BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780725|ref|YP_003065138.1| response regulator receiver
protein [Candidatus Liberibacter asiaticus str. psy62]
         (427 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780725|ref|YP_003065138.1| response regulator receiver protein [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040402|gb|ACT57198.1| response regulator receiver protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 427

 Score =  867 bits (2240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/427 (100%), Positives = 427/427 (100%)

Query: 1   MNIGYDGHNSDFLENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRI 60
           MNIGYDGHNSDFLENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRI
Sbjct: 1   MNIGYDGHNSDFLENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRI 60

Query: 61  TRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSL 120
           TRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSL
Sbjct: 61  TRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSL 120

Query: 121 YRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAH 180
           YRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAH
Sbjct: 121 YRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAH 180

Query: 181 NCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFY 240
           NCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFY
Sbjct: 181 NCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFY 240

Query: 241 AENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKV 300
           AENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKV
Sbjct: 241 AENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKV 300

Query: 301 VITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPS 360
           VITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPS
Sbjct: 301 VITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPS 360

Query: 361 AIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKI 420
           AIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKI
Sbjct: 361 AIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKI 420

Query: 421 FNMKCFS 427
           FNMKCFS
Sbjct: 421 FNMKCFS 427


>gi|315121889|ref|YP_004062378.1| response regulator receiver protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495291|gb|ADR51890.1| response regulator receiver protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 418

 Score =  571 bits (1471), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 281/424 (66%), Positives = 344/424 (81%), Gaps = 6/424 (1%)

Query: 1   MNIGYDGHNSDFLENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRI 60
           M+I Y G  SD L    +      SLP IS H FCVTD+LYSV+E+SKID RM++VNMRI
Sbjct: 1   MSIEYKGSGSDVLNKHGD-----GSLPSISAHAFCVTDSLYSVIEKSKIDRRMNRVNMRI 55

Query: 61  TRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSL 120
           T+GSI EA+  F+DS+TP+L+I+QT VDSR++LS+LEPLAEVCDS TKVIVIG+TNDV L
Sbjct: 56  TKGSITEAIDVFADSATPNLLIIQTTVDSRKILSSLEPLAEVCDSTTKVIVIGETNDVLL 115

Query: 121 YRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAH 180
           YR LI++ +SEYLIEPLSV+DII +IS IF  ++  + S G SI+FIGSRGGVGSSTIAH
Sbjct: 116 YRELIASGISEYLIEPLSVSDIIKAISNIFV-EKNKEDSFGSSIAFIGSRGGVGSSTIAH 174

Query: 181 NCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFY 240
           NCAFSIASV A +T+LADLDLPYGTANINFD+DPI  I D I   G+ID+  V ++ V Y
Sbjct: 175 NCAFSIASVLATDTILADLDLPYGTANINFDQDPIYGILDLISSSGKIDEGLVDKIMVRY 234

Query: 241 AENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKV 300
            ENLSILTAPA+L  TYDFDEK I+PV+++L++I PL ILD+PH+WN W +++LTLSDKV
Sbjct: 235 VENLSILTAPAILDCTYDFDEKDILPVIELLKRIAPLTILDLPHIWNRWNRQILTLSDKV 294

Query: 301 VITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPS 360
           VITTSLDL  LRN+KNLID L K RP DKPPYLV+NQV  PKKPEISI DFCAPLGI PS
Sbjct: 295 VITTSLDLVSLRNTKNLIDFLTKNRPNDKPPYLVINQVGMPKKPEISIDDFCAPLGIDPS 354

Query: 361 AIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKI 420
            IIPFD  VFG+SANSGKMI E++P+S+++NLLVDFS +L+ R+T+ KP++A+Y KIK  
Sbjct: 355 VIIPFDAFVFGISANSGKMIREMNPQSSVSNLLVDFSNILLDRITIVKPKNAIYDKIKTF 414

Query: 421 FNMK 424
             +K
Sbjct: 415 LKIK 418


>gi|150398543|ref|YP_001329010.1| response regulator receiver protein [Sinorhizobium medicae WSM419]
 gi|150030058|gb|ABR62175.1| response regulator receiver protein [Sinorhizobium medicae WSM419]
          Length = 428

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 198/398 (49%), Positives = 286/398 (71%), Gaps = 4/398 (1%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
           E +  LPRIS+H FC ++ +  ++ER   D RM++V++R+T G IA A + F+  STP+L
Sbjct: 27  EQLRPLPRISIHAFCESEAVQRLMERCGQDRRMAKVSLRVTGGGIAAAATTFASVSTPNL 86

Query: 81  IIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA 140
           II++T  + R +LS L PLAEVCD  T+VIVIG  ND++LYR L+ N +SEY++ P+ +A
Sbjct: 87  IILETATEPRSLLSELAPLAEVCDPSTRVIVIGRHNDIALYRELLRNGISEYMVAPVGMA 146

Query: 141 DIINSISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADL 199
           D+++++SAIF  P+ E  G S   ++FIG++GG GSS IAHNCA+ I+++F+ ET+LADL
Sbjct: 147 DMLSAVSAIFVDPEAEPLGRS---LAFIGAKGGCGSSGIAHNCAWGISNLFSTETILADL 203

Query: 200 DLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDF 259
           DLPYGTANI+FD+DP   I++A++   R+D+ F+ RL    +E+LS+L AP+ML R YDF
Sbjct: 204 DLPYGTANIDFDQDPPQGIAEAVFAPERLDEVFLDRLLTRCSEHLSLLAAPSMLDRAYDF 263

Query: 260 DEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLID 319
           +     P+L+IL++  P+ +LD+PH W+ WT+ VL+ +D+VVIT + DLA LRN+KNL+D
Sbjct: 264 ETAAFQPILEILQRSAPVSVLDLPHSWSDWTRSVLSAADEVVITAAPDLASLRNAKNLLD 323

Query: 320 VLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKM 379
            +KKLRP DKPP+LVLNQV  PK+PEI+  +FCA L +  +AIIPFD  +FG ++NSG+M
Sbjct: 324 AMKKLRPNDKPPHLVLNQVGLPKRPEIAPDEFCASLEVEAAAIIPFDAVLFGNASNSGRM 383

Query: 380 IHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKI 417
           I E+D KS  A      S +L GR    K +     K+
Sbjct: 384 IAEIDRKSPAAETFSQLSHLLTGRTAAKKARRGGLGKV 421


>gi|227823973|ref|YP_002827946.1| pilus assembly protein CpaE [Sinorhizobium fredii NGR234]
 gi|227342975|gb|ACP27193.1| pilus assembly protein CpaE [Sinorhizobium fredii NGR234]
          Length = 427

 Score =  417 bits (1073), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/393 (50%), Positives = 281/393 (71%), Gaps = 4/393 (1%)

Query: 26  LPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQT 85
           LPRIS+H FC T+ +  ++ER   D RM++V++RIT GS+A A + F+  STP+LII++T
Sbjct: 31  LPRISIHAFCETEAMQRLMERCGQDRRMAKVSLRITGGSVAAAANMFASVSTPNLIILET 90

Query: 86  KVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINS 145
             + R +L  L PLAEVCD  TKV++IG  ND++LYR LI N +SEY++ P+++AD++ +
Sbjct: 91  ATEPRSLLGELAPLAEVCDPSTKVVIIGRHNDIALYRELIRNGISEYMVAPVAMADLLGA 150

Query: 146 ISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYG 204
           I+AIF  P+ E  G S   ++FIG++GG GSS IAHNCA+ I+++F+ ET+LADLDLPYG
Sbjct: 151 IAAIFVDPEAEPVGRS---LAFIGAKGGCGSSVIAHNCAWGISNLFSTETILADLDLPYG 207

Query: 205 TANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMI 264
           TANI+FD+DP   IS+A+    R+D+ F+ RL    +E+LS+L AP+ML R YDF+    
Sbjct: 208 TANIDFDQDPPQGISEAVSAPDRLDEVFLDRLLTKCSEHLSLLAAPSMLDRAYDFEAGAF 267

Query: 265 VPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL 324
            P+L+IL++  P+ +LD+PH W+ WT+ VL  +D+VVIT   DLA LRN+KNL+D LKKL
Sbjct: 268 QPILEILQRSAPVSVLDIPHGWSDWTRSVLGEADEVVITAIPDLASLRNTKNLLDALKKL 327

Query: 325 RPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVD 384
           RP D+ P+LVLNQV  PK+PEI+ ++FC  L I  +AIIPFD  +FG +ANSG+MI E+D
Sbjct: 328 RPNDRAPHLVLNQVGMPKRPEIAPNEFCESLEIEAAAIIPFDAVLFGNAANSGRMIGEID 387

Query: 385 PKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKI 417
            KS  A      + +L GR  + K +     K+
Sbjct: 388 RKSPAAETFSQLAHLLTGRTAIKKARRGGLGKV 420


>gi|241207159|ref|YP_002978255.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861049|gb|ACS58716.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 425

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 206/393 (52%), Positives = 286/393 (72%), Gaps = 4/393 (1%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
           E+M  LPRISVH FC ++ L  V+ER   D R+++V+MRIT G IA A + FS + TP+L
Sbjct: 27  ENMRPLPRISVHAFCESEVLQHVMERCANDRRVAKVSMRITSGGIAAAANMFSGAPTPNL 86

Query: 81  IIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA 140
           II++TK ++  +L  L PLA VCD  TKV++IG  ND+ LYR LI N +SEY+++P+++ 
Sbjct: 87  IILETKANAANLLGELAPLAAVCDPTTKVVIIGYYNDIGLYRELIRNGISEYMVQPVAMP 146

Query: 141 DIINSISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADL 199
           DI+ ++++IF  P+ E  G S   I+FIGS+GG G+STIAHNCAF I+++F+ ET+LADL
Sbjct: 147 DILAAMASIFVDPEAEPLGRS---IAFIGSKGGTGASTIAHNCAFGISNLFSTETILADL 203

Query: 200 DLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDF 259
           DLPYGTANI+FD+DP   I++A++   R+D+ F+ RL    +E+LS+L AP++L R YDF
Sbjct: 204 DLPYGTANIDFDQDPAQGIAEAVFAPDRLDEVFLDRLLTKCSEHLSLLAAPSLLDRAYDF 263

Query: 260 DEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLID 319
           D +   PVLD+L++  P+ +LDVPH W+ WT+ VL+  D+VVI    DLA LRN+KN++D
Sbjct: 264 DGQAFQPVLDVLQRSAPVTVLDVPHAWSEWTRSVLSSVDEVVIAAVPDLANLRNAKNMLD 323

Query: 320 VLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKM 379
            L+K+RP D+PP+L+LNQV  PK+PEIS SDFC PL I P AIIPFD  +FG +ANSG+M
Sbjct: 324 ALRKMRPNDRPPHLILNQVGMPKRPEISPSDFCEPLEIDPIAIIPFDIHLFGNAANSGRM 383

Query: 380 IHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSA 412
           I EVDPKS  A      S ++ GRV + K +  
Sbjct: 384 ISEVDPKSPTAETFSQISHIVTGRVAIKKARKG 416


>gi|116249983|ref|YP_765821.1| pilus assembly protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254631|emb|CAK05705.1| putative pilus assembly protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 425

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 209/410 (50%), Positives = 290/410 (70%), Gaps = 9/410 (2%)

Query: 3   IGYDGHNSDFLENEDNLS-----ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVN 57
           I Y+  N   L N +        E+M  LPRISVH FC ++ L  V+ER   D R+++V+
Sbjct: 4   IEYEIRNPSELRNAEEAVRMADLENMRPLPRISVHAFCESEALQHVMERCANDRRVAKVS 63

Query: 58  MRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTND 117
           MRIT G +A A + FS + TP+LII++TK ++  +L  L PLA VCD  TKV++IG  ND
Sbjct: 64  MRITSGGVAAAANMFSGAPTPNLIILETKANAANLLGELAPLAAVCDPTTKVVIIGYYND 123

Query: 118 VSLYRALISNHVSEYLIEPLSVADIINSISAIFT-PQEEGKGSSGCSISFIGSRGGVGSS 176
           + LYR LI N +SEY+++P+++ DI+ ++++IF  P  E  G S   I+FIGS+GG G+S
Sbjct: 124 IGLYRELIRNGISEYMVQPVAMPDILTAMASIFVDPDAEPLGRS---IAFIGSKGGTGAS 180

Query: 177 TIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRL 236
           TIAHNCAF I+++F+ ET+LADLDLPYGTANI+FD+DP   I++A++   R+D+ F+ RL
Sbjct: 181 TIAHNCAFGISNLFSTETILADLDLPYGTANIDFDQDPAQGIAEAVFAPDRLDEVFLDRL 240

Query: 237 PVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTL 296
               +E+LS+L AP++L R YDFD +   PVLD+L++  P+ +LDVPH W+ WT+ VL+ 
Sbjct: 241 LTKCSEHLSLLAAPSLLDRAYDFDGQAFQPVLDVLQRSAPVTVLDVPHAWSEWTRSVLSS 300

Query: 297 SDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLG 356
            D+VVI    DLA LRN+KN++D L+K+RP D+PP+L+LNQV  PK+PEIS SDFC PL 
Sbjct: 301 VDEVVIAAVPDLANLRNAKNMLDALRKMRPNDRPPHLILNQVGMPKRPEISPSDFCEPLE 360

Query: 357 ITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTV 406
           I P AIIPFD  +FG +ANSG+MI EVDPKS  A      S ++ GRV +
Sbjct: 361 IDPIAIIPFDINLFGNAANSGRMISEVDPKSPTAETFSQISHIVTGRVAI 410


>gi|15963896|ref|NP_384249.1| putative response regulator protein [Sinorhizobium meliloti 1021]
 gi|307315793|ref|ZP_07595307.1| response regulator receiver protein [Sinorhizobium meliloti BL225C]
 gi|307320428|ref|ZP_07599845.1| response regulator receiver protein [Sinorhizobium meliloti AK83]
 gi|15073071|emb|CAC41530.1| Putative response regulator [Sinorhizobium meliloti 1021]
 gi|306893994|gb|EFN24763.1| response regulator receiver protein [Sinorhizobium meliloti AK83]
 gi|306898561|gb|EFN29234.1| response regulator receiver protein [Sinorhizobium meliloti BL225C]
          Length = 428

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 199/398 (50%), Positives = 285/398 (71%), Gaps = 4/398 (1%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
           E +  LPRIS+H FC ++ +  ++ER   D RM++V++R+T G IA A + F+ +STP+L
Sbjct: 27  EQLRPLPRISIHAFCESEAVQRLMERCGQDRRMAKVSLRVTGGGIAAAANTFAGASTPNL 86

Query: 81  IIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA 140
           II++T  +   +LS L PLAEVCD  T+VIVIG  ND++LYR LI N +SEY++ P+ +A
Sbjct: 87  IILETATEPGALLSELAPLAEVCDPSTRVIVIGRHNDIALYRELIRNGISEYMVAPVGMA 146

Query: 141 DIINSISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADL 199
           D+++++SAIF  P+ E  G S   ++FIG++GG GSS IAHNCA+ I+++F+ ET+LADL
Sbjct: 147 DMLSAVSAIFVDPEAEPLGRS---LAFIGAKGGCGSSVIAHNCAWGISNLFSTETILADL 203

Query: 200 DLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDF 259
           DLPYGTANI+FD+DP   I++A++   R+D+ F+ RL    +E+LS+L AP+ML R YDF
Sbjct: 204 DLPYGTANIDFDQDPPQGIAEAVFAPERLDEVFLDRLLTRCSEHLSLLAAPSMLDRAYDF 263

Query: 260 DEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLID 319
           +     P+L+IL++  P+ +LD+PH W  WT+ VL+ +D+VVIT + DLA LRN+KNL+D
Sbjct: 264 ETGAFQPILEILQRSAPVSVLDLPHGWTDWTRSVLSAADEVVITAAPDLASLRNAKNLLD 323

Query: 320 VLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKM 379
            LKKLRP DK P+LVLNQV  PK+PEI+  +FCA L I  +AIIPFD  +FG ++NSG+M
Sbjct: 324 ALKKLRPNDKVPHLVLNQVGVPKRPEIAPDEFCASLEIEAAAIIPFDAVLFGNASNSGRM 383

Query: 380 IHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKI 417
           I E+D KS  A      S +L GR  + K +     K+
Sbjct: 384 IAEIDRKSPAAETFAQLSHLLTGRTAIKKARRGGLGKV 421


>gi|86355866|ref|YP_467758.1| pilus assembly protein, response regulator protein [Rhizobium etli
           CFN 42]
 gi|86279968|gb|ABC89031.1| pilus assembly protein, response regulator protein [Rhizobium etli
           CFN 42]
          Length = 425

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/387 (53%), Positives = 283/387 (73%), Gaps = 4/387 (1%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
           E+M  LPRISVH FC ++ L  V+ER   D RM++V+MRIT G IA A + F+ + TP+L
Sbjct: 27  ENMRPLPRISVHAFCESEPLQHVMERCANDRRMAKVSMRITSGGIAAAANMFAAAPTPNL 86

Query: 81  IIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA 140
           II++TK +S  +L  L PLA VCD  TKV+++G  ND+ LYR LI N +SEY+++P+++ 
Sbjct: 87  IILETKANSGSLLGELAPLAAVCDPSTKVVIVGYYNDIGLYRELIRNGISEYMVQPVAMP 146

Query: 141 DIINSISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADL 199
           DI+ ++++IF  P+ E  G S   I+FIGS+GG G+STIAHNCAF I+++F+ ET+LADL
Sbjct: 147 DILTAMASIFVDPEAEPLGRS---IAFIGSKGGTGASTIAHNCAFGISNLFSTETILADL 203

Query: 200 DLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDF 259
           DLPYGTANI+FD+DP   I++A++   R+D+ F+ RL    +E+LS+L AP++L R YDF
Sbjct: 204 DLPYGTANIDFDQDPAQGIAEAVFAPDRLDEVFLDRLLTKCSEHLSLLAAPSLLDRAYDF 263

Query: 260 DEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLID 319
           D +   PVLD+L++  P+ +LDVPH W+ WT+ VL   D+VVIT   DLA LRN+KN++D
Sbjct: 264 DGQAFQPVLDVLQRSAPVTVLDVPHAWSEWTRSVLASVDEVVITAVPDLANLRNTKNMLD 323

Query: 320 VLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKM 379
            L+K+RP DKPP+L+LNQV  PK+PEIS SDFC PL   P AIIPFD  +FG +ANSG+M
Sbjct: 324 ALRKMRPNDKPPHLILNQVGMPKRPEISPSDFCEPLEADPIAIIPFDINLFGNAANSGRM 383

Query: 380 IHEVDPKSAIANLLVDFSRVLMGRVTV 406
           I EVDPKS  A      S ++ GRV +
Sbjct: 384 ISEVDPKSPTAETFSQISHIVTGRVAI 410


>gi|209551761|ref|YP_002283678.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537517|gb|ACI57452.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 425

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 208/389 (53%), Positives = 287/389 (73%), Gaps = 4/389 (1%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
           ESM  LPRISVH FC ++ L  V+ER   D R+++V++RIT G IA A + FS + TP+L
Sbjct: 27  ESMRPLPRISVHAFCESEALQQVMERCANDRRVAKVSLRITSGGIAAAANMFSGAPTPNL 86

Query: 81  IIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA 140
           II++TK ++  +L+ L PLA VCD  TKV+++G  ND++LYR LI N +SEY+++P+++ 
Sbjct: 87  IILETKANAGSLLAELAPLAAVCDPSTKVVIVGYYNDIALYRELIRNGISEYMVQPVAMP 146

Query: 141 DIINSISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADL 199
           DI+ ++++IF  P+ E  G S   I+FIGS+GG G+STIAHNCAF I+++F+ ET+LADL
Sbjct: 147 DILTAMASIFVDPEAEPLGRS---IAFIGSKGGTGASTIAHNCAFGISNLFSTETILADL 203

Query: 200 DLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDF 259
           DLPYGTANI+FD+DP   I++A++   R+D+ F+ RL    +E+LS+L AP++L R YDF
Sbjct: 204 DLPYGTANIDFDQDPALGIAEAVFAPDRLDEVFLDRLLTKCSEHLSLLAAPSLLDRAYDF 263

Query: 260 DEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLID 319
           D     PVLD+L++  P+ +LDVPH W+ WT+ VL+  D+VVIT   DLA LRN+KN++D
Sbjct: 264 DGHAFQPVLDVLQRSAPVTVLDVPHAWSEWTRSVLSSVDEVVITAVPDLANLRNAKNMLD 323

Query: 320 VLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKM 379
            L+K+RP DKPP+LVLNQV  PK+PEIS SDFC PL I P AIIPFD  +FG +ANSG+M
Sbjct: 324 ALRKMRPNDKPPHLVLNQVGMPKRPEISPSDFCEPLEIDPIAIIPFDINLFGNAANSGRM 383

Query: 380 IHEVDPKSAIANLLVDFSRVLMGRVTVSK 408
           I EVDPKS  A      S ++ GRV + K
Sbjct: 384 ISEVDPKSPTAETFSQISHIVTGRVAIRK 412


>gi|327194692|gb|EGE61538.1| pilus assembly, two-component response regulator protein [Rhizobium
           etli CNPAF512]
          Length = 425

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 207/389 (53%), Positives = 286/389 (73%), Gaps = 4/389 (1%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
           E+M  LPRISVH FC ++TL +V+ER   D RM++V++RIT G IA A + FS + TP+L
Sbjct: 27  EAMRPLPRISVHAFCESETLQNVMERCANDRRMAKVSLRITSGGIAAAANMFSGAPTPNL 86

Query: 81  IIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA 140
           II++TK +   +L+ L PLA VCD  TKV+++G  ND+ LYR LI N +SEY+++P+++ 
Sbjct: 87  IILETKANVGSLLAELAPLAAVCDPTTKVVIVGYYNDIGLYRELIRNGISEYMVQPVAMP 146

Query: 141 DIINSISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADL 199
           DI+ ++++IF  P+ E  G S   I+FIGS+GGVG+STIAHNCAF I+++F+ ET+LADL
Sbjct: 147 DILAAMASIFVDPEAEPLGRS---IAFIGSKGGVGASTIAHNCAFGISNLFSTETILADL 203

Query: 200 DLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDF 259
           DLPYGTANI+FD+DP   I++A++   R+D+ F+ RL    +E+LS+L AP++L R YDF
Sbjct: 204 DLPYGTANIDFDQDPAQGIAEAVFAPDRLDEVFLDRLLTKCSEHLSLLAAPSLLDRAYDF 263

