HHsearch alignment for GI: 254780725 and conserved domain: pfam09140

>pfam09140 MipZ ATPase MipZ. MipZ is an ATPase that forms a complex with the chromosome partitioning protein ParB near the chromosomal origin of replication. It is responsible for the temporal and spatial regulation of FtsZ ring formation.
Probab=99.94  E-value=1e-25  Score=177.32  Aligned_cols=209  Identities=14%  Similarity=0.173  Sum_probs=129.1

Q ss_pred             EEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCHHHHHCCCCCHHHHHHHHHHHCCC
Q ss_conf             37999746988775689999999999626994999978798986033438998789888631845612433765320248
Q gi|254780725|r  162 CSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYA  241 (427)
Q Consensus       162 rvIav~g~KGGvGkTTiA~nLA~~LA~~~~~~VlLvDlDl~~g~~~~~l~~~~~~~l~d~l~~~~rlD~~~l~~~l~~~~  241 (427)
T Consensus         1 hIIaVaNqKGGvGKTTtavnLA~aLA~-~G~rVllIDlDpqq~slt~~l~nr~~~--~~----~~~~~--------l~~P   65 (261)
T pfam09140         1 HVIVVGNEKGGSGKSTTAVHVAVALLY-LGARVATIDLDLRQRTLTRYIENRAAT--AE----RTGLD--------LPVP   65 (261)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHH-CCCCEEEEECCCCCCCHHHHHHHHHHH--HH----HCCCC--------CCCC
T ss_conf             979997178987299999999999998-899789997999998512344303556--55----13865--------3466


Q ss_pred             CCEEEEECCCCCCCHHCCCHHHHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHH----
Q ss_conf             9806872487612032079999999899985128889973888889899999862012543578776889999999----
Q gi|254780725|r  242 ENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNL----  317 (427)
Q Consensus       242 ~gL~lL~a~~~~~~~~~~~~~~l~~ll~~l~~~yd~VIiD~p~~~~~~~~~~L~~AD~vviV~~p~~~slr~a~~l----  317 (427)
T Consensus        66 ~~~~l~~~~~~~~~~~~~~~~~L~~al~~l~~~yDfIlIDcPPsl~~Lt~nAl~aAD~vIiPlq~sf~dld~L~~vd~~~  145 (261)
T pfam09140        66 KHLCLPDDVSEVFDGESADDARLEEAVADLEQDADFIVIDTPGSDSPLSRLAHSRADTLVTPLNDSFVDFDLLGQVDPET  145 (261)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHCEEEECCCHHHHHHHHHHHCCHHH
T ss_conf             53445506777613455789999999999875799999969985739999999983987632440155143352137034


Q ss_pred             ---------HHHH---HHCCC--CCC--CCEEEEECCCCCC-CCHHH----HHHHHHHHCCCEEEEECCCHHHHHHHHHC
Q ss_conf             ---------9999---98198--767--5389995658987-52005----99999984895379906879999998847
Q gi|254780725|r  318 ---------IDVL---KKLRP--ADK--PPYLVLNQVKTPK-KPEIS----ISDFCAPLGITPSAIIPFDGAVFGMSANS  376 (427)
Q Consensus       318 ---------l~~l---~~~~~--~~~--~~~iVlNr~~~~~-~~~i~----~~~~~~~lg~~~~~~IP~D~~~~~~A~~~  376 (427)
T Consensus       146 ~~i~~~s~y~e~vw~~r~~ra~~~~~~idwivlrnRl~~~~~rnk~~~~~~l~~Ls~rigfr~~~g~-~eRviyRelfp~  224 (261)
T pfam09140       146 FKVTRPSFYAEMVWEARKKRAQADRAPIDWIVLRNRLSTLEARNKRRVEDALNELSKRVGFRVAPGF-SERVIYRELFPR  224 (261)
T ss_pred             HHHCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC-CHHHHHHHHCCC
T ss_conf             3213621789999999998743689886479980562188878889999999999764075225774-313578776246


Q ss_pred             CCCEEEECCC
Q ss_conf             9618988899
Q gi|254780725|r  377 GKMIHEVDPK  386 (427)
Q Consensus       377 G~pi~e~~p~  386 (427)
T Consensus       225 gltl~dl~~~  234 (261)
T pfam09140       225 GLTLLDLKDL  234 (261)
T ss_pred             CCCHHCCCCC
T ss_conf             7714118512