~l~~~~~yD~iliD~Pp~l~~l~~~al~aad~vLv~v~~d~~s~  154 (244)
T pfam06564        75 YTPGLDLLPFGQLTGAERENLQQLQPDLGAWAQRLQLLKASGQYRWILLDLPQGFSPLTRQLLELADVTLAVVHADANCH  154 (244)
T ss_pred             ECCCEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCHHHHHHHHHHCCCEEEEECCCHHHH
T ss_conf             26975897289974789998986544379999987642135789999997999968999999997696089968885899


Q ss_pred             HHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCHHHH-HHHHHHHCCCEEEEECCCHHHHHHHHHCCCCEEEECCCCHHH
Q ss_conf             9999999999981987675389995658987520059-999998489537990687999999884796189888999899
Q gi|254780725|r  312 RNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISI-SDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIA  390 (427)
Q Consensus       312 r~a~~ll~~l~~~~~~~~~~~iVlNr~~~~~~~~i~~-~~~~~~lg~~~~~~IP~D~~~~~~A~~~G~pi~e~~p~s~~a  390 (427)
T Consensus       155 ~~-------l~~-~~~~~~~~ilvn~~d~~~~l~~d~~~~~~~~~~~~l~~~I~rd~~-l~EA~a~g~pv~~yaP~S~aA  225 (244)
T pfam06564       155 IR-------LHQ-QALPAGCHLLINDFRIGSQLQDDLYQLWLQSQRRLLPIVVHRDEA-MAEALAAKQPLGEYRPDSLAA  225 (244)
T ss_pred             HH-------HHH-CCCCCCCEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEECCCCH-HHHHHHCCCCHHHCCCCCHHH
T ss_conf             99-------732-334467748864245576899999999998608725755079882-989986799554538699899


Q ss_pred             HHHHHHHHHHHC
Q ss_conf             999999999852
Q gi|254780725|r  391 NLLVDFSRVLMG  402 (427)
Q Consensus       391 ~~~~~La~~i~g  402 (427)
T Consensus       226 ~dy~~LA~w~l~  237 (244)
T pfam06564       226 EEVLTLANWCLL  237 (244)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999998