Query: 260 DEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLID 319
           D +   PVLD+L++  P+ +LDVPH W+ WT+ VL   D+VVIT   DLA LRN+KN++D
Sbjct: 264 DGQAFQPVLDVLQRSAPVTVLDVPHAWSEWTRSVLASVDEVVITAVPDLANLRNTKNMLD 323

Query: 320 VLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKM 379
            L+K+RP DKPP+L+LNQV  PK+PEIS SDFC PL I P AIIPFD  +FG +ANSG+M
Sbjct: 324 ALRKMRPNDKPPHLILNQVGMPKRPEISPSDFCEPLEIDPIAIIPFDINLFGNAANSGRM 383

Query: 380 IHEVDPKSAIANLLVDFSRVLMGRVTVSK 408
           I EVDP+S  A      S  + GR  + K
Sbjct: 384 ISEVDPRSPTAETFSQISHFVTGRAAIRK 412


>gi|190889883|ref|YP_001976425.1| pilus assembly, two-component response regulator protein [Rhizobium
           etli CIAT 652]
 gi|190695162|gb|ACE89247.1| pilus assembly, two-component response regulator protein [Rhizobium
           etli CIAT 652]
          Length = 425

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/389 (52%), Positives = 286/389 (73%), Gaps = 4/389 (1%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
           E+M  LPRISVH FC ++TL +V+ER   D RM++V++RIT G IA A + FS + TP+L
Sbjct: 27  EAMRPLPRISVHAFCESETLQNVMERCANDRRMAKVSLRITSGGIAAAANMFSGAPTPNL 86

Query: 81  IIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA 140
           II++TK +   +L+ L PLA VCD  TKV+++G  ND+ LYR LI N +SEY+++P+++ 
Sbjct: 87  IILETKANVGSLLAELAPLAAVCDPTTKVVIVGYYNDIGLYRELIRNGISEYMVQPVAMP 146

Query: 141 DIINSISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADL 199
           DI+ ++++IF  P+ E  G S   I+FIGS+GGVG+STIAHNCAF I+++F+ ET+LADL
Sbjct: 147 DILAAMASIFVDPEAEPLGRS---IAFIGSKGGVGASTIAHNCAFGISNLFSTETILADL 203

Query: 200 DLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDF 259
           DLPYGTANI+FD+DP   I++A++   R+D+ F+ RL    +E+LS+L AP++L R YDF
Sbjct: 204 DLPYGTANIDFDQDPAQGIAEAVFAPDRLDEVFLDRLLTKCSEHLSLLAAPSLLDRAYDF 263

Query: 260 DEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLID 319
           D +   PVLD+L++  P+ +LDVPH W+ WT+ VL   D+VVI    DLA LRN+KN++D
Sbjct: 264 DGQAFQPVLDVLQRSAPVTVLDVPHAWSEWTRSVLASVDEVVIAAVPDLANLRNTKNMLD 323

Query: 320 VLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKM 379
            L+K+RP DKPP+L+LNQV  PK+PEIS SDFC PL I P AIIPFD  +FG +ANSG+M
Sbjct: 324 ALRKMRPNDKPPHLILNQVGMPKRPEISPSDFCEPLEIDPIAIIPFDINLFGNAANSGRM 383

Query: 380 IHEVDPKSAIANLLVDFSRVLMGRVTVSK 408
           I EVDP+S  A      S ++ GR  + K
Sbjct: 384 ISEVDPRSPTAETFSQISHIVTGRAAIRK 412


>gi|222147180|ref|YP_002548137.1| component of type IV pilus [Agrobacterium vitis S4]
 gi|221734170|gb|ACM35133.1| component of type IV pilus [Agrobacterium vitis S4]
          Length = 428

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 209/429 (48%), Positives = 299/429 (69%), Gaps = 11/429 (2%)

Query: 3   IGYD--GHNSDFLENE----DNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQV 56
           I YD  G   D L  E     NL E +  LPRISVH FC++D++ +V+E +  D RM++V
Sbjct: 4   IKYDIAGSKEDGLAAEPVRTGNL-EQLRPLPRISVHAFCISDSVLAVMEEAARDRRMAKV 62

Query: 57  NMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTN 116
           +MR+T G I+ AV+ F+ + TP+L+I++T      +LS L PLA+VCD  T+VIV+G  N
Sbjct: 63  SMRVTSGGISAAVNMFAGAPTPNLVILETDAKPENLLSELAPLADVCDPSTRVIVVGRYN 122

Query: 117 DVSLYRALISNHVSEYLIEPLSVADIINSISAIFT-PQEEGKGSSGCSISFIGSRGGVGS 175
           D++LYR L+ N VS+Y++ P+S+AD+I ++S+IF  P  E  G S   I+FIG++GGVGS
Sbjct: 123 DIALYRELMRNGVSDYIVAPVSMADVIGALSSIFIDPDAEPLGRS---IAFIGAKGGVGS 179

Query: 176 STIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSR 235
           STIAHN AF IAS+F+ ET+LADLDLPYGTANI+FD+DP   +++A++   R+D+ F+ R
Sbjct: 180 STIAHNAAFMIASLFSSETILADLDLPYGTANIDFDQDPAQGVAEAVFAPERLDEVFLDR 239

Query: 236 LPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLT 295
           L    ++NLS+L AP++L R YDF+    +P+L+ L++  P+ +LD+PH WN WT  +L+
Sbjct: 240 LLTSCSQNLSLLAAPSLLDRAYDFERGAFLPLLETLQRSAPVAVLDLPHSWNEWTLALLS 299

Query: 296 LSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPL 355
             D++V+T   DLA LRN KNL+D LK+LRP DK P+L+LNQ   PK+PEIS SDF  PL
Sbjct: 300 EVDEIVLTCVPDLANLRNVKNLLDALKRLRPNDKAPHLILNQAGMPKRPEISPSDFFEPL 359

Query: 356 GITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYT 415
            + P+AIIPFD  +FG +ANSG+MI E+D KS  A      + ++ GRV++ KP+ A  +
Sbjct: 360 DMQPAAIIPFDIQLFGNAANSGRMIAEIDAKSPTAETFSQLAHLITGRVSIKKPKKAGLS 419

Query: 416 KIKKIFNMK 424
            I  +   K
Sbjct: 420 TIFAMLARK 428


>gi|218671621|ref|ZP_03521290.1| pilus assembly, two-component response regulator protein [Rhizobium
           etli GR56]
          Length = 425

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 206/389 (52%), Positives = 284/389 (73%), Gaps = 4/389 (1%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
           E+M  LPRISVH FC ++TL  V+ER   D RM++V++RIT G IA A + FS + TP+L
Sbjct: 27  EAMRPLPRISVHAFCESETLQHVMERCANDRRMAKVSLRITSGGIAAAANMFSGAPTPNL 86

Query: 81  IIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA 140
           II++TK +   +L+ L PLA VCD  TKV+++G  ND+ LYR LI N +SEY+++P+++ 
Sbjct: 87  IILETKANVGSLLAELAPLAAVCDPTTKVVIVGYYNDIGLYRELIRNGISEYMVQPVAMP 146

Query: 141 DIINSISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADL 199
           DI+ ++++IF  P+ E  G S   I+FIGS+GG GSSTIAHNCAF I+++F+ ET+LADL
Sbjct: 147 DILAAMASIFVDPEAEPLGRS---IAFIGSKGGTGSSTIAHNCAFGISNLFSTETILADL 203

Query: 200 DLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDF 259
           DLPYGTANI+FD+DP   I++A++   R+D+ F+ RL    +E+LS+L AP++L R YDF
Sbjct: 204 DLPYGTANIDFDQDPAQGIAEAVFAPDRLDEVFLDRLLTKCSEHLSLLAAPSLLDRAYDF 263

Query: 260 DEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLID 319
           D +   PVLD+L++  P+ +LDVPH W+ WT+ VL   D+VVI    DLA LRN+KN++D
Sbjct: 264 DGQAFQPVLDVLQRSAPVTVLDVPHAWSEWTRSVLASVDEVVIAAVPDLANLRNTKNMLD 323

Query: 320 VLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKM 379
            L+K+RP DKPP+L+LNQV  PK+PEIS SDFC PL I P AIIPFD  +FG +ANSG+M
Sbjct: 324 ALRKMRPNDKPPHLILNQVGMPKRPEISPSDFCEPLEIDPIAIIPFDINLFGNAANSGRM 383

Query: 380 IHEVDPKSAIANLLVDFSRVLMGRVTVSK 408
           I EVDP+S  A      S ++ GR  + K
Sbjct: 384 ISEVDPRSPTAETFSQISHIVTGRAAIRK 412


>gi|222084471|ref|YP_002543000.1| pilus assembly protein [Agrobacterium radiobacter K84]
 gi|221721919|gb|ACM25075.1| pilus assembly protein [Agrobacterium radiobacter K84]
          Length = 423

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/385 (51%), Positives = 284/385 (73%), Gaps = 4/385 (1%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
           E+M  LPRISVH FC ++ L+ V++R   D RMS+VN+RIT GS A A + F+ + TP+L
Sbjct: 25  ENMRPLPRISVHAFCESEQLHQVMDRCANDRRMSKVNLRITGGSTAAAANMFASAPTPNL 84

Query: 81  IIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA 140
           II++T+ + + +L+ L PLA VCD  TKV+++G  ND+SLYR LI N +SEY+++P+++ 
Sbjct: 85  IILETRANPQNLLAELAPLAAVCDPTTKVVIVGHHNDISLYRELIRNGISEYIVQPVTMT 144

Query: 141 DIINSISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADL 199
           DI+ +++AIF  P  E  G S   ++FIG++GGVG+STIAHNCAF I+++F++ET+LADL
Sbjct: 145 DIMAAMAAIFVDPDAEPIGRS---VAFIGAKGGVGASTIAHNCAFGISNLFSVETILADL 201

Query: 200 DLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDF 259
           DLPYGTANI+FD+DP   I++A++   R+D+ F+ RL    +++LS+L AP+ML R YDF
Sbjct: 202 DLPYGTANIDFDQDPAQGIAEAVFAPERLDEVFLDRLLTKCSQHLSLLAAPSMLDRAYDF 261

Query: 260 DEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLID 319
           + +   PVLD+L++  P+ +LD+PH+W  WT+ VL+  D+VVI    DLA LRN+KN++D
Sbjct: 262 EGQAFQPVLDVLQRSAPVTVLDMPHLWTEWTRSVLSSVDEVVICAVPDLANLRNAKNMLD 321

Query: 320 VLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKM 379
            L+KLRP DK P+L+LNQV  PK+PEI  S+FC PL   P AIIPFD  +FG +ANSG+M
Sbjct: 322 ALRKLRPNDKAPHLILNQVGMPKRPEIGPSEFCEPLETDPIAIIPFDINLFGNAANSGRM 381

Query: 380 IHEVDPKSAIANLLVDFSRVLMGRV 404
           I E DPKS IA      S ++ GRV
Sbjct: 382 ISETDPKSPIAETFSQISHIVTGRV 406


>gi|159184216|ref|NP_353252.2| components of type IV pilus [Agrobacterium tumefaciens str. C58]
 gi|159139545|gb|AAK86037.2| components of type IV pilus [Agrobacterium tumefaciens str. C58]
          Length = 427

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/400 (50%), Positives = 284/400 (71%), Gaps = 4/400 (1%)

Query: 26  LPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQT 85
           LPRIS+H FCV+DT+ +V+E    D R+S+V +R+T+G I  A + FS S TP+LII++T
Sbjct: 31  LPRISIHAFCVSDTMQAVMEALSSDRRLSRVTLRVTKGDINAAATMFSASPTPNLIILET 90

Query: 86  KVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINS 145
              +  +L+ L PLAEVCD  T+VI+IG  ND++LYR LI N +SEYL+ P+++AD++ S
Sbjct: 91  ASATASLLNDLAPLAEVCDPSTRVIIIGRHNDITLYRDLIRNGISEYLVAPVNMADLLGS 150

Query: 146 ISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYG 204
           I+AIF  P+ E  G +   I+FIG++GGVGSSTIAHNCAF I+S+F+ ET+LAD+DL YG
Sbjct: 151 IAAIFVDPEAEPLGRN---IAFIGAKGGVGSSTIAHNCAFGISSLFSTETILADMDLAYG 207

Query: 205 TANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMI 264
           TANI+FD+DP   +++A++   R+D+ F+ RL    +++LS+L AP++L RTYD D +  
Sbjct: 208 TANIDFDQDPAQGMAEAVFSPERLDEVFLDRLLTKCSDHLSLLAAPSLLDRTYDLDRQAF 267

Query: 265 VPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL 324
           +P+L++L++  P+ +LD+PH W  WT+ VL  +D+VVIT   DLA LRN+KNL D L KL
Sbjct: 268 LPILEVLQRSAPVAVLDLPHQWCDWTRAVLAEADEVVITAVPDLANLRNTKNLFDALIKL 327

Query: 325 RPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVD 384
           RP DK P+LVLNQV  PK+PEI+ +DF  PL I P AIIPFD  +FG +ANSG+MI E+D
Sbjct: 328 RPNDKLPHLVLNQVGMPKRPEITPADFLEPLEIEPIAIIPFDAQLFGNAANSGRMISEMD 387

Query: 385 PKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMK 424
            KS  A      +  + GR  + K +     K+K I   K
Sbjct: 388 EKSQTAETFSQIAHTITGRSVLRKNRRGGLEKLKNILKRK 427


>gi|163757629|ref|ZP_02164718.1| pilus assembly protein, response regulator protein [Hoeflea
           phototrophica DFL-43]
 gi|162285131|gb|EDQ35413.1| pilus assembly protein, response regulator protein [Hoeflea
           phototrophica DFL-43]
          Length = 428

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 191/399 (47%), Positives = 274/399 (68%), Gaps = 2/399 (0%)

Query: 26  LPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQT 85
           LPRISVH F  T+ L   +ER   D RM++VN+R+  G ++ A + F+ S TP+L+I++T
Sbjct: 32  LPRISVHAFYETEGLAKTMERCGEDRRMAKVNLRVNSGGVSAATNMFASSPTPNLLILET 91

Query: 86  KVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINS 145
             D   +++ L  LA  CD  T+V+VIG  NDVSLYR L+ N VSEY++ P+S+AD+I  
Sbjct: 92  NADGATLIAELGELANYCDPDTRVVVIGHVNDVSLYRELVRNGVSEYIVAPVSMADVIGV 151

Query: 146 ISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGT 205
           +S+IF   E      G SI+F+G++GGVGSST+AHNCA+SI+S+F+ E +LADLDL +GT
Sbjct: 152 VSSIFVDPE--AAPLGKSIAFVGAKGGVGSSTLAHNCAWSISSLFSSEVILADLDLAFGT 209

Query: 206 ANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIV 265
           AN+NFD DP   I++A++   R+D+ F+ RL    +E+LS+L AP+ML RTYDF     +
Sbjct: 210 ANLNFDNDPTQGIAEAVFSPDRLDEVFLDRLLAKCSEHLSMLAAPSMLDRTYDFSGDAFL 269

Query: 266 PVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
           P+L+I+++  P+ +LDVPH+W+ W++++L+ +D+VVIT + DLA LRN+KNL D L+KLR
Sbjct: 270 PILEIVQRNAPVSVLDVPHIWSDWSRKILSAADEVVITATPDLANLRNTKNLFDTLRKLR 329

Query: 326 PADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDP 385
           P D PP+L+LNQV   K+PEI+   FC PL I P AIIPFD  +FG +ANSG MI E   
Sbjct: 330 PNDHPPFLILNQVGMAKRPEIAPEVFCDPLEIEPLAIIPFDAPLFGEAANSGLMISESAA 389

Query: 386 KSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMK 424
           KS +A      + V+ GR  + K + A    +  +   K
Sbjct: 390 KSPVAESFSQIAHVVTGRAEMKKRKKAGLASLMGMLGRK 428


>gi|325291657|ref|YP_004277521.1| components of type IV pilus [Agrobacterium sp. H13-3]
 gi|325059510|gb|ADY63201.1| components of type IV pilus [Agrobacterium sp. H13-3]
          Length = 428

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/400 (49%), Positives = 281/400 (70%), Gaps = 4/400 (1%)

Query: 26  LPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQT 85
           LPRISVH FCV++ +  V++    D RMS+V +R+T+G I  A + FS S TP+LI+++T
Sbjct: 32  LPRISVHAFCVSENMQRVIDALSSDRRMSKVTLRVTKGDINAAATMFSASPTPNLIVLET 91

Query: 86  KVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINS 145
                 +L  L PLAEVCD  T+VI++G  ND++LYR LI N +SEYL+ P+++AD++ S
Sbjct: 92  ASSPASLLDDLAPLAEVCDPTTRVIIVGRHNDITLYRDLIRNGISEYLVAPINMADLLAS 151

Query: 146 ISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYG 204
           I+ IF  P+ E  G +   I+FIG++GGVGSSTIAHNCAF I+++F+ ET+LAD+DL YG
Sbjct: 152 IATIFVDPEAEPLGRN---IAFIGAKGGVGSSTIAHNCAFGISTLFSTETILADMDLAYG 208

Query: 205 TANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMI 264
           TANI+FD+DP   +++A++   R+D+ F+ RL    +++LS+L AP++L RTYDFD +  
Sbjct: 209 TANIDFDQDPAQGMAEAVFSPERLDEVFLDRLLTKCSDHLSLLAAPSLLDRTYDFDRQAF 268

Query: 265 VPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL 324
           +P+L++L++  P+ +LD+PH W  WT+ VL  +D+VVIT   DLA LRN+KNL D L KL
Sbjct: 269 LPILEVLQRSAPVAVLDLPHQWCDWTRAVLAEADEVVITAVPDLANLRNTKNLFDALIKL 328

Query: 325 RPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVD 384
           RP DK P+LVLNQV  PK+PEI+ +DF  PL I P AIIPFD  +FG +ANSG+MI E+D
Sbjct: 329 RPNDKLPHLVLNQVGMPKRPEIAPADFLDPLEIEPVAIIPFDTQLFGNAANSGRMISEMD 388

Query: 385 PKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMK 424
            KS IA      +  + GR  + K +     K+K I   K
Sbjct: 389 EKSQIAETFSQIAHTITGRTILRKNKRGGLDKLKNILKRK 428


>gi|218682229|ref|ZP_03529830.1| putative pilus assembly protein [Rhizobium etli CIAT 894]
          Length = 383

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/373 (52%), Positives = 274/373 (73%), Gaps = 4/373 (1%)

Query: 37  TDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSAL 96
           ++ L  ++ER   D R+++V+MRIT G IA A + FS + TP+LII++TK ++  +L  L
Sbjct: 1   SEALQHIMERCANDRRVAKVSMRITSGGIAAAANMFSGAPTPNLIILETKANAANLLGEL 60

Query: 97  EPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFT-PQEE 155
            PLA VCD  TKV++IG  ND+ LYR LI N +SEY+++P+++ DI+ S+++IF  P+ E
Sbjct: 61  APLAAVCDPSTKVVIIGYYNDIGLYRELIRNGISEYMVQPVAMPDILASMASIFVDPEAE 120

Query: 156 GKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPI 215
             G S   ++FIGS+GG G+STIAHNCAF I+++F+ ET+LADLDLPYGTANI+FD+DP 
Sbjct: 121 PLGRS---VAFIGSKGGTGASTIAHNCAFGISNLFSTETILADLDLPYGTANIDFDQDPA 177

Query: 216 NSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIF 275
             I++A++   R+D+ F+ RL    +E+LS+L AP++L R YDFD +   PVLD+L++  
Sbjct: 178 MGIAEAVFAPDRLDEVFLDRLLTKCSEHLSLLAAPSLLDRAYDFDGQAFQPVLDVLQRSA 237

Query: 276 PLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVL 335
           P+ +LDVPH W+ WT+ VL+  D+VVIT   DLA LRN+KN++D L+K+RP DKPP+L+L
Sbjct: 238 PVTVLDVPHAWSEWTRSVLSSVDEVVITAVPDLANLRNAKNMLDALRKMRPNDKPPHLIL 297

Query: 336 NQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVD 395
           NQV  PK+PEIS SDFC PL I P AIIPFD  +FG +ANSG+MI EVDPKS  A     
Sbjct: 298 NQVGMPKRPEISPSDFCEPLEIDPIAIIPFDINLFGNAANSGRMISEVDPKSPTAETFSQ 357

Query: 396 FSRVLMGRVTVSK 408
            S ++ GRV + K
Sbjct: 358 ISHIVTGRVAIRK 370


>gi|319785606|ref|YP_004145082.1| response regulator receiver protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317171494|gb|ADV15032.1| response regulator receiver protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 429

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 180/405 (44%), Positives = 282/405 (69%), Gaps = 6/405 (1%)

Query: 2   NIGYDG--HNSDFLENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMR 59
           N+ YD     SD  + +    +++  +PRIS+  FC T+ + + VER+  D RM++ +++
Sbjct: 5   NLAYDAPVDGSDTSQQDIAAMQALRPIPRISIQAFCETEGVANPVERAGEDRRMTKAHLK 64

Query: 60  ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS 119
           +  G +  A+  +  + TP+LI+++++ + +++L  L  L+E CD  +KV+VIG  NDV 
Sbjct: 65  VHMGGVPTAIEFYQSAPTPNLILLESRSEPKQLLEQLAQLSEYCDPTSKVVVIGHYNDVG 124

Query: 120 LYRALISNHVSEYLIEPLSVADIINSISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTI 178
           LYR LI N +SEY+I P+S+ADI++ +S+IF  P+ E  G S   I+F+G++GGVGSSTI
Sbjct: 125 LYRELIRNGISEYVIAPVSMADIVSVVSSIFIDPEAEPLGRS---IAFVGAKGGVGSSTI 181

Query: 179 AHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPV 238
           AHN A++++S+F  E ++ADLDL +GTANINFD+DP   I++A++   RID+ ++ RL  
Sbjct: 182 AHNVAWAMSSLFKSEVVVADLDLAFGTANINFDQDPAQGIAEAVFSPERIDEVYLDRLLT 241

Query: 239 FYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSD 298
             AE+LS+L AP+ L R YDFD +  V ++D  ++  PL++LDVPH W  WT+  L  +D
Sbjct: 242 QCAEHLSLLAAPSTLERVYDFDPEAFVQLIDTAQRSVPLLVLDVPHAWTGWTKNTLVKAD 301

Query: 299 KVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGIT 358
           ++VIT + +LA LRN+KNLID+LK+LRP D PP L++NQ   PK+PEIS +DF  PLG++
Sbjct: 302 EIVITATPELANLRNTKNLIDMLKRLRPNDPPPKLIINQAGVPKRPEISPADFAEPLGLS 361

Query: 359 PSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGR 403
           P ++I FD  +FG +AN+G+M+ E+D K+ I  ++ + + VL GR
Sbjct: 362 PMSVIAFDPLLFGNAANNGRMLGEMDAKNPIVAMINEMAHVLTGR 406


