HHsearch alignment for GI: 254780725 and conserved domain: smart00177

>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor. Ras homologues involved in vesicular transport. Activator of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. ARFs are N-terminally myristoylated. Contains ATP/GTP-binding motif (P-loop).
Probab=90.37  E-value=1.1  Score=23.34  Aligned_cols=112  Identities=12%  Similarity=0.130  Sum_probs=70.5

Q ss_pred             CCCEEEECCCCC--CCHHHHHHHHHCCCCCCCCCCC-HHHHHHHHHHHHH-HHHCCCCCCCCEEEEECCCCCCCCHHHHH
Q ss_conf             288899738888--8989999986201254357877-6889999999999-99819876753899956589875200599
Q gi|254780725|r  274 IFPLVILDVPHV--WNSWTQEVLTLSDKVVITTSLD-LAGLRNSKNLIDV-LKKLRPADKPPYLVLNQVKTPKKPEISIS  349 (427)
Q Consensus       274 ~yd~VIiD~p~~--~~~~~~~~L~~AD~vviV~~p~-~~slr~a~~ll~~-l~~~~~~~~~~~iVlNr~~~~~~~~i~~~  349 (427)
T Consensus        56 ~~~l~iwD~~Gqe~~r~l~~~Yy~~a~~iIfVvD~sd~~~~~~~~~~l~~~l~~~~~~~~piLil~NK~Dl~~--~~~~~  133 (175)
T smart00177       56 NISFTVWDVGGQDKIRPLWRHYYTNTQGLIFVVDSNDRDRIDEAREELHRMLNEDELRDAVILVFANKQDLPD--AMKAA  133 (175)
T ss_pred             CEEEEEEECCCCCCCCHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCEEEEEEECCCCCC--CCCHH
T ss_conf             8999999899985455367775577618999986687789999999999996315316986999984566767--88999


Q ss_pred             HHHHHHCCCEEEEECCCHHHHHHHHHCCCCEEEECC--CCHHHHHHHHHHHHH
Q ss_conf             999984895379906879999998847961898889--998999999999998
Q gi|254780725|r  350 DFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDP--KSAIANLLVDFSRVL  400 (427)
Q Consensus       350 ~~~~~lg~~~~~~IP~D~~~~~~A~~~G~pi~e~~p--~s~~a~~~~~La~~i  400 (427)
T Consensus       134 ei~~~l~l~~~~-------------~~~~~i~~~SA~tG~GI~e~f~wL~~~i  173 (175)
T smart00177      134 EITEKLGLHSIR-------------DRNWYIQPTCATSGDGLYEGLTWLSNNL  173 (175)
T ss_pred             HHHHHHCHHHHC-------------CCCEEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             999996866540-------------7975999826878969899999999984