>gi|110636323|ref|YP_676531.1| response regulator receiver protein [Mesorhizobium sp. BNC1]
 gi|110287307|gb|ABG65366.1| response regulator receiver protein [Chelativorans sp. BNC1]
          Length = 422

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 176/409 (43%), Positives = 275/409 (67%), Gaps = 6/409 (1%)

Query: 15  NEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSD 74
           ++D L + +  +PRIS+  FC TD +   + R+  D RM++ ++++  G +  A+  +  
Sbjct: 16  DQDGLLQMLRPIPRISIQAFCETDAVAGAIRRAGEDRRMAKTHLKVQMGGLPAAIEHYRT 75

Query: 75  SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLI 134
           ++TP+L++++T+++ RE+ + L   AEVCD  TKV+VIG+ NDV LYR L+   +SEY++
Sbjct: 76  AATPNLVLLETRMEPRELTAQLGSFAEVCDPSTKVVVIGNHNDVWLYRELVRAGISEYMV 135

Query: 135 EPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMET 194
            P+ +ADI+  I+ IF   + G    G SI+F+G++GGVGSST+AHN A+S++S+F  E 
Sbjct: 136 APVLMADIVAVIANIFV--DPGAEPLGRSIAFVGAKGGVGSSTLAHNIAWSMSSLFESEV 193

Query: 195 LLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLS 254
           ++ADLDLP+GTANINFD+DP   I++A++   R+D+ ++ RL    AE LS+L AP+ L 
Sbjct: 194 VVADLDLPFGTANINFDQDPAQGIAEAVFAPERVDEVYLDRLLAQCAERLSLLAAPSTLD 253

Query: 255 RTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNS 314
           R YD D +    ++D  ++  P+V+LDVPH+W  W +  L  +D +VIT + +LA LRN+
Sbjct: 254 RVYDLDGEAFSQIIDTAQRTAPMVVLDVPHLWTGWARTTLMRADDIVITATPELANLRNT 313

Query: 315 KNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSA 374
           KNL+D+LK LRP D PP L++NQ   PK+PEI   DF  PLGITP A+IPF+  +FG +A
Sbjct: 314 KNLVDMLKMLRPNDGPPKLIINQANVPKRPEIKPEDFSEPLGITPLAVIPFEPQLFGTAA 373

Query: 375 NSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQ----SAMYTKIKK 419
           N+G+M+ E D    IA  + + + VL GR  V+  +    +A+  ++KK
Sbjct: 374 NNGRMLGETDRNHTIAKTIDELAHVLSGRREVTPKKRSGLAALLGRLKK 422


>gi|153008061|ref|YP_001369276.1| response regulator receiver protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151559949|gb|ABS13447.1| response regulator receiver protein [Ochrobactrum anthropi ATCC
           49188]
          Length = 428

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/405 (45%), Positives = 278/405 (68%), Gaps = 2/405 (0%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
           E++  +PRIS+  FCV +++   +ER+  D RM++ ++++  G IA A   +  +STP+L
Sbjct: 25  ENVRPIPRISIQAFCVNESVAIPIERAGGDRRMAKTHLKVMMGGIAAATEFYQTASTPNL 84

Query: 81  IIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA 140
           IIV++  +   +L  L+ L+EVCDSG+KV+VIG +N+V LYR L+   VSEY++ P+S+A
Sbjct: 85  IIVESASEPNVLLEELQQLSEVCDSGSKVMVIGHSNEVWLYRELLRRGVSEYIVAPVSLA 144

Query: 141 DIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLD 200
           DI+  +S+IF   + G    G SI+FIG++GGVG+STIAHN A+SI+ +F  + +LAD+D
Sbjct: 145 DILAIVSSIFL--DPGAEPLGRSIAFIGAKGGVGASTIAHNVAWSISDLFRHDVVLADMD 202

Query: 201 LPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFD 260
           LP+GTANINFD+DP   I+DA++   RID+ ++ RL V Y ++LSIL AP+ L RT+DF 
Sbjct: 203 LPFGTANINFDQDPTLGIADAVFSPERIDEVYLDRLLVQYDDHLSILAAPSSLERTFDFG 262

Query: 261 EKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDV 320
           E     ++D+ ++  PL++LDV H W+ WT+  L  +D+VVI  + DLA LRN+KNL+D 
Sbjct: 263 EDAFAEMIDVAQRNSPLIVLDVAHGWSGWTRTTLMRADEVVIVATPDLANLRNTKNLLDT 322

Query: 321 LKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMI 380
           L +LRP D  P+LVLNQ+  PK+PEI+++DF  PLGI P A I FD  +FG +AN+G+MI
Sbjct: 323 LAQLRPNDVKPHLVLNQMGIPKRPEIALADFAEPLGIDPVATIDFDPQLFGNAANNGRMI 382

Query: 381 HEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMKC 425
            E +P+S IA  +   + V+ GR  V   + +  + +   F  K 
Sbjct: 383 AETNPESPIAEAISHIAHVVTGRADVQPRKKSSISSLLGKFARKT 427


>gi|239833235|ref|ZP_04681564.1| response regulator receiver protein [Ochrobactrum intermedium LMG
           3301]
 gi|239825502|gb|EEQ97070.1| response regulator receiver protein [Ochrobactrum intermedium LMG
           3301]
          Length = 426

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/405 (45%), Positives = 278/405 (68%), Gaps = 2/405 (0%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
           E++  +PRIS+  FCV +++   +ER+  D RM++ ++++  G +A A+  +  +STP+L
Sbjct: 23  ENVRPIPRISIQAFCVNESVAIPIERAGGDRRMAKTHLKVMMGGVAAAIEFYQTASTPNL 82

Query: 81  IIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA 140
           IIV++  +   +L  L+ L+EVCD G+KV+VIG +N+V LYR L+   VSEY++ P+S+A
Sbjct: 83  IIVESASEPNVLLEELQQLSEVCDPGSKVMVIGHSNEVWLYRELLRRGVSEYIVAPVSLA 142

Query: 141 DIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLD 200
           DI+  +S+IF   + G    G SI+FIG++GGVG+STIAHN A+SI+++F  + +LAD+D
Sbjct: 143 DILAIVSSIFL--DPGAEPLGRSIAFIGAKGGVGASTIAHNVAWSISNMFRHDVVLADMD 200

Query: 201 LPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFD 260
           LP+GTANINFD+DP   I+DA++   RID+ ++ RL V Y ++LSIL AP+ L RT+DF 
Sbjct: 201 LPFGTANINFDQDPTLGIADAVFSPERIDEVYLDRLLVQYGDHLSILAAPSSLERTFDFA 260

Query: 261 EKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDV 320
           E     ++D+ ++  PLV+LDV H W+ WT+  L   D+VVI  + DLA LRN+KNL+D 
Sbjct: 261 EDAFAELIDVAQRSSPLVVLDVAHGWSGWTRTTLMRVDEVVIVATPDLANLRNTKNLLDT 320

Query: 321 LKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMI 380
           L +LRP D  P+LVLNQ+  PK+PEI+I+DF  PLGI P A I FD  +FG +AN+G+MI
Sbjct: 321 LAQLRPNDVKPHLVLNQMGIPKRPEIAIADFAEPLGIDPIATIDFDPQLFGNAANNGRMI 380

Query: 381 HEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMKC 425
            E +P+S IA  +   + V+ GR  V   + +  + +   F  K 
Sbjct: 381 AETNPESPIAEAISHIAHVVTGRADVQPRKKSGISSLLGKFARKT 425


>gi|260461947|ref|ZP_05810192.1| response regulator receiver protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259032194|gb|EEW33460.1| response regulator receiver protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 429

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 179/414 (43%), Positives = 280/414 (67%), Gaps = 6/414 (1%)

Query: 2   NIGYDG--HNSDFLENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMR 59
           N+ YD      D    +    +++  +PRIS+  FC T+ + + VER+  D RM++ +++
Sbjct: 5   NLAYDATVDGGDTSPQDIAAMQALRPIPRISIQAFCETEGVANPVERAGEDRRMTKAHLK 64

Query: 60  ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS 119
           +  G +  AV  +  + TP+LI+++++ + +++L  L  L+E CD  +KV+VIG  NDV 
Sbjct: 65  VHMGGVPTAVEFYQSAPTPNLILLESRSEPKQLLEQLAQLSEYCDPSSKVVVIGHYNDVG 124

Query: 120 LYRALISNHVSEYLIEPLSVADIINSISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTI 178
           LYR LI + +SEY+I P+S+ADI++ +S+IF  P+ E  G S   ++FIG++GGVGSSTI
Sbjct: 125 LYRELIRSGISEYVIAPVSMADIVSVVSSIFVDPEAEPLGRS---VAFIGAKGGVGSSTI 181

Query: 179 AHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPV 238
           AHN A++++S+F  E ++ADLDL +GTANINFD+DP   I++A++   RID+ ++ RL  
Sbjct: 182 AHNVAWAMSSLFKSEVVVADLDLAFGTANINFDQDPAQGIAEAVFSPERIDEVYLDRLLT 241

Query: 239 FYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSD 298
             AE+LS+L AP+ L R YDFD      ++D  ++  PL++LDVPHVW  W +  L  +D
Sbjct: 242 QCAEHLSLLAAPSTLERVYDFDPDAFAQLVDTAQRSVPLLVLDVPHVWTGWAKNTLVKAD 301

Query: 299 KVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGIT 358
           ++VIT + +LA LRN+KNL+D+LK+LRP D PP L++NQ   PK+PEIS SDF  PLG+T
Sbjct: 302 EIVITATPELANLRNTKNLVDMLKRLRPNDPPPKLIINQAGIPKRPEISPSDFAEPLGLT 361

Query: 359 PSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSA 412
           P ++I FD  +FG +AN+G+M+ E+D K+ +   + + + VL GR  +   + A
Sbjct: 362 PMSVIGFDPVLFGNAANNGRMLGEMDAKNPVVATINEIAHVLTGRSEIKTKKKA 415


>gi|304392382|ref|ZP_07374323.1| pilus assembly protein CpaE [Ahrensia sp. R2A130]
 gi|303295486|gb|EFL89845.1| pilus assembly protein CpaE [Ahrensia sp. R2A130]
          Length = 545

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 175/398 (43%), Positives = 269/398 (67%), Gaps = 8/398 (2%)

Query: 26  LPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQT 85
           +PR+S+  FC TD + S + ++  D RM++ ++++  G I  AV+ +   +TP+LI+V++
Sbjct: 147 VPRVSIQAFCETDPVASKIHQTSQDRRMAKAHVKVDMGGIQAAVAHYQTVTTPNLILVES 206

Query: 86  KVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINS 145
            +  ++++S LE L+EVCD GT V+VIG  NDV LYR LIS  V+EYL  P+S+ +I+  
Sbjct: 207 SLVGQQLISELEQLSEVCDEGTNVVVIGHRNDVHLYRELISRGVAEYLFAPVSMTEIMEI 266

Query: 146 ISAIF-TPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYG 204
           + ++F  P+ E  G S   I+FIGS+GGVGSST+ HN A++I+  F  + +L DLDL +G
Sbjct: 267 VGSLFVNPEAEPLGQS---IAFIGSKGGVGSSTVCHNVAWAISDNFESDVVLTDLDLAFG 323

Query: 205 TANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMI 264
           TAN++FD+DP   +++A++   RID  F+ RL    +++LS+L AP+ L R YDFD    
Sbjct: 324 TANMDFDRDPPQGVAEAVFSADRIDDTFLDRLLEKCSDHLSLLAAPSTLDRDYDFDANDF 383

Query: 265 VPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL 324
             +L++ ++  P VI+D+PHVW  WT+E+L  +D+VVIT + DLA LRN+KNL+D L ++
Sbjct: 384 DQLLEVAQRGTPNVIIDLPHVWTGWTREILANADRVVITATPDLASLRNTKNLVDTLNEM 443

Query: 325 RPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVD 384
           RP D  P++VLNQ   PK+PEI +  F  PLG+ P+A+IPFD A+FG++AN+G+M+ E D
Sbjct: 444 RPNDSKPWIVLNQCNVPKRPEIDVESFMEPLGLQPAAVIPFDPALFGLAANNGQMVSETD 503

Query: 385 PKSAIANLLVDFSRVLMGRVTVSKPQ----SAMYTKIK 418
            K  IA +    + VL GR  +  P     S++  K+K
Sbjct: 504 AKHEIAQMFDTLASVLTGRRDIEPPAAKGLSSLLQKLK 541


>gi|114705453|ref|ZP_01438361.1| pilus assembly protein, response regulator protein [Fulvimarina
           pelagi HTCC2506]
 gi|114540238|gb|EAU43358.1| pilus assembly protein, response regulator protein [Fulvimarina
           pelagi HTCC2506]
          Length = 427

 Score =  365 bits (938), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 177/398 (44%), Positives = 269/398 (67%), Gaps = 3/398 (0%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
           E++  +PR+S+  FC +D + + ++ +  D R+++ N ++  G    A+  FS S TP+L
Sbjct: 23  ENVRPIPRVSIQAFCESDAVCATLQNAAKDRRVAKANFKVNMGGHRAALDHFSSSPTPNL 82

Query: 81  IIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA 140
           +I++T++D  E++ AL+ LA+VCD G+KV+VIG  NDV LYR L+   +SEYL+ P+S+A
Sbjct: 83  VIIETRMDPVELMEALDRLADVCDPGSKVVVIGHFNDVHLYRELMRCGISEYLVAPISLA 142

Query: 141 DIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLD 200
           D+I +IS IFT   E     G SI+F+G+RGGVGSST+AHN A+SI+ +F +E +LAD D
Sbjct: 143 DVIGAISDIFTA--ENAEPLGRSIAFLGARGGVGSSTVAHNVAWSISQLFEIEVILADCD 200

Query: 201 LPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFD 260
           L +GTANI+FD+DP   + +A+     +D+  + RL     E+LS+LTAP+ L RTY+FD
Sbjct: 201 LAFGTANIDFDRDPPQGMFEALTSYEEMDETLLDRLLSKCGEHLSLLTAPSTLDRTYEFD 260

Query: 261 EKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDV 320
            +    +++  ++  P+V LD PH+W  WT+ VL+  D+VV+T + DLA LRN+KN+ID 
Sbjct: 261 LEAYRILIETAQRTAPVVALDTPHLWTDWTRSVLSEVDQVVLTATPDLANLRNAKNIIDT 320

Query: 321 LKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMI 380
           L KLRP D PP LVLNQV   KKPEI+I +FC PL + PS ++ FD  +FG +AN G MI
Sbjct: 321 LAKLRPNDAPPALVLNQVGIAKKPEIAIEEFCEPLNLKPSMVLGFDPELFGNAANGGMMI 380

Query: 381 HEVDPKSAIANLLVDFSRVLMGR-VTVSKPQSAMYTKI 417
            +  P+  IA L  + +  L GR V  ++ + +++ ++
Sbjct: 381 RQSAPRHEIAKLFDELAHQLTGRGVAKTQKKPSLFDRL 418


>gi|90419766|ref|ZP_01227675.1| Flp pilus assembly protein, ATPase CpaE [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335807|gb|EAS49555.1| Flp pilus assembly protein, ATPase CpaE [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 430

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 183/391 (46%), Positives = 270/391 (69%), Gaps = 4/391 (1%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
           E++  +PRIS+  FC ++ +   +E +  D RM++ +MR+  G I  AV  FS + TP+L
Sbjct: 26  ENVRPIPRISIQAFCESEAVARPIENAGADRRMAKTHMRVNLGGIRAAVEHFSGAPTPNL 85

Query: 81  IIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA 140
           +I+++K+   E+++ LE L+EVCD G+KVI+IG  NDV+LYR L+   VSEYL+ P+S+A
Sbjct: 86  VILESKLPPLELIAELESLSEVCDPGSKVIIIGHYNDVALYRDLMHRGVSEYLVAPVSIA 145

Query: 141 DIINSISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADL 199
           DI+  I ++FT P  E  G S   I+F+G++GGVGSSTIAHN A+SI+ +F+ + ++ADL
Sbjct: 146 DIMTIIGSLFTAPDSEPLGRS---IAFVGAKGGVGSSTIAHNLAWSISKLFSSDVVIADL 202

Query: 200 DLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDF 259
           DLP+GTANINFD+DP   I++A++   R+D   + RL    AE+LS+L AP++L RTYDF
Sbjct: 203 DLPFGTANINFDQDPAQGIAEAVFSAERMDDTMLDRLLSKCAEHLSLLAAPSLLDRTYDF 262

Query: 260 DEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLID 319
             +    +++  ++  P+V LD+PHVWN WT+ VL  +D++VIT + DLA LRN+KNL+D
Sbjct: 263 STEAFSALIETAQRGAPVVALDIPHVWNDWTRSVLASADQIVITATPDLANLRNAKNLVD 322

Query: 320 VLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKM 379
           +L KLRP D  P+L+LNQ+  P++PEIS  +F  PLG+ P A I FD   FG +AN+G+M
Sbjct: 323 MLAKLRPNDPVPHLILNQLAIPRRPEISPEEFADPLGLEPIAQINFDPQAFGNAANNGQM 382

Query: 380 IHEVDPKSAIANLLVDFSRVLMGRVTVSKPQ 410
           + E+D K          + VL GR T  KP+
Sbjct: 383 LAELDGKHPAVEAFEHVAHVLTGRGTAKKPK 413


>gi|254503288|ref|ZP_05115439.1| hypothetical protein SADFL11_3327 [Labrenzia alexandrii DFL-11]
 gi|222439359|gb|EEE46038.1| hypothetical protein SADFL11_3327 [Labrenzia alexandrii DFL-11]
          Length = 400

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 177/399 (44%), Positives = 263/399 (65%), Gaps = 8/399 (2%)

Query: 26  LPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQT 85
           +PRI++H FC+ D    VVE +  D RM + +M+   G I  A+  F  + TP+LI+V+T
Sbjct: 2   IPRITIHAFCLEDRTMHVVEAATEDRRMLKAHMKAEMGGIPAAIDMFEKAPTPNLIVVET 61

Query: 86  KVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINS 145
                ++L +L+ LAE CD+GTKVIVIGD NDV+LYR LIS  VSEYLI P+S+  +I S
Sbjct: 62  SGAREDLLQSLDQLAEYCDAGTKVIVIGDVNDVTLYRDLISRGVSEYLITPVSIFQLIGS 121

Query: 146 ISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYG 204
           IS ++  P+ E  G +   ++F G +GG GSSTIAHN A+ +A  F  E ++ADLDLP+G
Sbjct: 122 ISNLYNDPEAEPLGRT---VAFYGVKGGCGSSTIAHNGAWCLARKFDSEVVIADLDLPFG 178

Query: 205 TANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMI 264
           TA +++++DP+  + +AI    R+D+ ++ R+    +++LS+L APA L RTYD  EK  
Sbjct: 179 TAGLDYNQDPLQGVFEAISAPERLDETYLDRILSKCSDHLSLLAAPATLERTYDHSEKTF 238

Query: 265 VPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL 324
             ++D +    P V+LDVPH WNSW +  L  +D++V+    DLA LRN+KN +D+LK++
Sbjct: 239 ELLIDTMRLGTPHVVLDVPHAWNSWIRNTLLNADEIVLVAEPDLANLRNAKNAVDLLKQI 298

Query: 325 RPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVD 384
           RP DK P+LV+N+V  PK+PEI   +F   LG++  A IPFD  +FG SAN+G+MI E+D
Sbjct: 299 RPNDKLPHLVMNKVNVPKRPEIKPDEFANALGLSVDAAIPFDPHLFGTSANNGQMIGELD 358

Query: 385 PKSAIANLLVDFSRVLMGRVTVSK----PQSAMYTKIKK 419
            K AIA +  D ++ + G+   +K    P   + +K+K+
Sbjct: 359 SKHAIAGMFQDLAQTISGKAQPAKTSKSPLGGLISKLKR 397


>gi|118589705|ref|ZP_01547110.1| putative pilus assembly protein cpaE [Stappia aggregata IAM 12614]
 gi|118437791|gb|EAV44427.1| putative pilus assembly protein cpaE [Stappia aggregata IAM 12614]
          Length = 435

 Score =  354 bits (908), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 169/380 (44%), Positives = 257/380 (67%), Gaps = 4/380 (1%)

Query: 25  SLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQ 84
           S+PRI+VH FC+TD    V E +  D RM++ ++++  G I  A+  F  + TP+LI+V+
Sbjct: 36  SIPRITVHGFCLTDATMRVAEAAMEDRRMAKAHLKLDMGGIPAAIETFEQAPTPNLIVVE 95

Query: 85  TKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIIN 144
           T     ++L +L+ LAE CD GTKVIVIGD NDV+LYR LIS  VSEYLI P++V  +I 
Sbjct: 96  TSGRREDLLPSLDHLAEYCDPGTKVIVIGDVNDVTLYRDLISRGVSEYLITPVNVFQLIG 155

Query: 145 SISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPY 203
           SI+ ++  P  E  G +   I+F G +GG G+STIAHN A+++A VF  E ++ADLDLP+
Sbjct: 156 SIANLYADPDAEPLGRT---IAFFGVKGGCGASTIAHNGAWALARVFQSEVVVADLDLPF 212

Query: 204 GTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKM 263
           GTA +++++DP+  + +A+    R+D+ ++ R+     ++LS+L APA L RTYD+ EK 
Sbjct: 213 GTAGLDYNQDPLQGVFEAVSSPERLDETYLDRILSKCNDHLSLLAAPATLERTYDYSEKS 272

Query: 264 IVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKK 323
              +++ +    P V+LDVPH WN+W +  L   D++V+    DLA LRN+KN++D+LK+
Sbjct: 273 FDQLVETMRAGVPSVVLDVPHAWNAWVKNTLLGVDEIVLVAEPDLANLRNAKNVVDMLKQ 332

Query: 324 LRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEV 383
           LRP D+PP+L++N+V  PK+PEI   +F   LG+T  A IPF+  +FG +AN+G+MI E+
Sbjct: 333 LRPNDRPPHLIMNKVNVPKRPEIKPDEFAGALGLTVHATIPFEPHLFGTAANNGQMIGEI 392

Query: 384 DPKSAIANLLVDFSRVLMGR 403
           D K AI+ +  D +  + G+
Sbjct: 393 DGKHAISRVFDDLAHTVSGK 412


>gi|218662339|ref|ZP_03518269.1| pilus assembly, two-component response regulator protein [Rhizobium
           etli IE4771]
          Length = 349

 Score =  350 bits (897), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 179/338 (52%), Positives = 249/338 (73%), Gaps = 4/338 (1%)

Query: 72  FSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSE 131
           FS + TP+LII++TK +   +L+ L PLA VCD  TKV+++G  ND+ LYR LI N +SE
Sbjct: 2   FSGAPTPNLIILETKANVGSLLAELAPLAAVCDPTTKVVIVGYYNDIGLYRELIRNGISE 61

Query: 132 YLIEPLSVADIINSISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVF 190
           Y+++P+++ DI+ ++++IF  P+ E  G S   I+FIGS+GG G+STIAHNCAF I+++F
Sbjct: 62  YMVQPVAMPDILAAMASIFVDPEAEPLGRS---IAFIGSKGGTGASTIAHNCAFGISNLF 118

Query: 191 AMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAP 250
           + ET+LADLDLPYGTANI+FD+DP   I++A++   R+D+ F+ RL    +E+LS+L AP
Sbjct: 119 STETILADLDLPYGTANIDFDQDPAQGIAEAVFAPDRLDEVFLDRLLTKCSEHLSLLAAP 178

Query: 251 AMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAG 310
           ++L R YDFD +   PVLD+L++  P+ +LDVPH W+ WT+ VL   D+VVIT   DLA 
Sbjct: 179 SLLDRAYDFDGQAFQPVLDVLQRSAPVTVLDVPHAWSEWTRSVLASVDEVVITAVPDLAN 238

Query: 311 LRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVF 370
           LRN+KN++D L+K+RP DKPP+L+LNQV  PK+PEIS SDFC PL I P AIIPFD  +F
Sbjct: 239 LRNTKNMLDALRKMRPNDKPPHLILNQVGMPKRPEISPSDFCEPLEIDPIAIIPFDINLF 298

Query: 371 GMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSK 408
           G +ANSG+MI EVDP+S  A      S ++ GR  + K
Sbjct: 299 GNAANSGRMISEVDPRSPTAETFSQISHIVTGRAAIRK 336


>gi|220922781|ref|YP_002498083.1| response regulator receiver protein [Methylobacterium nodulans ORS
           2060]
 gi|219947388|gb|ACL57780.1| response regulator receiver protein [Methylobacterium nodulans ORS
           2060]
          Length = 414

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 160/404 (39%), Positives = 258/404 (63%), Gaps = 2/404 (0%)

Query: 14  ENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFS 73
           +  D     +  +PRI++  FC T  + +V+E +  D RM + ++++  G  A A   F 
Sbjct: 3   DRTDPAERVIAPVPRITIQAFCETQDVAAVIESAAEDRRMQKAHLKVQMGGAAAATEAFR 62

Query: 74  DSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYL 133
            + TP++++++        L+ L+ LAEVCD+GTKV+VIG  NDV LYR  I   VSEYL
Sbjct: 63  SAPTPNVLLIEMHGGRTNPLAQLDSLAEVCDAGTKVVVIGHVNDVLLYRDFIRRGVSEYL 122

Query: 134 IEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAME 193
           I P+    +I +IS +F   E G    G +++ +G++GGVG+ST+AHN A++IA   A+ 
Sbjct: 123 IAPIDPVTVIAAISDLFA--EPGAEPLGRTVAVVGAKGGVGASTLAHNIAWAIARDHAVS 180

Query: 194 TLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAML 253
           T++ADLD+ +GTA +NF++DP   +++A++   RID  FV RL     +NLS+L APA L
Sbjct: 181 TVIADLDVAFGTAGLNFNQDPPQGVAEALFAPERIDANFVDRLLSKCTDNLSLLAAPATL 240

Query: 254 SRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRN 313
            RT DF E     ++DIL  + P ++LDVPHVW +W+++++  +D++++  + +LA LRN
Sbjct: 241 DRTNDFGEGAFDGLIDILRGMVPCIVLDVPHVWTAWSRKMVIGADEILVVAAPELASLRN 300

Query: 314 SKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMS 373
           ++NL D+L++ RP D+PP LVLNQV  P++PEI+ ++F   L +T +A++PFD A+FG +
Sbjct: 301 ARNLFDLLRQARPNDRPPRLVLNQVAMPRRPEIAAAEFAKALDVTAAAVVPFDPALFGAA 360

Query: 374 ANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKI 417
           AN+G+M+ E+   S I  +L +    + GR    K +  +   I
Sbjct: 361 ANNGQMLAELQTNSRITEILSELGGAVTGRAETKKARPTLLEPI 404


>gi|296444393|ref|ZP_06886358.1| response regulator receiver protein [Methylosinus trichosporium
           OB3b]
 gi|296258040|gb|EFH05102.1| response regulator receiver protein [Methylosinus trichosporium
           OB3b]
          Length = 417

 Score =  340 bits (872), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 161/403 (39%), Positives = 256/403 (63%), Gaps = 3/403 (0%)

Query: 22  SMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLI 81
            +  LPRISV  FC T    +++  + +D RM + ++++  G +A A+  F  + TP+LI
Sbjct: 15  QIAPLPRISVQAFCETQDFVALMNTAAVDRRMDKTHVKVHMGGVAAAIEAFRGAPTPNLI 74

Query: 82  IVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVAD 141
           I++T  D R+++  L+ LAE CD GTKV+V+G  ND++LYR LIS  VS+Y++ PL    
Sbjct: 75  ILETFGDRRQLIGQLDTLAESCDPGTKVVVLGHENDIALYRELISRGVSDYIVAPLDTLS 134

Query: 142 IINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDL 201
            I  +S ++T   E   S G  I+ +G++GGVG+S+IAHN A+SIA    M+T++ADLDL
Sbjct: 135 FIARLSELYTAAAE---SLGRIIAVVGAKGGVGASSIAHNLAWSIARALQMQTVIADLDL 191

Query: 202 PYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDE 261
           P+GTA ++F++DP   +++A++   R+D   V RL    ++ LS+L APA + R YD  E
Sbjct: 192 PFGTAGLDFNQDPPQGVAEAVFAPDRVDSNLVDRLLSKCSDQLSLLAAPATIDRLYDLPE 251

Query: 262 KMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL 321
                ++D+L    P  +LDVPH W++WT+ VL  +D++ I  + DLA LRN+K L+D L
Sbjct: 252 SAFDAIIDVLRATSPSTVLDVPHQWSAWTKRVLVGADQLAIVAAPDLASLRNTKTLLDTL 311

Query: 322 KKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIH 381
           +  R  D+ P ++LN V  P++PEI+ +DF   + I  +A+IPF+  +FG +AN+G+M+ 
Sbjct: 312 RLSRRNDQAPKVLLNMVGVPRRPEITPADFAKAIEIELAAVIPFEAKLFGSAANNGQMLA 371

Query: 382 EVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMK 424
           EV+P S I        R LMGR  + K +S ++  + + F+ +
Sbjct: 372 EVEPGSKIVESFDALGRELMGRTGLRKAKSGLFAPLIERFSRR 414


>gi|328545277|ref|YP_004305386.1| Flp pilus assembly protein, ATPase CpaE [polymorphum gilvum
           SL003B-26A1]
 gi|326415019|gb|ADZ72082.1| Flp pilus assembly protein, ATPase CpaE [Polymorphum gilvum
           SL003B-26A1]
          Length = 431

 Score =  338 bits (868), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 165/398 (41%), Positives = 256/398 (64%), Gaps = 4/398 (1%)

Query: 25  SLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQ 84
           S+PRIS+  FC+      V+E +  D RM++ ++++  G I  ++  +S + TP+LI+++
Sbjct: 31  SVPRISLQAFCIDPETAKVIEAAGEDRRMTKAHVKVHMGGIPASIEFYSQAPTPNLIVLE 90

Query: 85  TKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIIN 144
           +      +++ L+ LAE CD+GTKVIVIG  NDV+LYR LI   VSEYL+ P+SV  +I 
Sbjct: 91  SAAAPDVLVADLDRLAEFCDAGTKVIVIGHVNDVALYRELIHRGVSEYLVAPISVFQMIG 150

Query: 145 SISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPY 203
           ++  ++  PQ       G +I+F G +GG G+STIAHN A+SIA  F  E +LADLDLP+
Sbjct: 151 AVGELYCDPQ---SAPLGRTIAFFGVKGGCGASTIAHNVAWSIARDFQNEVVLADLDLPF 207

Query: 204 GTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKM 263
           GTA ++F++DP+  + +A+    R+D+ F+ R+    ++ LS+L APA L RTYD+ +  
Sbjct: 208 GTAGLDFNQDPLQGVYEAVSAPERLDETFLDRILSRCSDRLSLLAAPASLERTYDYSDTS 267

Query: 264 IVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKK 323
              ++D++ Q  P ++LDVPH WN W + +L  +D+V++    DLA LRN+KNL+D L+ 
Sbjct: 268 FDALVDVMRQGTPTIVLDVPHAWNGWVKHMLVAADEVIMVAEPDLANLRNAKNLVDTLRH 327

Query: 324 LRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEV 383
           LRP D PP+LV+N+V  PK+PEI   +F   L +   A IPF+  +FG +AN+G+MI E+
Sbjct: 328 LRPNDGPPHLVMNRVNIPKRPEIKPDEFAKALNLAVLAAIPFEPQLFGTAANNGQMIAEL 387

Query: 384 DPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIF 421
           D K AI  +    S+V+ GR  V K + + +  +  I 
Sbjct: 388 DGKHAINEVFNTVSQVVSGRSEVKKSRRSPFGSLLSIL 425


>gi|307943147|ref|ZP_07658492.1| pilus assembly protein CpaE [Roseibium sp. TrichSKD4]
 gi|307773943|gb|EFO33159.1| pilus assembly protein CpaE [Roseibium sp. TrichSKD4]
          Length = 429

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 168/400 (42%), Positives = 261/400 (65%), Gaps = 5/400 (1%)

Query: 23  MCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLII 82
           +  +PR+S+  FC+ +     +E +  D RM++ + ++  G I  A+  FS + TP+LI+
Sbjct: 31  LAPVPRVSIQAFCLNEQTARTLEAAGEDRRMAKAHTKVHLGGIKAAIEHFSQAPTPNLIV 90

Query: 83  VQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADI 142
           ++    S +VL+ L+ LAE CD+GT+VIVIGD NDV LYR L+   VS+YL+ P+ +  +
Sbjct: 91  IEVAAQSGDVLAQLDMLAEYCDAGTRVIVIGDLNDVKLYRDLVQAGVSDYLVTPVDIYQL 150

Query: 143 INSISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDL 201
           I S+S ++  P  E  G +   ++F G +GG GSST+AHN  +SI+  F  + ++ADLDL
Sbjct: 151 IGSVSNLYADPTAEPLGRA---VAFFGVKGGCGSSTVAHNTGWSISRQFQHDVVVADLDL 207

Query: 202 PYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDE 261
           P+GTA ++F++DPI  I +AI    R+D+  + R+    +E+LS+L APA L +TYD  E
Sbjct: 208 PFGTAGLDFNQDPIQGIHEAISAPDRLDQTLLDRILAKCSEHLSLLAAPATLDKTYDHGE 267

Query: 262 KMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL 321
                +LD++    P ++LDVPHVWN WT+ VLT +D+VVI    DLA LRN+KN++DVL
Sbjct: 268 AAFEILLDVMRASTPSIVLDVPHVWNGWTRNVLTTADEVVIVAEPDLANLRNAKNVVDVL 327

Query: 322 KKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIH 381
            +LRP D  P LV+N+V  PK+PEI   +F A LG+  +A IPF+  +FG +AN+G+MI 
Sbjct: 328 SQLRPNDNAPRLVINRVNVPKRPEIKPDEFAAALGLELAAEIPFEPQLFGTAANNGQMIS 387

Query: 382 EVDPKSAIANLLVDFSRVLMGRVTVSK-PQSAMYTKIKKI 420
           E++ K AI+    D +  ++G+   +K  +SA+ + + K+
Sbjct: 388 EINGKHAISETFSDLANTVLGKAVPTKSKKSALSSLMAKL 427


>gi|315497463|ref|YP_004086267.1| response regulator receiver protein [Asticcacaulis excentricus CB
           48]
 gi|315415475|gb|ADU12116.1| response regulator receiver protein [Asticcacaulis excentricus CB
           48]
          Length = 475

 Score =  330 bits (846), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 164/412 (39%), Positives = 247/412 (59%), Gaps = 4/412 (0%)

Query: 13  LENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCF 72
           +E  D+L     S+PRI +H F   DT     + + +D RM++    + RG I EA++ +
Sbjct: 67  IEPTDDLG--AVSIPRIGIHFFPKNDTTLQACDTAALDRRMARAQSLVRRGGIDEAIAVY 124

Query: 73  SDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEY 132
               TP L+IV++   +  +L  L  LAEVCD+ TKV+VIG  ND+SLYR LI   VSEY
Sbjct: 125 QQEPTPSLLIVESSEAAHGLLDQLGRLAEVCDTNTKVVVIGAHNDISLYRELIRQGVSEY 184

Query: 133 LIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAM 192
           ++ P+    +I SI+ +F   E      G +I+F+G+RGG GSS +AHN A S++ V   
Sbjct: 185 MVAPVKPLQLIKSIATLFNDPE--TPFVGRAIAFMGARGGAGSSVLAHNFAHSLSEVMQA 242

Query: 193 ETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAM 252
            T++AD DLP+GTA ++F++DP+  ++DA+    R+D+  + R+     E LS+ +APA 
Sbjct: 243 NTVIADYDLPFGTAGLDFNQDPLQGMADALNEPERLDQVLLDRMLTRCTERLSLFSAPAS 302

Query: 253 LSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLR 312
           L + Y  DE     V   +  + P +++D+PH+W  W ++ L  +D+VVI  + DLA LR
Sbjct: 303 LDQDYLADEHAFEEVTRKVRSVAPFIVMDLPHIWTPWLKKCLIAADEVVIVATPDLASLR 362

Query: 313 NSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGM 372
           N+KNLI++LK  RP D PP++VLNQ+  P +PEI + DF A LG+ P+  I FD   FG 
Sbjct: 363 NAKNLIELLKSFRPNDNPPHIVLNQIDMPGRPEIPVKDFTAALGVAPACTISFDAKTFGQ 422

Query: 373 SANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMK 424
           +AN+G+MI E  P S     L+  +  + GR   +K + A  + I K F  K
Sbjct: 423 AANNGQMIAECAPASKAHEALLALTATITGRTPETKKKPASTSLIGKFFPKK 474


>gi|75674497|ref|YP_316918.1| pilus assembly protein cpaE [Nitrobacter winogradskyi Nb-255]
 gi|74419367|gb|ABA03566.1| pilus assembly protein cpaE [Nitrobacter winogradskyi Nb-255]
          Length = 421

 Score =  330 bits (846), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 165/399 (41%), Positives = 252/399 (63%), Gaps = 9/399 (2%)

Query: 16  EDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDS 75
           ED+++ +    PR+SV  FC T    + V+ +  D R+++ +++I  G +  AV  +  +
Sbjct: 20  EDHIAPA----PRVSVQAFCETMETATAVQAASEDRRLAKAHLKIQMGGMTAAVEAYRSA 75

Query: 76  STPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIE 135
            TP++II++T+    ++L+AL+ LA VCD+GT+VIVIG  NDV+LYR L+   VS+YL+ 
Sbjct: 76  PTPNVIILETEGHG-DILAALDHLATVCDAGTRVIVIGRVNDVTLYRELVKRGVSDYLMA 134

Query: 136 PLSVADIINSISAIF-TPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMET 194
           P +  DI+ S+  +F TP+ +  G     I+  G++GGVG+STIAHN A++IA   A+++
Sbjct: 135 PAAPIDIVRSVCGLFSTPEAKAVGRI---IAIAGAKGGVGASTIAHNVAWAIARDLALDS 191

Query: 195 LLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLS 254
           ++ADLDL +GTA ++F++DP   I+DA++   RID AFV RL     ++LS+L APA L 
Sbjct: 192 VVADLDLAFGTAGLDFNQDPPQGIADAVFSPDRIDTAFVDRLLSKCTDHLSLLAAPATLD 251

Query: 255 RTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNS 314
           R YDF  +     LD L    P ++LD+PH W+ WT+  L  +D ++I  + DLA LRN+
Sbjct: 252 RVYDFGTEAFDSTLDTLRATMPCIVLDIPHQWSGWTRRALIGADDILIVATPDLANLRNT 311

Query: 315 KNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSA 374
           KNL D+LK  RP D+PP   LNQV  PK+PEIS  +F   +   P   IPFD  +FG +A
Sbjct: 312 KNLFDLLKVARPNDRPPLYCLNQVGVPKRPEISGGEFAKAIESQPVVSIPFDPHMFGSAA 371

Query: 375 NSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAM 413
           N+G+MI E+ P      + +  ++ L GR    KP+ + 
Sbjct: 372 NNGQMIAEIAPNHRATEMFLQIAQRLTGRGEAKKPRKSF 410


>gi|16127173|ref|NP_421737.1| pilus assembly protein CpaE [Caulobacter crescentus CB15]
 gi|221235974|ref|YP_002518411.1| pilus assembly ATPase cpaE [Caulobacter crescentus NA1000]
 gi|13424569|gb|AAK24905.1| pilus assembly protein CpaE [Caulobacter crescentus CB15]
 gi|220965147|gb|ACL96503.1| pilus assembly ATPase cpaE [Caulobacter crescentus NA1000]
          Length = 517

 Score =  328 bits (842), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 158/394 (40%), Positives = 247/394 (62%), Gaps = 2/394 (0%)

Query: 26  LPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQT 85
           +PRI++H FC      +++E++  D RMS+    +  G +  AV  + +  TP L++V+T
Sbjct: 124 IPRITIHAFCARPETAALIEKAAADRRMSRAATIVRDGGLEAAVDYYQNQPTPSLVMVET 183

Query: 86  KVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINS 145
              ++ +L  L+ LA+VCD GTKV+V+G TND++LYR L+   VSEYL +PL    +I +
Sbjct: 184 LDGAQRLLHLLDSLAQVCDPGTKVVVVGQTNDIALYRELMRRGVSEYLTQPLGPLQVIRA 243

Query: 146 ISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGT 205
           + A++   +     +G  I+F+G++GGVG+ST+AHN A+S+A      T+L DLDL +GT
Sbjct: 244 VGALYA--DPAAPFTGRQIAFVGAKGGVGASTLAHNFAWSMAEKMQSATVLVDLDLAFGT 301

Query: 206 ANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIV 265
           A ++F++DP+  + DA+    R+D   + R+ V  A+ LS+  APA L   Y+F      
Sbjct: 302 AGLDFNQDPLQGVLDALSQPDRLDPVLMDRMMVRCADRLSLFAAPASLDDDYEFGADAFE 361

Query: 266 PVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
            V   +    P V+LD+PHVWN+W++ VL  SD +V+  + DLA LRN+KN+ID++K  R
Sbjct: 362 EVTQKIRGAAPFVVLDLPHVWNAWSRRVLIGSDDLVVVATPDLASLRNAKNIIDLVKGSR 421

Query: 326 PADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDP 385
           P D PP LVLNQV  P +PEI + DF   LG+ PS ++PFD   +G +AN+G+M+ EV P
Sbjct: 422 PNDAPPRLVLNQVGVPGRPEIPVKDFGEALGVQPSLVLPFDPKPYGQAANNGQMLAEVAP 481

Query: 386 KSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKK 419
           KS  A  L   +R++  R      +++M++ + K
Sbjct: 482 KSKAAEGLEHLARLISRREPPPVQKTSMFSGLFK 515


>gi|7208427|gb|AAF40194.1|AF229646_6 CpaE [Caulobacter crescentus CB15]
          Length = 517

 Score =  328 bits (841), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 158/394 (40%), Positives = 247/394 (62%), Gaps = 2/394 (0%)

Query: 26  LPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQT 85
           +PRI++H FC      +++E++  D RMS+    +  G +  AV  + +  TP L++V+T
Sbjct: 124 IPRITIHAFCARPETAALIEKAAADRRMSRAATIVRDGGLEAAVDYYQNQPTPSLVMVET 183

Query: 86  KVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINS 145
              ++ +L  L+ LA+VCD GTKV+V+G TND++LYR L+   VSEYL +PL    +I +
Sbjct: 184 LDGAQRLLHLLDSLAQVCDPGTKVVVVGQTNDIALYRELMRRGVSEYLTQPLGPLQVIRA 243

Query: 146 ISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGT 205
           + A++   +     +G  I+F+G++GGVG+ST+AHN A+S+A      T+L DLDL +GT
Sbjct: 244 VGALYA--DPAAPFTGRQIAFVGAKGGVGASTLAHNFAWSMAEKMQSATVLVDLDLAFGT 301

Query: 206 ANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIV 265
           A ++F++DP+  + DA+    R+D   + R+ V  A+ LS+  APA L   Y+F      
Sbjct: 302 AGLDFNQDPLQGVLDALSQPDRLDPVLMDRMMVRCADRLSLFAAPASLDDDYEFGADAFE 361

Query: 266 PVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
            V   +    P V+LD+PHVWN+W++ VL  SD +V+  + DLA LRN+KN+ID++K  R
Sbjct: 362 EVTQKIRGAAPFVVLDLPHVWNAWSRRVLIGSDDLVVVATPDLASLRNAKNIIDLVKGSR 421

Query: 326 PADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDP 385
           P D PP LVLNQV  P +PEI + DF   LG+ PS ++PFD   +G +AN+G+M+ EV P
Sbjct: 422 PNDAPPRLVLNQVGVPGRPEIPVKDFGEALGVQPSLVLPFDPKPYGQAANNGQMLAEVAP 481

Query: 386 KSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKK 419
           KS  A  L   +R++  R      +++M++ + K
Sbjct: 482 KSKAAEGLEHLARLISRRDPPPVQKTSMFSGLFK 515


>gi|92116011|ref|YP_575740.1| pilus assembly protein CpaE [Nitrobacter hamburgensis X14]
 gi|91798905|gb|ABE61280.1| pilus assembly protein CpaE [Nitrobacter hamburgensis X14]
          Length = 422

 Score =  328 bits (840), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 161/387 (41%), Positives = 248/387 (64%), Gaps = 3/387 (0%)

Query: 27  PRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTK 86
           PR+SV  FC T    + V+ +  D R+ + +++I  G +A A   +  + TP++II++T+
Sbjct: 28  PRVSVQAFCETMETATAVQAAGEDRRLGKAHLKIQMGGMAAAAEAYRSAPTPNVIILETE 87

Query: 87  VDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSI 146
            +  ++L+ L+ LA VCD+GT+VIVIG  NDV+LYR L+   VS+Y+I P++  DI+ ++
Sbjct: 88  -ERGDILAGLDQLATVCDAGTRVIVIGRVNDVTLYRELVKRGVSDYVIAPVTAVDIVRAV 146

Query: 147 SAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTA 206
             +F+  E    + G  I+  G++GGVG+STIAHN A++IA   A+++++ADLDL +GTA
Sbjct: 147 CGLFSAPE--AKAVGRIIAVAGAKGGVGASTIAHNVAWAIARDLALDSVVADLDLAFGTA 204

Query: 207 NINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVP 266
            ++F++DP   I+DA++   RID AFV RL     ++LS+L APA L R YDF  +    
Sbjct: 205 GLDFNQDPPQGIADAVFSPDRIDTAFVDRLLSKCTDHLSLLAAPATLDRVYDFGTEAFDS 264

Query: 267 VLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRP 326
           +LD L    P ++LD+PH W+ WT+  L  +D ++I  + DLA LRN+KNL D+LK  RP
Sbjct: 265 ILDTLRTTMPCIVLDIPHQWSGWTKRALIGADDILIVATPDLASLRNTKNLFDLLKAARP 324

Query: 327 ADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPK 386
            D+PP   LNQV  PK+PEIS S+F   +   P   IPFD  +FG +AN+G+MI E+   
Sbjct: 325 NDRPPLYCLNQVGVPKRPEISASEFAKAIESQPIVSIPFDPQLFGSAANNGQMIAEIAAN 384

Query: 387 SAIANLLVDFSRVLMGRVTVSKPQSAM 413
             I ++ +  ++ L GR    KP+ + 
Sbjct: 385 HRITDMFLQIAQRLTGRGETKKPRKSF 411


>gi|90425199|ref|YP_533569.1| putative pilus assembly protein cpaE [Rhodopseudomonas palustris
           BisB18]
 gi|90107213|gb|ABD89250.1| putative pilus assembly protein cpaE [Rhodopseudomonas palustris
           BisB18]
          Length = 423

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 157/393 (39%), Positives = 248/393 (63%), Gaps = 3/393 (0%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
           E +   PR+SV  FC T    + V+ +  D R+ + +++I  G +A A+  +  + TP++
Sbjct: 23  EHIAPAPRVSVQAFCETVETAAAVQAAGEDRRLDKAHLKIQMGGMAAAIEAYRSAPTPNV 82

Query: 81  IIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA 140
           II++T   S ++L+ L+ LA VCD+GT+VIVIG  NDV+LYR L+   VS+Y+I P+   
Sbjct: 83  IILETDPRS-DILAGLDQLATVCDAGTRVIVIGRVNDVTLYRELVRRGVSDYVIAPVVPI 141

Query: 141 DIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLD 200
            I+ SI  +F+  E    + G  I+ +G++GGVG+STIAHN A++IA   A+++++ADLD
Sbjct: 142 KIVGSICGLFSAPE--ARAVGRIIAVVGAKGGVGASTIAHNVAWAIARDLALDSVVADLD 199

Query: 201 LPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFD 260
           L +GTA +++++DP   I+DA++   R+D AF+ RL     ++LS+L APA L R YDF 
Sbjct: 200 LAFGTAGLDYNQDPPQGIADAVFSPDRVDTAFIDRLLSKCTDHLSLLAAPATLERVYDFG 259

Query: 261 EKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDV 320
            +    + D L    P ++LDVPH W+ WT+  L  +D ++I  + DLA LRN+KN+ D+
Sbjct: 260 TEAFDSIFDTLRTTMPCIVLDVPHQWSGWTKRALVSADDILIVAAPDLANLRNAKNMYDL 319

Query: 321 LKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMI 380
           LK  RP D+PP+  LNQV  PK+PEI+ ++F   +   P   IPFD  +FG +AN+G+MI
Sbjct: 320 LKAARPNDRPPHYCLNQVGVPKRPEINANEFAKAIESPPVVSIPFDPQIFGAAANNGQMI 379

Query: 381 HEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAM 413
            E+      A + +  ++ + GR    KP+ + 
Sbjct: 380 AEISANHRAAEMFLQIAQRMTGRGETKKPRGSF 412


>gi|329847255|ref|ZP_08262283.1| pilus assembly protein CpaE [Asticcacaulis biprosthecum C19]
 gi|328842318|gb|EGF91887.1| pilus assembly protein CpaE [Asticcacaulis biprosthecum C19]
          Length = 499

 Score =  327 bits (837), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 160/380 (42%), Positives = 236/380 (62%), Gaps = 2/380 (0%)

Query: 25  SLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQ 84
           S+PRI++H F  ++      + + +D RMS+    + RG I EA+  +    TP LI+V+
Sbjct: 101 SIPRINIHFFPDSEASLQACDTAALDRRMSRAQCTVKRGGIFEAMDTYRHEPTPSLIVVE 160

Query: 85  TKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIIN 144
           +    R++L  L  LAEVCD  TKV+V+G  ND+SLYR LI   VSEY++ PL    +I 
Sbjct: 161 SGARGRDLLDQLGQLAEVCDGNTKVVVVGAHNDISLYRELIRQGVSEYVVSPLQPLSLIK 220

Query: 145 SISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYG 204
           +I+ +F   E      G +I+F+G+RGG GSS+IAHN AF+++   +  T++ D DLP+G
Sbjct: 221 TIAGLFNDPE--TPFVGRTIAFVGARGGAGSSSIAHNFAFNLSESMSSNTVIVDYDLPFG 278

Query: 205 TANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMI 264
           TA ++F++DP + ++DA+    R+D   + R+     E LS+ ++PA L + Y  D    
Sbjct: 279 TAGLDFNQDPPHGLADALNEPDRLDSVLLDRMLTKCTERLSLFSSPAALDQDYTADPDAF 338

Query: 265 VPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL 324
             V   +    P +++D+PHVW  W ++ L  +D VVI  + DLA LRN+KN+ID+LK  
Sbjct: 339 DEVTRKIRSAAPFIVMDLPHVWTPWLRQNLVAADDVVIVATPDLASLRNAKNIIDLLKHS 398

Query: 325 RPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVD 384
           RP D PP LVLNQ++TP +PEI + DF A LGI PSA+IPFD  +FG +AN+G+MI EV 
Sbjct: 399 RPNDTPPRLVLNQMETPGRPEIPVKDFTAALGIEPSALIPFDAKLFGSAANNGQMIAEVG 458

Query: 385 PKSAIANLLVDFSRVLMGRV 404
           P S  A  L   +  + GR 
Sbjct: 459 PTSKAAEALGHLTAAITGRT 478


>gi|316933037|ref|YP_004108019.1| putative pilus assembly protein CpaE [Rhodopseudomonas palustris
           DX-1]
 gi|315600751|gb|ADU43286.1| putative pilus assembly protein CpaE [Rhodopseudomonas palustris
           DX-1]
          Length = 423

 Score =  325 bits (833), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 159/404 (39%), Positives = 247/404 (61%), Gaps = 3/404 (0%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
           E +   PR+SV  FC T    + V+ +  D R+++ +++I  G +A A+  +  + TP++
Sbjct: 23  EHIAPAPRVSVQAFCETVETATAVQAAGEDRRLAKAHLKIQMGGVAAAIEAYRSAPTPNV 82

Query: 81  IIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA 140
           I+++T   S +VL+ L+ LA VCD GT+VIVIG  NDV+LYR L+   VS+Y I P+   
Sbjct: 83  IVLETDARS-DVLAGLDQLATVCDPGTRVIVIGKVNDVTLYRELVRRGVSDYAIAPVQPI 141

Query: 141 DIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLD 200
           D++ SI  +F+  E    + G  I+ +G++GGVG+ST+AHN A++IA   A+++++ADLD
Sbjct: 142 DVVRSICNLFSAPE--AKAVGRIIAVVGAKGGVGASTVAHNVAWAIARDLALDSVVADLD 199

Query: 201 LPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFD 260
           L +GTA +++++DP   I++A++   R+D AFV RL     ++LS+L APA L R YDF 
Sbjct: 200 LAFGTAGLDYNQDPPQGIAEAVFSPDRVDTAFVDRLLSKCTDHLSLLAAPATLDRVYDFG 259

Query: 261 EKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDV 320
            +    + D L    P ++LDVPH W  W +  L  +D ++I  + DLA LRN+KNLID+
Sbjct: 260 TEAFDAIFDTLRATMPCIVLDVPHQWTGWAKRSLITADDILIVATPDLANLRNTKNLIDL 319

Query: 321 LKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMI 380
           LK  RP D+PP   LNQV  PK+PEIS ++F   +   P   IPFD  +FG +AN+G+MI
Sbjct: 320 LKAARPNDRPPLYCLNQVGVPKRPEISTAEFAKAIESPPIVSIPFDPQMFGAAANNGQMI 379

Query: 381 HEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMK 424
            E+        + +  ++ L GR    K + +    I +    K
Sbjct: 380 AEIAANHKTTEMFLQIAQRLTGRGEAKKSKGSFLAPILEKLRAK 423


>gi|192292568|ref|YP_001993173.1| pilus assembly protein CpaE [Rhodopseudomonas palustris TIE-1]
 gi|192286317|gb|ACF02698.1| putative pilus assembly protein CpaE [Rhodopseudomonas palustris
           TIE-1]
          Length = 423

 Score =  325 bits (833), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 159/404 (39%), Positives = 246/404 (60%), Gaps = 3/404 (0%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
           E +   PR+SV  FC T    + V+ +  D R+++ +++I  G +  A+  +  + TP++
Sbjct: 23  EHIAPAPRVSVQAFCETVETAAAVQAAGEDRRLAKAHLKIQMGGVVAAIEAYRSAPTPNV 82

Query: 81  IIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA 140
           I+++T   S +VL+ L+ LA VCD GT+VIVIG  NDV+LYR L+   VS+Y I P+   
Sbjct: 83  IVLETDARS-DVLAGLDQLATVCDPGTRVIVIGKVNDVTLYRELVRRGVSDYAIAPVQPI 141

Query: 141 DIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLD 200
           D++ SI  +F+  E    + G  I+ +G++GGVG+ST+AHN A++IA   A+++++ADLD
Sbjct: 142 DVVRSICNLFSAPE--AKAVGRIIAVVGAKGGVGASTVAHNVAWAIARDLALDSVVADLD 199

Query: 201 LPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFD 260
           L +GTA +++++DP   I++A++   R+D AFV RL     ++LS+L APA L R YDF 
Sbjct: 200 LAFGTAGLDYNQDPPQGIAEAVFAPDRVDTAFVDRLLSKCTDHLSLLAAPATLDRVYDFG 259

Query: 261 EKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDV 320
                 V D L    P ++LDVPH W  W +  L  +D ++I  + DLA LRN+KNLID+
Sbjct: 260 ADAFDSVFDTLRTTMPCIVLDVPHQWTGWAKRSLITADDILIVATPDLANLRNTKNLIDL 319

Query: 321 LKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMI 380
           LK  RP D+PP   LNQV  PK+PEIS ++F   +   P   IPF+  +FG +AN+G+MI
Sbjct: 320 LKGARPNDRPPLYCLNQVGVPKRPEISTNEFAKAIESQPIVSIPFEPQIFGAAANNGQMI 379

Query: 381 HEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMK 424
            E+        + +  ++ L GR    KP+ +    I +    K
Sbjct: 380 AEIAANHKTTEMFLQIAQRLTGRGEAKKPKGSFLGPILEKLRAK 423


>gi|39936742|ref|NP_949018.1| pilus assembly protein cpaE [Rhodopseudomonas palustris CGA009]
 gi|39650598|emb|CAE29121.1| possible pilus assembly protein cpaE [Rhodopseudomonas palustris
           CGA009]
          Length = 423

 Score =  325 bits (832), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 159/404 (39%), Positives = 246/404 (60%), Gaps = 3/404 (0%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
           E +   PR+SV  FC T    + V+ +  D R+++ +++I  G +  A+  +  + TP++
Sbjct: 23  EHIAPAPRVSVQAFCETVETAAAVQAAGEDRRLAKAHLKIQMGGVVAAIEAYRSAPTPNV 82

Query: 81  IIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA 140
           I+++T   S +VL+ L+ LA VCD GT+VIVIG  NDV+LYR L+   VS+Y I P+   
Sbjct: 83  IVLETDARS-DVLAGLDQLATVCDPGTRVIVIGKVNDVTLYRELVRRGVSDYAIAPVQPI 141

Query: 141 DIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLD 200
           D++ SI  +F+  E    + G  I+ +G++GGVG+ST+AHN A++IA   A+++++ADLD
Sbjct: 142 DVVRSICNLFSAPE--AKAVGRIIAVVGAKGGVGASTVAHNVAWAIARDLALDSVVADLD 199

Query: 201 LPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFD 260
           L +GTA +++++DP   I++A++   R+D AFV RL     ++LS+L APA L R YDF 
Sbjct: 200 LAFGTAGLDYNQDPPQGIAEAVFAPDRVDTAFVDRLLSKCTDHLSLLAAPATLDRVYDFG 259

Query: 261 EKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDV 320
                 V D L    P ++LDVPH W  W +  L  +D ++I  + DLA LRN+KNLID+
Sbjct: 260 ADAFDSVFDTLRTTMPCIVLDVPHQWTGWAKRSLITADDILIVATPDLANLRNTKNLIDL 319

Query: 321 LKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMI 380
           LK  RP D+PP   LNQV  PK+PEIS ++F   +   P   IPF+  +FG +AN+G+MI
Sbjct: 320 LKGARPNDRPPLYCLNQVGVPKRPEISTNEFAKAIESQPIVSIPFEPQIFGAAANNGQMI 379

Query: 381 HEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMK 424
            E+        + +  ++ L GR    KP+ +    I +    K
Sbjct: 380 AEIAANHKTTEMFLQIAQRLTGRGEAKKPKGSFLGPILEKLRAK 423


>gi|170740619|ref|YP_001769274.1| response regulator receiver protein [Methylobacterium sp. 4-46]
 gi|168194893|gb|ACA16840.1| response regulator receiver protein [Methylobacterium sp. 4-46]
          Length = 414

 Score =  324 bits (831), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 161/404 (39%), Positives = 259/404 (64%), Gaps = 2/404 (0%)

Query: 14  ENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFS 73
           +  D     +  +PRI++  FC T  +  V+E +  D RM + ++++  G  A AV  F 
Sbjct: 3   DRTDTADRVIAPVPRITIQAFCDTPEVAEVIEAAAEDRRMHKAHLKVQMGGAAAAVEAFR 62

Query: 74  DSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYL 133
            + TP++++++        L+ L+ LAEVCD GTKV+V+G  NDV LYR  I   VS+YL
Sbjct: 63  SAPTPNVLVIEMHGPRANPLAQLDTLAEVCDPGTKVVVVGHVNDVLLYREFIRRGVSDYL 122

Query: 134 IEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAME 193
           I P+    +I +IS +FT  E G    G +++ +G++GGVG+ST+AHN  +SIA  +A  
Sbjct: 123 IAPIDPVGVIAAISDLFT--EPGAEPLGRTVAVVGAKGGVGASTLAHNLGWSIARDYATS 180

Query: 194 TLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAML 253
           T++ADLD+ +GTA +NF++DP   +++A++   RID  FV RL     +NLS+L APA L
Sbjct: 181 TVIADLDVAFGTAGLNFNQDPPQGVAEAVFAPERIDANFVDRLLSKCTDNLSLLAAPATL 240

Query: 254 SRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRN 313
            RT DF E     ++DIL  + P ++LDVPHVW +W+++++  +D+++I  + +LA LRN
Sbjct: 241 DRTNDFGEGAFDGLVDILRGMVPCIVLDVPHVWTAWSRKMVIGADEILIVAAPELASLRN 300

Query: 314 SKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMS 373
           ++NL+D+L++ RP D+PP LVLNQV  PK+PEI+ ++F   L +T +A++PFD A+FG +
Sbjct: 301 ARNLVDLLRQARPNDRPPRLVLNQVGMPKRPEIAAAEFAKALDVTAAAVVPFDPALFGAA 360

Query: 374 ANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKI 417
           AN+G+M+ EV   S + +++   +  + GR    K +  +   I
Sbjct: 361 ANNGQMLAEVQAGSKVIDIVTALAGTVTGRAEAKKSRPTLLDPI 404


>gi|323137427|ref|ZP_08072505.1| response regulator receiver protein [Methylocystis sp. ATCC 49242]
 gi|322397414|gb|EFX99937.1| response regulator receiver protein [Methylocystis sp. ATCC 49242]
          Length = 421

 Score =  324 bits (831), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 160/407 (39%), Positives = 259/407 (63%), Gaps = 10/407 (2%)

Query: 22  SMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLI 81
            +  +PRIS+  FC +  +  V+E +  D RMS+ ++++  G +  AV  +  + TP+LI
Sbjct: 18  QIAPVPRISIQAFCESQDVAKVIENAAQDRRMSKAHVKVHMGGVLAAVEAYRSAPTPNLI 77

Query: 82  IVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVAD 141
           +++T  D   ++  LE LAE CD+GTKV+V+G  ND++LYR L S  VS+Y++ P  +  
Sbjct: 78  VLETFSDRITLIEQLESLAEFCDAGTKVMVVGHENDIALYRELTSRGVSDYVVAPFDILS 137

Query: 142 IINSISAIFTPQEEGKGSS----GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLA 197
            I  +S ++       GSS    G  I+ +G++GGVG+STIAHN A+S++ +   +T++ 
Sbjct: 138 FIGQVSLLY------NGSSSEALGRMIAVVGAKGGVGASTIAHNLAWSVSRLLEYQTVIV 191

Query: 198 DLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTY 257
           DLDLP+GTA ++F++DP   ++DA++   R+D  FV RL    ++ LS+L APA + R Y
Sbjct: 192 DLDLPFGTAGLDFNQDPPQGVADAVFSPERLDSNFVDRLLSKCSDTLSLLAAPATVDRLY 251

Query: 258 DFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNL 317
           D  E+     LDIL    P +ILDVPH W++WT+ VL  +D+VV+  S DLA LRN++ +
Sbjct: 252 DLPEQAFDATLDILRSTTPAIILDVPHQWSAWTRRVLVAADEVVVVASPDLANLRNTRTV 311

Query: 318 IDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
           +DVL+  R  D+PP ++LN V  P++PEIS+++F   + I P AI+PF+  +FG +AN+G
Sbjct: 312 VDVLRSARVNDRPPRVILNNVGVPRRPEISLTEFTKAIEIDPVAIVPFEPKLFGTAANNG 371

Query: 378 KMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMK 424
           +M+ EV+  S I  +L D +R LMG+    + +  + + + +  + K
Sbjct: 372 QMLAEVEAGSKIVEMLDDVARSLMGKAAGRRAKKTLLSPLLQRLSRK 418


>gi|295690796|ref|YP_003594489.1| pilus assembly ATPase CpaE [Caulobacter segnis ATCC 21756]
 gi|295432699|gb|ADG11871.1| pilus assembly ATPase CpaE [Caulobacter segnis ATCC 21756]
          Length = 464

 Score =  323 bits (827), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 153/398 (38%), Positives = 250/398 (62%), Gaps = 2/398 (0%)

Query: 22  SMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLI 81
           S   +PR+++H FC      +V+E++  D RM++    +  G +A AV  + D  TP L+
Sbjct: 67  SEAVIPRVTLHAFCARTETAAVLEQAAKDRRMARATTVVRMGGLAAAVDLYQDQPTPSLV 126

Query: 82  IVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVAD 141
           +V++  D++ +L  L+ LAEVCD+GTKV+VIG  ND++LYR L+   VSEYL  PLS   
Sbjct: 127 MVESLDDAQRLLHHLDALAEVCDAGTKVVVIGQANDIALYRELMRRGVSEYLTPPLSALS 186

Query: 142 IINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDL 201
           +I +I+ ++   +      G  ++F+G++GGVG+ST+AHN A++++      T+LADLDL
Sbjct: 187 VIRAIADLYA--DPSAPFVGRQVAFVGAKGGVGASTLAHNFAWTMSERLQTATVLADLDL 244

Query: 202 PYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDE 261
            +GTA ++F++DP+  + DA+    R+D   + R+ V   + LS+  APA L   Y+   
Sbjct: 245 AFGTAGLDFNQDPVQGVFDALSQPDRLDPVLMDRMMVRCGDRLSLFAAPATLDDDYEIGA 304

Query: 262 KMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL 321
                V   +    P V+LD+PH+W++WT+ VL  SD++V+  + DLA LRN+KN+ID++
Sbjct: 305 DAFDEVTHRIRAAAPYVVLDLPHIWSAWTRRVLLGSDELVVVATPDLASLRNAKNIIDLV 364

Query: 322 KKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIH 381
           +  RP D PP LVLNQV  P +PEI + DF   LG+ PS ++ FD   +G++AN+G+M+ 
Sbjct: 365 RAARPNDAPPRLVLNQVGVPGRPEIPVKDFGEALGVEPSLVLLFDPKPYGLAANNGQMLA 424

Query: 382 EVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKK 419
           E+ P+S  A  +   +R++  R   S P++++ + + K
Sbjct: 425 EIAPRSKAAEGIEQLARLISRREPPSPPKASLLSALFK 462


>gi|146338121|ref|YP_001203169.1| putative pilus assembly protein CpaE [Bradyrhizobium sp. ORS278]
 gi|146190927|emb|CAL74932.1| putative pilus assembly protein cpaE [Bradyrhizobium sp. ORS278]
          Length = 422

 Score =  323 bits (827), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 157/391 (40%), Positives = 247/391 (63%), Gaps = 3/391 (0%)

Query: 27  PRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTK 86
           PR+SV  FC T    + V+ +  D R+ + +++I  G +A A+  +  + TP++II++T 
Sbjct: 28  PRVSVQAFCETVETAATVQAAGEDRRLGKAHLKIQMGGMAAAIEAYRSAPTPNVIILETD 87

Query: 87  VDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSI 146
             S ++L+ L+ LA VCD GT+V+VIG  NDV+LYR L+   VS+Y++ P++  D++ SI
Sbjct: 88  ARS-DILAGLDHLATVCDPGTRVVVIGRVNDVTLYRELVRRGVSDYVLSPVTPIDVVRSI 146

Query: 147 SAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTA 206
             +F+  E    + G  I+ +G++GGVG+STIAHN A++IA   AM++++ADLDL +GTA
Sbjct: 147 CNLFSAPE--AKAVGRIIAVVGAKGGVGASTIAHNIAWAIARDLAMDSVVADLDLAFGTA 204

Query: 207 NINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVP 266
            +++++DP   I+DA++   RID AF+ RL     ++LS+L APA L R YDF  +    
Sbjct: 205 GLDYNQDPAQGIADAVFSPDRIDIAFMDRLLSKCTDHLSLLAAPATLDRVYDFGAEAFDA 264

Query: 267 VLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRP 326
           V D L    P ++LDVPH W+ WT+  L  +D ++I  + DLA LRN+KN+ D+LK  RP
Sbjct: 265 VFDTLRASMPCIVLDVPHQWSGWTKRALISADDILIVAAPDLASLRNTKNIYDLLKAARP 324

Query: 327 ADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPK 386
            D+ P   LNQV  PK+PEI+ S+F   +   P   IPF+  +FG +AN+G+MI E+ P 
Sbjct: 325 NDRMPLYCLNQVGVPKRPEINASEFAKAIESPPIVTIPFEPQIFGAAANNGQMIAEMSPN 384

Query: 387 SAIANLLVDFSRVLMGRVTVSKPQSAMYTKI 417
                + +  ++ L GR    KP+ +  + +
Sbjct: 385 HRTTEMFLQIAQRLTGRSETKKPKGSFLSPL 415


>gi|86748905|ref|YP_485401.1| pilus assembly protein cpaE [Rhodopseudomonas palustris HaA2]
 gi|86571933|gb|ABD06490.1| pilus assembly protein cpaE [Rhodopseudomonas palustris HaA2]
          Length = 425

 Score =  323 bits (827), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 160/404 (39%), Positives = 247/404 (61%), Gaps = 3/404 (0%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
           E +   PR+SV  FC +    + V+ +  D R+++ +++I  G +  A+  +  + TP++
Sbjct: 25  EHIAPAPRVSVQAFCESVDTAAAVQSAGEDRRLAKAHLKIQMGGMVAAIEAYRSAPTPNV 84

Query: 81  IIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA 140
           II++T   S ++L+ L+ LA VCD GT+VIVIG  NDV+LYR L+   VS+Y I P+S  
Sbjct: 85  IILETDPRS-DILAGLDQLATVCDPGTRVIVIGKVNDVTLYRELVRRGVSDYAIAPVSPI 143

Query: 141 DIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLD 200
           DI+ SI  +F+  E    + G  I+ +G++GGVG+STIAHN A++IA   A+++++ADLD
Sbjct: 144 DIVRSICNLFSAPE--AKAVGRIIAVVGAKGGVGASTIAHNIAWAIARDLALDSVVADLD 201

Query: 201 LPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFD 260
           L +GTA +++++DP   I++A++   R+D AFV RL     ++LS+L APA L R YDF 
Sbjct: 202 LAFGTAGLDYNQDPPQGIAEAVFSPDRVDTAFVDRLLSKCTDHLSLLAAPATLDRVYDFG 261

Query: 261 EKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDV 320
            +    + D L    P ++LDVPH W  WT+  L  +D ++I  + DLA LRN+KNL D+
Sbjct: 262 TEAFDTIFDTLRSTMPCIVLDVPHQWTGWTKRALINADDILIVATPDLANLRNTKNLYDL 321

Query: 321 LKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMI 380
           LK  RP D+PP   LNQV  PK+PEI+  +F   +   P   IPFD  +FG +AN+G+MI
Sbjct: 322 LKAARPNDRPPLYCLNQVGVPKRPEINSGEFAKAIESPPIVSIPFDPQMFGAAANNGQMI 381

Query: 381 HEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMK 424
            E+        + +  ++ L GR    KP+    + I +    K
Sbjct: 382 AEIAASHKTTEMFLQIAQRLTGRGEAKKPKGGFLSPILEKLRAK 425


>gi|148258237|ref|YP_001242822.1| putative pilus assembly protein CpaE [Bradyrhizobium sp. BTAi1]
 gi|146410410|gb|ABQ38916.1| putative pilus assembly protein cpaE [Bradyrhizobium sp. BTAi1]
          Length = 422

 Score =  322 bits (826), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 156/391 (39%), Positives = 248/391 (63%), Gaps = 3/391 (0%)

Query: 27  PRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTK 86
           PR+SV  FC T    + V+ +  D R+ + ++++  G +A A+  +  + TP++II++T 
Sbjct: 28  PRVSVQAFCETVETAATVQAAGEDRRLGKAHLKVQMGGMAAAIEAYRSAPTPNVIILETD 87

Query: 87  VDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSI 146
             S ++L+ L+ LA VCD GT+V+VIG  NDV+LYR L+   VS+Y++ P++  D++ SI
Sbjct: 88  ARS-DILAGLDQLATVCDPGTRVVVIGRVNDVTLYRELVRRGVSDYVLSPVTPIDVVRSI 146

Query: 147 SAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTA 206
             +F+  E    + G  I+ +G++GGVG+STIAHN A++IA   +M++++ADLDL +GTA
Sbjct: 147 CNLFSAPE--AKAVGRIIAVVGAKGGVGASTIAHNVAWAIARDLSMDSVVADLDLAFGTA 204

Query: 207 NINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVP 266
            +++++DP   I+DA++   RID AF+ RL     ++LS+L APA L R YDF  +    
Sbjct: 205 GLDYNQDPAQGIADAVFSPDRIDIAFMDRLLSKCTDHLSLLAAPATLDRVYDFGVEAFDA 264

Query: 267 VLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRP 326
           + D L    P ++LDVPH W+ WT+  L  +D ++I  + DLA LRN+KN+ D+LK  RP
Sbjct: 265 IFDTLRASMPCIVLDVPHQWSGWTKRALISADDILIVAAPDLASLRNTKNIYDLLKAARP 324

Query: 327 ADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPK 386
            D+ P   LNQV  PK+PEI+ S+F   +   P A IPF+  VFG +AN+G+MI E+ P 
Sbjct: 325 NDRMPLYCLNQVGVPKRPEINASEFAKAIESQPIASIPFEPQVFGAAANNGQMIAEMSPN 384

Query: 387 SAIANLLVDFSRVLMGRVTVSKPQSAMYTKI 417
                + +  ++ L GR    KP+ +  + +
Sbjct: 385 HRTTEMFLQIAQRLTGRSETKKPKGSFLSPL 415


>gi|154250691|ref|YP_001411515.1| response regulator receiver protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154154641|gb|ABS61858.1| response regulator receiver protein [Parvibaculum lavamentivorans
           DS-1]
          Length = 437

 Score =  321 bits (822), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 158/381 (41%), Positives = 249/381 (65%), Gaps = 2/381 (0%)

Query: 23  MCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLII 82
           M  +PRI++H FC   +  S ++R+  D R+++ ++ +  G I  A+  +  ++TP+LI+
Sbjct: 39  MKPVPRITIHAFCEQPSTGSAIQRAGEDRRLAKAHLTVHMGGIPAAIEQYQQNATPNLIL 98

Query: 83  VQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADI 142
           V+ +V  +E+ S L  LAEVCD+GTKV+V G  NDVSLYR +I   V+EYL+ PL    +
Sbjct: 99  VEARVAGQELFSQLTALAEVCDAGTKVVVAGHMNDVSLYREMIRQGVNEYLVTPLHPMGV 158

Query: 143 INSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLP 202
           I +IS ++   +      G +I+FIG++GG GSSTIAHN  + I++    + ++ DLDLP
Sbjct: 159 IEAISRLYV--DPDAPPIGRTIAFIGAKGGTGSSTIAHNVGWCISTGMDEDVIITDLDLP 216

Query: 203 YGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEK 262
           +GTA ++F++DP   I+DA+    R+D   + RL V   E LS+  APA+L R ++ D  
Sbjct: 217 FGTAGLDFNQDPAQGIADALTAPERLDDVLLDRLLVKCTERLSLFAAPAVLDRDFEMDGD 276

Query: 263 MIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK 322
               VLDI+ +  P V++D+PHVW  WT++VL  +D++VIT + DLA LRN+KN++D+++
Sbjct: 277 SCESVLDIVREGVPCVVVDLPHVWAPWTKKVLLSADEIVITATPDLASLRNAKNILDLVR 336

Query: 323 KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHE 382
           + RP D  P++VLNQV  PK+PEI + DF   +G   + ++PF+  +FG +AN+G+MI E
Sbjct: 337 QARPNDSAPHIVLNQVGMPKRPEIPVKDFAEAVGAEATLVLPFNPGLFGTAANNGQMIEE 396

Query: 383 VDPKSAIANLLVDFSRVLMGR 403
           +DPK    + L   ++ L GR
Sbjct: 397 LDPKGKTTDGLRFLAQQLCGR 417


>gi|85713507|ref|ZP_01044497.1| pilus assembly protein cpaE [Nitrobacter sp. Nb-311A]
 gi|85699411|gb|EAQ37278.1| pilus assembly protein cpaE [Nitrobacter sp. Nb-311A]
          Length = 384

 Score =  320 bits (820), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 158/373 (42%), Positives = 241/373 (64%), Gaps = 5/373 (1%)

Query: 42  SVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSR-EVLSALEPLA 100
           + V+ +  D R+++ +++I  G +A AV  +  + TP++II++   D R ++L+AL+ LA
Sbjct: 5   TAVQAAGEDRRLAKAHLKIQMGGMAAAVEAYRSAPTPNVIILEA--DERGDILAALDHLA 62

Query: 101 EVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSS 160
            VCD+GT+VIVIG  NDV+LYR L+   VS+Y+I P +  DI+ S+  +F+  E    + 
Sbjct: 63  TVCDAGTRVIVIGRVNDVTLYRELVKRGVSDYVIAPAAPIDIVRSVCGLFSAPE--AKAV 120

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISD 220
           G  I+  G++GGVG+STIAHN A++IA   A+++++ADLDL +GTA ++F++DP   I+D
Sbjct: 121 GRVIAIAGAKGGVGASTIAHNVAWAIARDLALDSVVADLDLAFGTAGLDFNQDPPQGIAD 180

Query: 221 AIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVIL 280
           A++   RID AFV RL     ++LS+L APA L R YDF  +     LD L    P ++L
Sbjct: 181 AVFSPDRIDTAFVDRLLSKCTDHLSLLAAPATLDRIYDFGVEAFDSTLDTLRATMPCIVL 240

Query: 281 DVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKT 340
           D+PH W+ WT+  L  +D ++I  + DLA LRN+KNL D+LK  RP D+PP   LNQV  
Sbjct: 241 DIPHQWSGWTRRALIGADDILIAATPDLASLRNTKNLFDLLKAARPNDRPPLYCLNQVGV 300

Query: 341 PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
           PK+PEIS ++F   +   P   +PFD  +FG +AN+G+MI E+ P   IA + +  ++ L
Sbjct: 301 PKRPEISANEFAKAIESQPIVSVPFDPQMFGSAANNGQMIAEIAPNHRIAEMFLQLAQRL 360

Query: 401 MGRVTVSKPQSAM 413
            GR    KP+ + 
Sbjct: 361 TGRGEAKKPRKSF 373


>gi|115525751|ref|YP_782662.1| putative pilus assembly protein CpaE [Rhodopseudomonas palustris
           BisA53]
 gi|115519698|gb|ABJ07682.1| putative pilus assembly protein CpaE [Rhodopseudomonas palustris
           BisA53]
          Length = 423

 Score =  320 bits (819), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 159/402 (39%), Positives = 251/402 (62%), Gaps = 6/402 (1%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
           E +   PR+SV  FC +    + V+ +  D R+ + +++I  G I  A+  +  + TP++
Sbjct: 23  EHIAPAPRVSVQAFCESVETAAAVQSAGEDRRLGKAHLKIQMGGITAAIEAYRAAPTPNV 82

Query: 81  IIVQTKVDSR-EVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSV 139
           II++T  D+R ++L+ L+ LA VCD+GT+VIVIG  NDV+LYR L+   VS+Y+I P++ 
Sbjct: 83  IILET--DTRTDILAGLDQLATVCDAGTRVIVIGRINDVTLYRELVRRGVSDYVIAPVTP 140

Query: 140 ADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADL 199
             I+ SI  +F+  E    + G  I+ +G++GGVG+STIAHN A++IA   A++ ++ADL
Sbjct: 141 ITIVASICGLFSAPE--ARAVGRIIAVVGAKGGVGASTIAHNMAWAIARDLALDAVVADL 198

Query: 200 DLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDF 259
           DL +GTA +++++DP   I+DA++   R+D AF+ RL     ++LS+L APA L R YDF
Sbjct: 199 DLAFGTAGLDYNQDPPQGIADAVFSPDRVDTAFIDRLLSKCTDHLSLLAAPATLERVYDF 258

Query: 260 DEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLID 319
             +    + D L    P ++LDVPH W+ WT+  L  +D ++I  + DLA LRN+KNL D
Sbjct: 259 GTEAFDSIFDTLRATMPCIVLDVPHQWSGWTRRALVGADDILIVAAPDLANLRNTKNLYD 318

Query: 320 VLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKM 379
           +LK  RP D+ P+  LNQV  PK+PEIS  +F   +   P   IPF+  +FG +AN+G+M
Sbjct: 319 LLKAARPNDRSPHYCLNQVGVPKRPEISAGEFAKAIESQPIVTIPFEPQMFGAAANNGQM 378

Query: 380 IHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTK-IKKI 420
           I E+       ++ +  ++ L GR    K + +  +  I+KI
Sbjct: 379 IAEIAANHRTTDMFLQIAQRLTGRAETKKARGSFLSPLIQKI 420


>gi|91977987|ref|YP_570646.1| putative pilus assembly protein cpaE [Rhodopseudomonas palustris
           BisB5]
 gi|91684443|gb|ABE40745.1| putative pilus assembly protein cpaE [Rhodopseudomonas palustris
           BisB5]
          Length = 425

 Score =  319 bits (818), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 159/398 (39%), Positives = 244/398 (61%), Gaps = 5/398 (1%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
           E +   PR+SV  FC +    + V+ +  D R+++ +++I  G +  A+  +  + TP++
Sbjct: 25  EHIAPAPRVSVQAFCESVETAAAVQAAGEDRRLTKAHLKIQMGGMIAAIEAYRSAPTPNV 84

Query: 81  IIVQTKVDSR-EVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSV 139
           II++T  D R +VL+ L+ LA VCD GT+VIVIG  NDV+LYR L+   VS+Y I P+  
Sbjct: 85  IILET--DPRNDVLAGLDQLATVCDPGTRVIVIGKVNDVTLYRELVRRGVSDYAIAPVDP 142

Query: 140 ADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADL 199
            D++ SI  +F+  E    + G  I+ +G++GGVG+STIAHN A++IA   A+++++ADL
Sbjct: 143 IDVVRSICNLFSAPE--AKAVGRIIAIVGAKGGVGASTIAHNVAWAIARDLALDSVVADL 200

Query: 200 DLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDF 259
           DL +GTA +++++DP   I++A++   R+D AFV RL     ++LS+L APA L R YDF
Sbjct: 201 DLAFGTAGLDYNQDPPQGIAEAVFSPDRVDTAFVDRLLSKCTDHLSLLAAPATLDRVYDF 260

Query: 260 DEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLID 319
                  + D L    P ++LDVPH W  W +  L  +D ++I  + DLA LRN+KNL D
Sbjct: 261 GADAFDSIFDTLRATMPCIVLDVPHQWTGWAKRALINADDILIVAAPDLANLRNAKNLYD 320

Query: 320 VLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKM 379
           +LK  RP D+PP   LNQV  PK+PEI+ S+F   +   P   IPFD  +FG +AN+G+M
Sbjct: 321 LLKASRPNDRPPLYCLNQVGVPKRPEINASEFAKAIESQPIVSIPFDPQMFGSAANNGQM 380

Query: 380 IHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKI 417
           I E+        + +  ++ L GR    KP+    + I
Sbjct: 381 IAEIAASHKTTEMFLQIAQRLTGRGEAKKPKGGFLSPI 418


>gi|83859359|ref|ZP_00952880.1| pilus assembly protein CpaE [Oceanicaulis alexandrii HTCC2633]
 gi|83852806|gb|EAP90659.1| pilus assembly protein CpaE [Oceanicaulis alexandrii HTCC2633]
          Length = 548

 Score =  318 bits (816), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 162/392 (41%), Positives = 247/392 (63%), Gaps = 2/392 (0%)

Query: 26  LPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQT 85
           +PRI++H FC +     ++  +  D RM++ ++ +  G ++ A+  F D STP+L+I++T
Sbjct: 155 VPRIAIHAFCESPETGRLIHHAADDRRMARTHVTVELGGLSAAIERFHDESTPELLILET 214

Query: 86  KVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINS 145
            +  RE+   LE LA VCD  TKVI+IG  ND+SLYR LI   VSEYL+ P++   +I++
Sbjct: 215 GMRGRELFQQLEDLAAVCDGDTKVIIIGAANDISLYRELIKRGVSEYLVPPMTPLHLIST 274

Query: 146 ISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGT 205
           IS +F   E     +G SI+FIG++GGVGSSTIAHN A+ +      + +L DLDL +GT
Sbjct: 275 ISGLFLDPE--APFAGRSIAFIGAKGGVGSSTIAHNVAWQMTEGLRSDAVLVDLDLSFGT 332

Query: 206 ANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIV 265
           A ++F++DP  +I+ A+    R+D A + RL V   E LS+ +APA L R +DF      
Sbjct: 333 AGLDFNQDPAQTIAMALEEPDRLDDALLDRLLVRCTERLSLFSAPATLERDWDFQPDAFE 392

Query: 266 PVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
            VLD + +  P V LD+PH W+ W +  L  +D+VV+T + DLA LRN+KNL D+++  R
Sbjct: 393 TVLDKVRRQAPFVALDLPHAWSPWVRHTLLSADQVVVTVTPDLASLRNAKNLFDLVQNAR 452

Query: 326 PADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDP 385
           P D+PP +V+N    PKKP+I + DF   LG  P  ++PF+ A+FG +AN+G+MI EVDP
Sbjct: 453 PNDEPPKVVVNMAGCPKKPDIPLKDFSDALGAAPVLVLPFEPALFGKAANNGQMIAEVDP 512

Query: 386 KSAIANLLVDFSRVLMGRVTVSKPQSAMYTKI 417
           KS  ++     +  L GR   +  + +++  +
Sbjct: 513 KSKASDGFAHLAAQLTGRAPAAPRRKSLFGSL 544


>gi|167648150|ref|YP_001685813.1| pilus assembly protein CpaE [Caulobacter sp. K31]
 gi|167350580|gb|ABZ73315.1| pilus assembly protein CpaE [Caulobacter sp. K31]
          Length = 528

 Score =  318 bits (815), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 161/409 (39%), Positives = 250/409 (61%), Gaps = 7/409 (1%)

Query: 16  EDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDS 75
           E ++ E+  ++PRI++H FC      ++VE +  D RM + +     G +A AV  + + 
Sbjct: 127 EADMGEA--AVPRITIHAFCARPETVALVEAASADRRMVRASTVARPGGLAAAVDYYQNQ 184

Query: 76  STPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIE 135
           STP L++V++   +  +LS L+ LA+VCD GTKV+VIG TND++LYR L+   VSEYL +
Sbjct: 185 STPSLVLVESLDSAPLMLSLLDGLAQVCDPGTKVVVIGQTNDIALYRELMRRGVSEYLTQ 244

Query: 136 PLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETL 195
           P     II ++S ++   +      G  I+F+G++GGVGSST+AHN A+S+A      T+
Sbjct: 245 PSGPLQIIRAVSNLYA--DPSAPFVGRQIAFVGAKGGVGSSTLAHNFAWSMAERIQAATV 302

Query: 196 LADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSR 255
           + DLDL +GTA ++F++DP+  I DA+    R+D   + R+ V   + LS+  AP  L +
Sbjct: 303 MVDLDLAFGTAGLDFNQDPLQGIIDALGQPERLDAVLMDRMMVRCGDRLSLFAAPGALDQ 362

Query: 256 TYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSK 315
            Y+        V   +    P V+LD+PH W++WT+ VL  SD +V+  + DLA LRN+K
Sbjct: 363 DYEIPADAFEEVTQKIRGAAPFVVLDLPHSWSAWTRRVLISSDDLVVVATPDLASLRNAK 422

Query: 316 NLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSAN 375
           N++D++++ RP D PP LVLNQV  P +PEI + DF   LG+TPS ++PFD   FGM+AN
Sbjct: 423 NIVDLVRQARPNDAPPRLVLNQVGVPGRPEIPVKDFGEALGLTPSLVLPFDPKPFGMAAN 482

Query: 376 SGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMK 424
           +G+M+ EV PKS  A  +   +R++  R     P +   + +  +F  K
Sbjct: 483 NGQMVAEVAPKSKAAEGIDHLARLISRR---EPPPAQKASVLSGLFKKK 528


>gi|27376548|ref|NP_768077.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
 gi|27349689|dbj|BAC46702.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
          Length = 422

 Score =  318 bits (815), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 154/392 (39%), Positives = 245/392 (62%), Gaps = 5/392 (1%)

Query: 27  PRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTK 86
           PR+SV  FC T    + V+ +  D R+ + +++I  G +A AV  +  + TP++I++++ 
Sbjct: 28  PRVSVQAFCETVETAAAVQSAGEDRRLGKAHLKIQMGGMAAAVEAYRSAPTPNVIVLES- 86

Query: 87  VDSR-EVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINS 145
            D R ++L  L+ LA VCD+GT+V+VIG  NDV LYR L+   VS+Y++ P+   D++ S
Sbjct: 87  -DGRNDLLGGLDQLATVCDAGTRVVVIGRINDVMLYRELVRRGVSDYVLAPVGAIDVVRS 145

Query: 146 ISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGT 205
           I  +F+  E    + G  I+ +G++GGVG+STI+HN A++IA   AM+ ++ADLDL +GT
Sbjct: 146 ICNLFSAPE--AKAVGRIIAVVGAKGGVGASTISHNVAWAIARDLAMDAVVADLDLAFGT 203

Query: 206 ANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIV 265
           A +++++DP   I+DA++   R+D AF+ RL     ++LS+L APA L R YDF      
Sbjct: 204 AGLDYNQDPPQGIADAVFSPDRVDTAFIDRLLSKCTDHLSLLAAPATLDRVYDFGTDAFD 263

Query: 266 PVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
            V D L    P ++LD+PH W+ WT+  L  +D ++I  + DLA LRN+KNL D+LK  R
Sbjct: 264 SVFDTLRSTMPCIVLDIPHQWSGWTKRALIGADDILIVAAPDLANLRNTKNLFDLLKASR 323

Query: 326 PADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDP 385
           P D+PP   LNQV  PK+PEI+ ++F   +   P   IPF+  +FG +AN+G+MI E+  
Sbjct: 324 PNDRPPLYCLNQVGVPKRPEIAATEFAKAIESQPVVSIPFEPQIFGSAANNGQMIAEISA 383

Query: 386 KSAIANLLVDFSRVLMGRVTVSKPQSAMYTKI 417
                 + +  ++ L GR    K +S++ + +
Sbjct: 384 NHKSIEMFLQIAQRLTGRSETKKQKSSLLSPL 415


>gi|170750191|ref|YP_001756451.1| response regulator receiver protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656713|gb|ACB25768.1| response regulator receiver protein [Methylobacterium radiotolerans
           JCM 2831]
          Length = 414

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 152/390 (38%), Positives = 246/390 (63%), Gaps = 2/390 (0%)

Query: 14  ENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFS 73
           E  +    ++  +PRI++  FC T    +++E + +D RM +  +++  G  A A+  + 
Sbjct: 3   ELSETTERTIAPVPRITIQAFCETGETAAMIEGAALDRRMQKAQVKVRMGGGAAAIEAYR 62

Query: 74  DSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYL 133
            + TP++I+++ +    + +  L+ LAEVCD GT+V+VIG  NDV LYR LI   VS+YL
Sbjct: 63  HAPTPNVILIEVQGARSKPIECLDALAEVCDEGTRVLVIGHVNDVMLYRQLIQRGVSDYL 122

Query: 134 IEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAME 193
           + P+    +I +IS +FT    G    G +++  G +GG+G+ST+AHN A+S+A    ++
Sbjct: 123 MAPVEPLTLIAAISDLFT--APGVKPVGRTVAVYGVKGGIGASTVAHNFAWSVARSQGVQ 180

Query: 194 TLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAML 253
           T++ADLD+ +GTA++NF++DP   I++A++   R+D A V RL    ++NLS+L+APA L
Sbjct: 181 TVIADLDIAFGTASLNFNQDPPQGIAEAVFAPERLDSALVERLLSKCSDNLSLLSAPASL 240

Query: 254 SRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRN 313
            RT D  E     +++ +    P V+LD+PH WN+W++ VLT +D+++I    DLA LRN
Sbjct: 241 DRTIDLSEPAFDTLIEHMRASVPCVVLDIPHQWNAWSKRVLTAADEILIVAGPDLACLRN 300

Query: 314 SKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMS 373
           +KNL+  LK  RP D+PP +VLN V  PK+PEI  ++F   L    +  IPF+  +FG +
Sbjct: 301 AKNLLGALKHGRPNDQPPRIVLNGVGVPKRPEIGTAEFAKALEAPVALTIPFEPTLFGTA 360

Query: 374 ANSGKMIHEVDPKSAIANLLVDFSRVLMGR 403
           AN+G+MI E+   S +A L  D + + +GR
Sbjct: 361 ANNGQMIAEIQAGSKVAELFNDLAAMTLGR 390


>gi|299132288|ref|ZP_07025483.1| pilus assembly protein [Afipia sp. 1NLS2]
 gi|298592425|gb|EFI52625.1| pilus assembly protein [Afipia sp. 1NLS2]
          Length = 421

 Score =  316 bits (810), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 152/385 (39%), Positives = 241/385 (62%), Gaps = 3/385 (0%)

Query: 19  LSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTP 78
           + E +   PR+SV  FC T    + V+ +  D R+++ +++I  G +A A+  +  + TP
Sbjct: 19  VEEHIAPAPRVSVQAFCETVETAAAVQAACEDRRLAKAHLKIQMGGMAAAIEAYRTAPTP 78

Query: 79  DLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLS 138
           ++I+++T+ ++  +LS L+ LA VCD+GT+V+VIG  NDV+LYR L+   VS+Y+I P+ 
Sbjct: 79  NVILLETESET-GILSGLDQLAAVCDAGTRVVVIGRINDVTLYRELVRRGVSDYVISPVG 137

Query: 139 VADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLAD 198
             DI+ S+  +FT  E    + G  I+ +G++GGVG+STIAHN A++IA   A++ ++AD
Sbjct: 138 PLDIVRSVCNLFTTPE--AKAVGRIIAVVGAKGGVGASTIAHNVAWAIARDLALDAVVAD 195

Query: 199 LDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYD 258
           LDL +GTA +++++DP   I+DA++   R+D AF+ RL     ++L++L APA L R YD
Sbjct: 196 LDLAFGTAGLDYNQDPPQGIADAVFSPDRVDTAFLDRLLSKCTDHLNLLAAPATLDRVYD 255

Query: 259 FDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLI 318
           F       + D L    P ++LDVPH W+ WT+  L  +D ++I  + DLA LRN+KN+ 
Sbjct: 256 FGNDAFDAIFDTLRTTMPCIVLDVPHQWSGWTKRALVGADDILIVAAPDLANLRNTKNMF 315

Query: 319 DVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
           D LK  RP D+ P   LNQV  PK+PEI   +F   +   P   IPF+  +FG +AN+G+
Sbjct: 316 DTLKAARPNDRAPIYCLNQVGIPKRPEIKAGEFAKAIENDPIVSIPFEPQIFGSAANNGQ 375

Query: 379 MIHEVDPKSAIANLLVDFSRVLMGR 403
           MI E+      A + +  ++ L GR
Sbjct: 376 MIAEISANHRTAEMFLQIAQRLTGR 400


>gi|304320649|ref|YP_003854292.1| pilus assembly protein CpaE [Parvularcula bermudensis HTCC2503]
 gi|303299551|gb|ADM09150.1| pilus assembly protein CpaE [Parvularcula bermudensis HTCC2503]
          Length = 553

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 154/410 (37%), Positives = 256/410 (62%), Gaps = 5/410 (1%)

Query: 14  ENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFS 73
           E  D  + ++  +PRI+VHVF   +    +VE++  D RMS+ ++ I+ G  A A   ++
Sbjct: 147 EETDTTALNIAPIPRINVHVFTQNEATTLIVEKAAADRRMSKTHVTISAGDAASAAQIYA 206

Query: 74  DSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYL 133
           + ++P+LI+++       +L+ L+ LAEVCD  + V++IG  ND+ LYR+LI   VS+Y+
Sbjct: 207 EEASPNLILIEASESPTSLLAGLDQLAEVCDPSSHVMIIGHLNDIQLYRSLIDRGVSDYI 266

Query: 134 IEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAME 193
           + P S   II +I  I+T  +    + G S  F+G+RGGVGSSTI HN A+++A  +A +
Sbjct: 267 VAPRSPLQIIEAIGKIYT--DPAVSTIGRSFVFVGARGGVGSSTICHNVAWALAEEYASD 324

Query: 194 TLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAML 253
           T+L DLDLP+GTA+++F++DP   +++A+    R+D   + RL     + LSI +AP ML
Sbjct: 325 TVLLDLDLPFGTASLDFERDPSQGLAEALSSPERLDSVLLDRLLQEVTKRLSIFSAPNML 384

Query: 254 SRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRN 313
            RTY+   +    V+D++ Q  P V++D+PH+W+ W+Q VL  +D++VIT + DL+  RN
Sbjct: 385 ERTYELSPENFEIVIDLVRQAAPSVVVDLPHIWSPWSQHVLHGADEIVITATPDLSSFRN 444

Query: 314 SKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMS 373
           +KNL++V+K  R  D PP L+LNQ+  PK+PE+ +  F   L +   ++ P+D A FG +
Sbjct: 445 AKNLVEVIKAHRANDAPPILLLNQMGVPKRPEVPVEQFEEALDLEALSVFPWDPAAFGQA 504

Query: 374 ANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNM 423
           + + + + E++PKS  A  L   S  L+G+   +K Q      +K +F++
Sbjct: 505 STNAETLIELNPKSKCAVALRTVSERLLGQTQSAKKQ---RLSLKSLFSL 551


>gi|114568972|ref|YP_755652.1| response regulator receiver protein [Maricaulis maris MCS10]
 gi|114339434|gb|ABI64714.1| response regulator receiver protein [Maricaulis maris MCS10]
          Length = 493

 Score =  312 bits (800), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 156/392 (39%), Positives = 248/392 (63%), Gaps = 2/392 (0%)

Query: 26  LPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQT 85
           +PRISV  FC      +++  +  D R+++ ++ +  G +  A+  + D +TP+L+I+++
Sbjct: 101 VPRISVGAFCERPETGALIHNAANDRRLAKAHVTVELGGLPAAIERYHDETTPNLLIIES 160

Query: 86  KVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINS 145
            +  R +   LE LA VCD  TKVI++G  ND+SLYR L+   VSEYL+ P++   +I +
Sbjct: 161 GMRGRGLFDQLEELAGVCDPDTKVIIVGAANDISLYRELMKRGVSEYLVPPMTPMHVIRT 220

Query: 146 ISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGT 205
           IS +F   E+    +G +I+FIG++GGVGSSTIAHNC +++      + +L DLDL +GT
Sbjct: 221 ISELFLDPEQP--FAGKTIAFIGAKGGVGSSTIAHNCTWAMTEGMQSDAVLVDLDLSFGT 278

Query: 206 ANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIV 265
           A ++F++DP  ++ DA+    R+D A + RL V   + LS+ +APA L R +DF  +   
Sbjct: 279 AGLDFNQDPAQTLGDALAEPDRLDDALLDRLLVRCTDRLSLFSAPATLDREWDFGPQDYE 338

Query: 266 PVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
            VL+ + +  P V LD+PH+W  W ++ L  +D+VV+T S DLA LRN+KNL D++   R
Sbjct: 339 TVLEKVRRQAPYVALDLPHMWTPWVKQTLLAADQVVVTVSPDLASLRNAKNLFDLVAGAR 398

Query: 326 PADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDP 385
           P D+PP +V+N    PK+PEI I DF   LG  P+ ++PF+  +FG +AN+G+MI E+DP
Sbjct: 399 PNDEPPRVVINMAGMPKRPEIPIKDFAEALGTPPTLVLPFEPQLFGKAANNGQMITELDP 458

Query: 386 KSAIANLLVDFSRVLMGRVTVSKPQSAMYTKI 417
           KS  A      + ++ GR  V+ P+ ++  K+
Sbjct: 459 KSKAAEGFSHLASLVSGRTPVAMPKRSLIAKL 490


>gi|188581662|ref|YP_001925107.1| response regulator receiver protein [Methylobacterium populi BJ001]
 gi|179345160|gb|ACB80572.1| response regulator receiver protein [Methylobacterium populi BJ001]
          Length = 414

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 154/392 (39%), Positives = 240/392 (61%), Gaps = 2/392 (0%)

Query: 20  SESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPD 79
             ++  +PRI++  FC T    +++E    D RM + ++++  G  A A+  +  + TP+
Sbjct: 9   ERTIAPVPRITIQAFCETPETAAMIEDIASDRRMQKAHVKVQMGGGAAALEAYRHAPTPN 68

Query: 80  LIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSV 139
           +I+++        L  L+ LAEVCD GTKV+V+G  NDV LYR  I   VSEYL+ P+  
Sbjct: 69  VILLEFLGLKSRPLECLDQLAEVCDEGTKVLVVGHVNDVLLYRQFIQRGVSEYLMAPVEP 128

Query: 140 ADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADL 199
            D+I +IS +FT    G    G +++  G+RGGVGSSTIAHN A+++A      T++ DL
Sbjct: 129 VDMIAAISELFT--APGAKPVGRTVAVYGARGGVGSSTIAHNLAWTVAREHGTATVIVDL 186

Query: 200 DLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDF 259
           D+ +GTA +NF++DP   I++A++   R+D   + RL    A+NLS+L+APA L RT D 
Sbjct: 187 DVAFGTAGLNFNQDPPQGIAEAVFAPERLDANLLDRLLSKCADNLSLLSAPATLDRTVDL 246

Query: 260 DEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLID 319
            E     + D+L    P ++LDVPH W++WT+ VL  +D+++I    DLAGLRN KNL+ 
Sbjct: 247 TEPAFDALTDLLRAAVPCIVLDVPHQWSAWTRRVLVSADEILIVAPPDLAGLRNVKNLVA 306

Query: 320 VLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKM 379
           +L + RP D    +VLN V  PK+PEI+ ++F   L +   AI+PF+ A+FG +AN+G+M
Sbjct: 307 LLHQQRPNDARARIVLNGVGVPKRPEIAAAEFAKALDLPLQAILPFEPALFGTAANNGQM 366

Query: 380 IHEVDPKSAIANLLVDFSRVLMGRVTVSKPQS 411
           I E+   S  A +  D +  + GR  + + ++
Sbjct: 367 IAEIQAGSKPAEIFSDLAAAVTGRAEIRRARA 398


>gi|27375775|ref|NP_767304.1| CtpF protein [Bradyrhizobium japonicum USDA 110]
 gi|27348913|dbj|BAC45929.1| CtpF protein [Bradyrhizobium japonicum USDA 110]
          Length = 429

 Score =  309 bits (791), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 151/402 (37%), Positives = 243/402 (60%), Gaps = 3/402 (0%)

Query: 9   NSDFLENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEA 68
           N +  ++  +  E +  +PRISV  FC TD   + V  +  D R+++ ++    G +A A
Sbjct: 5   NDEETDHPRHPEEHIAPVPRISVQAFCETDQTLAAVTAAGEDRRLAKAHLTAKEGGLAAA 64

Query: 69  VSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNH 128
           +  +    TP++I++++   +R++L  L+ LA VCD GT+V+VIG+ ND + YR L+   
Sbjct: 65  IEVYETMPTPNVIVIESD-GTRDILEGLDDLAGVCDPGTRVVVIGNPNDTAPYRELVRRG 123

Query: 129 VSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIAS 188
           V++Y++ P+   D++ SI ++F+  E     +G  I+ +G++GGVG+ST+AHN A++IA 
Sbjct: 124 VNDYVVGPVETIDVVRSICSLFSASE--AIITGRVIAVVGAKGGVGASTVAHNVAWTIAR 181

Query: 189 VFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILT 248
             A+++++ DLDL +GTA++++++DP+  I++A+    R D A + RL     E LS+L 
Sbjct: 182 DLALDSVVIDLDLAFGTASLDYNQDPVQGIANAVLSQDRPDTALMERLLAKCTERLSLLA 241

Query: 249 APAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDL 308
           APA L R YDF  +    V D L    P ++LDVPH W+ WT+  L  +D +VI    DL
Sbjct: 242 APATLDRVYDFGAEAFDAVFDTLRMTTPCIVLDVPHQWSGWTRRALINADDIVIVAEPDL 301

Query: 309 AGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGA 368
           A LRN+KN++ VLK  RP D+PP   +NQV   K+ EI +  F   +   P A+IPFD  
Sbjct: 302 ANLRNTKNMLTVLKTARPNDRPPLYCINQVGMHKRAEIDVKSFAKTMESQPIAVIPFDSK 361

Query: 369 VFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQ 410
           +F  +AN+G+MI EV        L  + +  L+GR  V KP+
Sbjct: 362 LFSTAANNGQMIAEVSKSHRTTALFQNMANRLVGRGEVKKPK 403


>gi|163851905|ref|YP_001639948.1| putative pilus assembly protein CpaE [Methylobacterium extorquens
           PA1]
 gi|163663510|gb|ABY30877.1| putative pilus assembly protein CpaE [Methylobacterium extorquens
           PA1]
          Length = 414

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 153/388 (39%), Positives = 238/388 (61%), Gaps = 2/388 (0%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
            ++  +PRI++  FC T    +++E    + RM + ++++  G  A A+  +  + TP++
Sbjct: 10  RTIAPVPRITIQAFCETPETAAMIEGIAAERRMQKAHVKVQMGGGAAALEAYRHAPTPNV 69

Query: 81  IIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA 140
           I+++        L  L+ LAEVCD GTKV+VIG  NDV LYR  I   VSEYL+ P+   
Sbjct: 70  IVLEFLNLKSRPLECLDQLAEVCDEGTKVLVIGHVNDVLLYRQFIQRGVSEYLMAPVEPV 129

Query: 141 DIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLD 200
            +I ++S +F     G    G +++  G+RGGVGSST+A N A+++A      T++ADLD
Sbjct: 130 AMIAAVSDLFA--APGAKPVGRTVAVYGARGGVGSSTVAQNLAWTVAREHGTATVIADLD 187

Query: 201 LPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFD 260
           + +GTA++NF++DP   I++A++   R+D   + RL    A+NLS+L+APA L RT D  
Sbjct: 188 VAFGTASLNFNQDPPQGIAEAVFAPERLDANLLDRLLSKCADNLSLLSAPATLDRTVDLT 247

Query: 261 EKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDV 320
           E     + D+L    P ++LDVPH W++WT+ VL  +D+++I    DLAGLRN KNL+ +
Sbjct: 248 EPAFDALTDLLRAAVPCIVLDVPHQWSAWTRRVLISADEILIVAPPDLAGLRNVKNLLAL 307

Query: 321 LKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMI 380
           L +LRP D    +VLN V  PK+PEI+ ++F   L +   A+IPFD A+FG +AN+G+MI
Sbjct: 308 LHQLRPNDARARVVLNGVGVPKRPEIAAAEFSKALDVPLQAVIPFDPALFGTAANNGQMI 367

Query: 381 HEVDPKSAIANLLVDFSRVLMGRVTVSK 408
            EV   S  A +  D +  + GR  + +
Sbjct: 368 AEVQAGSKPAEIFSDLAAAVTGRTEIRR 395


>gi|302381754|ref|YP_003817577.1| pilus assembly ATPase CpaE [Brevundimonas subvibrioides ATCC 15264]
 gi|302192382|gb|ADK99953.1| pilus assembly ATPase CpaE [Brevundimonas subvibrioides ATCC 15264]
          Length = 506

 Score =  305 bits (782), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 149/379 (39%), Positives = 232/379 (61%), Gaps = 2/379 (0%)

Query: 25  SLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQ 84
           ++PRI++HVF       +  ER+  D RMS+   +I  G I  AV  +S   TP LI+V+
Sbjct: 103 NVPRIAIHVFGERQDTLAAAERAGQDRRMSRATTQIRIGGIPAAVEAYSHEPTPPLIVVE 162

Query: 85  TKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIIN 144
              D + +L  ++ LAE CD+GTKV+VIG TND+ L+R L+   VSEY++ P+    +I 
Sbjct: 163 CLQDPQTLLWQVDRLAECCDAGTKVVVIGATNDIILFRELMKRGVSEYMVAPVQPLQLIA 222

Query: 145 SISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYG 204
           +I  +F+  +  +   G SI+F+G+RGG GSS++AHN A++++      T++ D DLP+G
Sbjct: 223 AIGGLFS--DPAQPFVGRSIAFVGARGGAGSSSVAHNTAYAMSEKIGANTVIVDYDLPFG 280

Query: 205 TANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMI 264
           TA ++F++DP++ ++DA+    R+D   + R+ V   + LS+  APA L   ++      
Sbjct: 281 TAGLDFNQDPLSGVADALGQPDRLDPVLLDRMMVRCTDKLSLFAAPATLDTDWEISADAF 340

Query: 265 VPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL 324
             V   +    P V+LD+PH+W+ W ++ L  +D+VV+  + DLA LRN+KN+ID+++  
Sbjct: 341 EEVTTQIRGTAPFVVLDLPHLWSGWMRKTLIAADEVVVVATPDLASLRNAKNMIDLIRSG 400

Query: 325 RPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVD 384
           RP D PP LVLNQV  P +PEI   DF A LGI P   IPFD  +FG +AN+G+MI +  
Sbjct: 401 RPNDAPPRLVLNQVGVPGRPEIPAKDFGAALGIHPCLSIPFDAKLFGAAANNGQMILDAG 460

Query: 385 PKSAIANLLVDFSRVLMGR 403
            KS  A      ++++  R
Sbjct: 461 AKSKSAEAFQTLAQIVSRR 479


>gi|218530656|ref|YP_002421472.1| pilus assembly protein CpaE [Methylobacterium chloromethanicum CM4]
 gi|218522959|gb|ACK83544.1| putative pilus assembly protein CpaE [Methylobacterium
           chloromethanicum CM4]
          Length = 414

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 154/389 (39%), Positives = 240/389 (61%), Gaps = 4/389 (1%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
            ++  +PRI++  FC T    +++E    + RM + ++++  G  A A+  +  + TP++
Sbjct: 10  RTIAPVPRITIQAFCETPETAAMIEGIAAERRMQKAHVKVQMGGGAAALEAYRHAPTPNV 69

Query: 81  IIVQ-TKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSV 139
           I+++   + SR  L  L+ LAEVCD GTKV+VIG  NDV LYR  I   VSEYL+ P+  
Sbjct: 70  IVLEFLNLKSRP-LECLDQLAEVCDEGTKVLVIGHVNDVLLYRQFIQRGVSEYLMAPVEP 128

Query: 140 ADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADL 199
             +I ++S +F     G    G +++  G+RGGVGSST+A N A+++A      T++ADL
Sbjct: 129 VAMIAAVSDLFA--APGAKPVGRTVAVYGARGGVGSSTVAQNLAWTVAREHGTATVIADL 186

Query: 200 DLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDF 259
           D+ +GTA++NF++DP   I++A++   R+D   + RL    A+NLS+L+APA L RT D 
Sbjct: 187 DVAFGTASLNFNQDPPQGIAEAVFAPERLDANLLDRLLSKCADNLSLLSAPATLDRTVDL 246

Query: 260 DEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLID 319
            E     + D+L    P ++LDVPH W++WT+ VL  +D+++I    DLAGLRN KNL+ 
Sbjct: 247 TEPAFDALTDLLRAAVPCIVLDVPHQWSAWTRRVLISADEILIVAPPDLAGLRNVKNLLA 306

Query: 320 VLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKM 379
           +L + RP D    +VLN V  PK+PEI+ ++F   L +   A+IPFD A+FG +AN+G+M
Sbjct: 307 LLHQQRPNDARARVVLNGVGVPKRPEIAAAEFSKALDVPLQAVIPFDPALFGTAANNGQM 366

Query: 380 IHEVDPKSAIANLLVDFSRVLMGRVTVSK 408
           I EV   S  A +  D +  + GR  + +
Sbjct: 367 IAEVQASSKPAEIFSDLAAAVTGRTEIRR 395


>gi|209886532|ref|YP_002290389.1| pilus assembly protein [Oligotropha carboxidovorans OM5]
 gi|209874728|gb|ACI94524.1| pilus assembly protein [Oligotropha carboxidovorans OM5]
          Length = 420

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 157/409 (38%), Positives = 249/409 (60%), Gaps = 3/409 (0%)

Query: 16  EDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDS 75
           E    E +   PR+SV  FC T    + V+ +  D R+++ +++I  G +A A+  +  +
Sbjct: 15  EAGGEEHIAPAPRVSVQAFCETVETAAAVQAACEDRRLAKAHLKIQMGGLAAAIEAYRTA 74

Query: 76  STPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIE 135
            TP++I+++T  +  ++L  L+ LA VCD+GT+VIV+G  NDV+LYR L+   VS+Y+I 
Sbjct: 75  PTPNVILLETD-NQTDILPGLDQLASVCDAGTRVIVVGRINDVTLYRELVRRGVSDYIIL 133

Query: 136 PLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETL 195
           P    DI+ SI ++FT  E    + G  I+ +G++GGVG+ST+AHN A++IA   A++++
Sbjct: 134 PAGPLDIVRSICSLFTSPE--AKAVGRVIAIVGAKGGVGASTVAHNVAWAIARDLALDSV 191

Query: 196 LADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSR 255
           +ADLDL +GTA +++++DP   I+DA++   RID AF+ RL     ++L++L APA L R
Sbjct: 192 VADLDLAFGTAGLDYNQDPPQGIADAVFSPDRIDTAFLDRLLSKCTDHLNLLAAPAALDR 251

Query: 256 TYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSK 315
            YDF       + D L    P +ILDVPH W+ WT+  L  +D ++I  + DLA LRN+K
Sbjct: 252 VYDFGTDAFDAIFDTLRTTMPCIILDVPHQWSGWTKRALVGADDILIVAAPDLANLRNTK 311

Query: 316 NLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSAN 375
           N+ D LK  RP D+ P   LNQV  PK+PEI  S+F   +   P   IPF+  +FG +AN
Sbjct: 312 NIFDTLKAARPNDRAPVYCLNQVGVPKRPEIKASEFAKAIESDPIVSIPFEPQIFGTAAN 371

Query: 376 SGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMK 424
           +G+MI E+        + +  ++ L GR    K  +++++ +   F  K
Sbjct: 372 NGQMIAEISANHRTTEMFLQIAQRLTGRGDSKKTSNSLFSPLLGKFRRK 420


>gi|240139028|ref|YP_002963503.1| pilus assembly protein cpaE [Methylobacterium extorquens AM1]
 gi|254561623|ref|YP_003068718.1| pilus assembly protein cpaE [Methylobacterium extorquens DM4]
 gi|240009000|gb|ACS40226.1| pilus assembly protein cpaE [Methylobacterium extorquens AM1]
 gi|254268901|emb|CAX24862.1| pilus assembly protein cpaE [Methylobacterium extorquens DM4]
          Length = 414

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 152/388 (39%), Positives = 237/388 (61%), Gaps = 2/388 (0%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDL 80
            ++  +PRI++  FC T    +++E    + RM + ++++  G  A A+  +  + TP++
Sbjct: 10  RTIAPVPRITIQAFCETPETAAMIEGIAAERRMQKAHVKVQMGGGAAALEAYRHAPTPNV 69

Query: 81  IIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA 140
           I+++        L  L+ LAEVCD GTKV+VIG  NDV LYR  I   VSEYL+ P+   
Sbjct: 70  IVLEFLNLKSRPLECLDQLAEVCDEGTKVLVIGHVNDVLLYRQFIQRGVSEYLMAPVEPV 129

Query: 141 DIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLD 200
            +I ++S +F     G    G +++  G+RGGVGSST+A N A+++A      T++ADLD
Sbjct: 130 AMIAAVSDLFA--APGAKPVGRTVAVYGARGGVGSSTVAQNLAWTVAREHGTATVIADLD 187

Query: 201 LPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFD 260
           + +GTA++NF++DP   I++A++   R+D   + RL    A+NLS+L+APA L RT D  
Sbjct: 188 VAFGTASLNFNQDPPQGIAEAVFAPERLDANLLDRLLSKCADNLSLLSAPATLDRTVDLT 247

Query: 261 EKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDV 320
           E     + D+L    P ++LDVPH W++WT+ VL  +D+++I    DLAGLRN KNL+ +
Sbjct: 248 EPAFDALTDLLRAAVPCIVLDVPHQWSAWTRRVLISADEILIVAPPDLAGLRNVKNLLAL 307

Query: 321 LKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMI 380
           L + RP D    +VLN V  PK+PEI+ ++F   L +   A+IPFD A+FG +AN+G+MI
Sbjct: 308 LHQQRPNDARARVVLNGVGVPKRPEIAAAEFSKALDVPLQAVIPFDPALFGTAANNGQMI 367

Query: 381 HEVDPKSAIANLLVDFSRVLMGRVTVSK 408
            EV   S  A +  D +  + GR  + +
Sbjct: 368 AEVQAGSKPAEIFSDLAAAVTGRTEIRR 395


>gi|254293216|ref|YP_003059239.1| Flp pilus assembly protein ATPase CpaE-like protein [Hirschia
           baltica ATCC 49814]
 gi|254041747|gb|ACT58542.1| Flp pilus assembly protein ATPase CpaE-like protein [Hirschia
           baltica ATCC 49814]
          Length = 762

 Score =  303 bits (777), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 149/378 (39%), Positives = 229/378 (60%), Gaps = 2/378 (0%)

Query: 26  LPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQT 85
           +PRI++H FC T     ++ +S  D RM  V   I  G +  A++ + +   P +I+V++
Sbjct: 371 IPRITIHAFCQTQMCQQMLNKSMQDRRMVNVTADIVEGGVVAAINYYQEHDLPHMIVVES 430

Query: 86  KVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINS 145
              S ++L+ L+ LA++CD   KV+VIG  ND+ LYR L++  VSEY++ PL    +I +
Sbjct: 431 TAKSAKLLAELDELAQLCDETVKVVVIGAANDIRLYRELMARGVSEYIVPPLETVQLIRA 490

Query: 146 ISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGT 205
           IS+ F   E  +   G +++  G +GGVGSSTIAHN A++I+      T L DLDL +GT
Sbjct: 491 ISSQFADPE--QPFVGKTLAVTGVKGGVGSSTIAHNLAWAISERLKQATTLIDLDLNFGT 548

Query: 206 ANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIV 265
             ++F+ +   +I+DA+    R D A ++RL     +NLS+ TAPA L RTYD DE+   
Sbjct: 549 TGLDFNSESNQTIADALMAPDRFDDAVMNRLLTQATDNLSLFTAPASLDRTYDVDEETYS 608

Query: 266 PVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
            VL+ + +  P V+LD+PH+W  W +  +  +D++V+    DLA LRN KNLID LK  R
Sbjct: 609 IVLNKVRETVPFVVLDLPHIWTDWFKGTVVSADEIVVVVQPDLASLRNGKNLIDFLKAAR 668

Query: 326 PADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDP 385
           P D  P LV+NQV  PK+PEI + DF   + + P  ++PFD  +FG +AN+G+MI +V  
Sbjct: 669 PNDSKPRLVINQVGVPKRPEIPVKDFAQAMDLEPDLVLPFDPQLFGTAANNGQMIADVAE 728

Query: 386 KSAIANLLVDFSRVLMGR 403
            S  +  +   + ++ GR
Sbjct: 729 DSKCSQGIDYLASLVTGR 746


>gi|146342080|ref|YP_001207128.1| putative pilus assembly protein CpaE [Bradyrhizobium sp. ORS278]
 gi|146194886|emb|CAL78911.1| putative pilus assembly protein cpaE [Bradyrhizobium sp. ORS278]
          Length = 422

 Score =  301 bits (772), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 151/406 (37%), Positives = 241/406 (59%), Gaps = 3/406 (0%)

Query: 19  LSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTP 78
           L + +  +PR+SV  F  TD   S V  +  D R+ + ++ I  G +A A+  +    TP
Sbjct: 20  LDDHIAPVPRVSVQAFTETDQTSSAVLAASQDRRLGKAHITIKAGGMARAIETYHSQPTP 79

Query: 79  DLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLS 138
           ++I+++TK    +++  L+ LA VCD GT+V++IG  +D   YR L+   V++Y+I P+ 
Sbjct: 80  NVIVIETKPGG-DIIGGLDDLASVCDPGTRVVLIGSPSDGVAYRELVRRGVNDYVIGPVE 138

Query: 139 VADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLAD 198
             D+I SI ++F+  E     +G  I+ +G++GGVG+ST+AHN A+S+A    +++++ D
Sbjct: 139 TIDVIRSICSLFSASE--AVITGRIIAVVGAKGGVGASTVAHNVAWSMARDLTLDSVVID 196

Query: 199 LDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYD 258
           LD+ +GTA +++++DP+  I++AI+   R D A + RL     E+L++L APA L R YD
Sbjct: 197 LDMAFGTAGLDYNQDPMQGIANAIFQPDRPDTALMERLLAKCTEHLNLLAAPATLDRVYD 256

Query: 259 FDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLI 318
           F       + D L      ++LDVPH W++WT+  L  +D +++    DLA LRN+KNL+
Sbjct: 257 FGADAFDAIFDTLRLTQQCIVLDVPHQWSAWTRHALINADDILVVAEPDLANLRNAKNLL 316

Query: 319 DVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
            VLK  RP D+PP   LNQV  PK+PEI +  F   +   P A+IPFD  +FG +AN+G+
Sbjct: 317 SVLKSSRPNDRPPLYCLNQVGMPKRPEIDLKRFAKTVEAEPVAVIPFDCKLFGTAANNGQ 376

Query: 379 MIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMK 424
           MI EV   S    L  + +  L GRV     + ++   I K+   K
Sbjct: 377 MIAEVGALSRTPKLFKELANRLTGRVEPKPQRGSLLAPIAKLLGAK 422


>gi|254473797|ref|ZP_05087192.1| pilus assembly protein [Pseudovibrio sp. JE062]
 gi|211957183|gb|EEA92388.1| pilus assembly protein [Pseudovibrio sp. JE062]
          Length = 386

 Score =  301 bits (770), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 147/376 (39%), Positives = 241/376 (64%), Gaps = 2/376 (0%)

Query: 44  VERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVC 103
           ++ + +D RMS+ +  + +G I  AV  F  ++TP+ +IV++     EV+  L+ LAEVC
Sbjct: 9   IQNASLDRRMSKAHTMVRQGGIPAAVETFQSAATPNFLIVESLSSPNEVIEELDQLAEVC 68

Query: 104 DSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCS 163
           D+GT V+VIG  NDV+LYRALI   V EY++ P+ +A IIN+I   ++  E      G +
Sbjct: 69  DAGTNVLVIGRVNDVNLYRALIQRGVGEYIVGPVDIAQIINTIGQFYSDTE--AEPFGRT 126

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           I+ IG++GG G+S++AHN ++SIA     +  +ADLDLP+GTA ++F++DP+  + +A+ 
Sbjct: 127 IAVIGAKGGCGASSVAHNLSWSIAKTLDNDVAIADLDLPFGTAGLDFNQDPLQGVMEAVA 186

Query: 224 PVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVP 283
              R+D   + RL     + LS+L APA L +TYDF+      V++++++  P V+LD+P
Sbjct: 187 SPERLDDTLLDRLLSKCNDRLSLLAAPATLDQTYDFETDKFDQVIEVMQKGTPTVVLDLP 246

Query: 284 HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKK 343
           H WN W + +L   D+V+I    DLA LRN+KNL+D + +LRP D  PYLVLN+V  PK+
Sbjct: 247 HTWNGWVRHILAHVDEVLIVAEPDLANLRNAKNLVDSIGQLRPNDAKPYLVLNKVGIPKR 306

Query: 344 PEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGR 403
           PEI   +F + L +   A +PF+ A+FG ++N+G+MI E D + A++ L  + +  + G+
Sbjct: 307 PEIKPDEFSSALDVVSLASMPFEPALFGTASNNGQMIAEFDSRHAVSGLFEEIAAKVTGK 366

Query: 404 VTVSKPQSAMYTKIKK 419
             +++   +++  + K
Sbjct: 367 AEMNQKSKSLFASLMK 382


>gi|148256959|ref|YP_001241544.1| putative pilus assembly protein CpaE [Bradyrhizobium sp. BTAi1]
 gi|146409132|gb|ABQ37638.1| putative pilus assembly protein cpaE [Bradyrhizobium sp. BTAi1]
          Length = 422

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 145/406 (35%), Positives = 243/406 (59%), Gaps = 3/406 (0%)

Query: 19  LSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTP 78
           L++ +  +PR+SV  FC TD   + +  +  D R+ + ++ I  G +  A+  +    TP
Sbjct: 20  LNDHIAPVPRVSVQAFCETDQTSAAILAASQDRRLGKAHITIKAGGMPRAIETYHSQPTP 79

Query: 79  DLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLS 138
           ++I+++TK    ++L  L+ LA V D GT+V++IG+  D   YR L+   V++Y++ P+ 
Sbjct: 80  NVIVLETKPGG-DILGGLDDLASVYDPGTRVVLIGNPADGVAYRELVRRGVNDYVVGPVE 138

Query: 139 VADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLAD 198
             D+I SI ++F+  E     +G  I+ IG++GGVG+ST+AHN A+S+A    +++++ D
Sbjct: 139 TIDVIRSICSLFSASE--AVITGRIIAVIGAKGGVGASTVAHNVAWSMARDLTLDSVVID 196

Query: 199 LDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYD 258
           LD+ +GTA +++++DP+  I++A++   R D A + RL     E+L++L APA L R YD
Sbjct: 197 LDMAFGTAGLDYNQDPMQGIANAVFQPDRPDTALMDRLLAKCTEHLNLLAAPATLERVYD 256

Query: 259 FDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLI 318
           F       + D L      ++LDVPH W++WT+  L  +D +++    DLA LRN+KNL+
Sbjct: 257 FGADAFDAIFDTLRMTQQCIVLDVPHQWSAWTRHALINADDILVVAEPDLANLRNAKNLL 316

Query: 319 DVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
            VLK  RP D+PP   LNQV  P++PEI +  F   +   P A+IPFD  +FG +AN+G+
Sbjct: 317 GVLKASRPNDRPPLYCLNQVGMPRRPEIDLKRFAKTVEAEPVAVIPFDCKLFGTAANNGQ 376

Query: 379 MIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMK 424
           MI E+   +    L ++ +  L GRV     +S++   I ++   K
Sbjct: 377 MIAEIAALNRTPKLFLEIANRLTGRVDPKPQRSSLLAPIARLLGAK 422


>gi|220923694|ref|YP_002498996.1| response regulator receiver protein [Methylobacterium nodulans ORS
           2060]
 gi|219948301|gb|ACL58693.1| response regulator receiver protein [Methylobacterium nodulans ORS
           2060]
          Length = 423

 Score =  296 bits (759), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 152/380 (40%), Positives = 235/380 (61%), Gaps = 4/380 (1%)

Query: 26  LPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQT 85
           +P+ISVH FC T    + +E +  D RMS+ +  +  G I  A + +  ++TP+L++++ 
Sbjct: 26  VPQISVHAFCDTPETAATLEAAFADRRMSRAHASVYPGGIPAAAAHYRQATTPNLLVLEA 85

Query: 86  KVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINS 145
                 +L+ LE LAEVCD  TKV+VIG  ND+ LYR L+   +SEYL+ P+    +I +
Sbjct: 86  SDAGSRLLADLEILAEVCDRSTKVVVIGKVNDIRLYRELLDRGISEYLVAPVEPVGLIAA 145

Query: 146 ISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGT 205
           ++ ++  ++ G    G S++FIG++GGVGSS +AHN A +IA  +  E +LADLDLP+G+
Sbjct: 146 VAQLY--RDAGASKLGRSLAFIGAKGGVGSSVVAHNVAAAIARSYDTEVILADLDLPFGS 203

Query: 206 ANI--NFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKM 263
           A++  N D++    I+DA+   GR+D   + RL     E+LS+L+APA L   +D D   
Sbjct: 204 ASLALNLDQEKGQGIADALANTGRLDDVLLERLLTKSGEHLSVLSAPATLDHCHDLDGGA 263

Query: 264 IVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKK 323
              ++++ +   P V+LD+PHVW  W +  L  +D+VVIT + DL  LRN+KNLI  L +
Sbjct: 264 FERLIEVAQASVPFVVLDLPHVWMPWAKSTLLAADEVVITATPDLTSLRNAKNLISFLTQ 323

Query: 324 LRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEV 383
            RP D  P LVLNQV  PK+ EI +  F A L + P+A IPF+ +VF  +AN G+++ +V
Sbjct: 324 ARPNDALPKLVLNQVGVPKRAEIKVDKFAAALELEPAACIPFEASVFSTAANEGRLVADV 383

Query: 384 DPKSAIANLLVDFSRVLMGR 403
             K+   +     +RV+ GR
Sbjct: 384 SAKARACSAFDHIARVISGR 403


>gi|300021856|ref|YP_003754467.1| response regulator receiver protein [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299523677|gb|ADJ22146.1| response regulator receiver protein [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 434

 Score =  293 bits (751), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 153/400 (38%), Positives = 239/400 (59%), Gaps = 3/400 (0%)

Query: 5   YDGHNSDFLENEDNLS-ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRG 63
           +D   SD  E +D  S E    +PRIS+  FC    + + ++ +  D R+S+ ++ +  G
Sbjct: 11  FDPGFSDNGERQDTYSSERARPVPRISIQAFCDDVGVANTIQFAAEDRRLSKAHVSVHMG 70

Query: 64  SIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRA 123
            IA A+S + DS TP+LII+   +DS  +L+ L+ LAE CD GTKV+VIG  NDV LYR 
Sbjct: 71  GIAAAISHYVDSPTPNLIILDCALDSGSLLAELDRLAESCDPGTKVVVIGRQNDVMLYRE 130

Query: 124 LISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCA 183
           L+   V EYL+ P+    ++ SIS ++   E      G   +F+G++GGVGSST+ HN  
Sbjct: 131 LLKRGVGEYLVAPVDPLAVMESISNLYNNPE--TDPVGHVFAFVGAKGGVGSSTVCHNVG 188

Query: 184 FSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAEN 243
           ++++ +   +  +ADLDL +GT  ++F++DP+  I++A+    R+D   + RL    +E+
Sbjct: 189 WTMSEILKTDVAIADLDLAFGTTGLDFNQDPVQGIAEALAAPERLDDQLLDRLMTKCSEH 248

Query: 244 LSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVIT 303
           LSI  AP ++ R Y+   +    VLDI+ Q  PLV +D+PH W+ W++ VL  +D+VVIT
Sbjct: 249 LSIFAAPVVIDRDYEISPEACDTVLDIVRQNVPLVAVDLPHGWSPWSKRVLLQADQVVIT 308

Query: 304 TSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAII 363
              DLA LRN+KN++D+L+  R  D  P L+LN   TPK+ EI+I +F   L     A+I
Sbjct: 309 AVPDLANLRNAKNIVDLLRTSRKNDNQPLLILNMANTPKRQEITIKEFEQALDSKVMAVI 368

Query: 364 PFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGR 403
            +D   F  ++N+G+M+ E  PK+       D +  + GR
Sbjct: 369 DYDPESFSQASNNGQMLEEFSPKAKAVEKFHDIAMKITGR 408


>gi|227818615|ref|YP_002822586.1| CpaE2 pilus assembly protein [Sinorhizobium fredii NGR234]
 gi|36958871|gb|AAQ87296.1| CpaE [Sinorhizobium fredii NGR234]
 gi|227337614|gb|ACP21833.1| CpaE2 pilus assembly protein [Sinorhizobium fredii NGR234]
          Length = 580

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 143/375 (38%), Positives = 232/375 (61%), Gaps = 2/375 (0%)

Query: 23  MCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLII 82
           + S+P++ + VFC ++ L   V  + ID RM++  + I  G I EA + +   ++P+L++
Sbjct: 19  LLSIPKVDIAVFCRSEALMGTVRTAAIDRRMARATVTINEGGIEEAAALYGGVTSPNLVV 78

Query: 83  VQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADI 142
           V++  +   ++ ALE LA  C +GTKVIV+G +NDV LY+ L+   VS+YL+ PL   D 
Sbjct: 79  VESGDEEDRLMRALEDLAMECITGTKVIVVGRSNDVGLYKRLLDAGVSDYLVTPLDPMDF 138

Query: 143 INSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLP 202
           + ++   F    +GK   G  ++FIG++GG GSST+AHN A +++   A + L+ADLDL 
Sbjct: 139 VAAVHRCFRDSVDGK--LGRIVAFIGAKGGTGSSTLAHNVALAMSKRIASDVLVADLDLQ 196

Query: 203 YGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEK 262
           +GT  ++FD + +  ++D +    R+D   + RL V Y E+L +L     L+R +   E+
Sbjct: 197 FGTLGLDFDVEAVQGMTDVLSSPDRLDDVLLRRLTVPYTEHLHLLPTTTDLNRFFYLKEE 256

Query: 263 MIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK 322
            +  +LD+       +++D+PH+W  WT+++L  +D+VVIT + DLA +RN KNL+D+LK
Sbjct: 257 HVDHLLDVARSSSWQIVVDLPHIWMQWTRKILLEADEVVITATPDLASMRNVKNLVDLLK 316

Query: 323 KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHE 382
           K RP D PP LVLN+  TPK  EI   DF A +G+  S  +PFD  +FG +AN+G+++ E
Sbjct: 317 KARPNDPPPRLVLNRTDTPKLAEIKPKDFVAAVGLEESISVPFDPQLFGKAANNGQLVIE 376

Query: 383 VDPKSAIANLLVDFS 397
             P+S     +V  +
Sbjct: 377 SAPESKAGQAIVSLA 391


>gi|254420442|ref|ZP_05034166.1| hypothetical protein BBAL3_2752 [Brevundimonas sp. BAL3]
 gi|196186619|gb|EDX81595.1| hypothetical protein BBAL3_2752 [Brevundimonas sp. BAL3]
          Length = 520

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 158/403 (39%), Positives = 240/403 (59%), Gaps = 8/403 (1%)

Query: 25  SLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQ 84
           S+PRI++HVF       +  ER+  D R+S+   +I  G I  AV  +    TP LIIV+
Sbjct: 113 SVPRIAIHVFAERQDTLAAAERAAQDRRLSRATTQIRIGGIMAAVETYQHEPTPPLIIVE 172

Query: 85  TKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIIN 144
              D + +L  ++ LAEVCD+GTKV+V+G TND+ L+R L+   VSEYL+ PL    +I 
Sbjct: 173 CLKDPQTLLWEVDQLAEVCDAGTKVVVVGPTNDILLFRELMRRGVSEYLVGPLQPLQLIA 232

Query: 145 SISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYG 204
           +I  +F   +  +   G SI+F+G+RGG G+S +AHN A++I+      T++ D DLP+G
Sbjct: 233 AIGGLFN--DPAQPFVGRSIAFVGARGGAGASAVAHNTAYAISERIGANTVIVDYDLPFG 290

Query: 205 TANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMI 264
           TA ++F++DP++ ++DA+    R+D   + R+ V   + LS+  APA L   +D   +  
Sbjct: 291 TAGLDFNQDPLSGVADALGQPDRLDSTLLDRMMVRCTDKLSLFAAPATLDTDWDISTEAF 350

Query: 265 VPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL 324
             V   +    P V+LD+PH+W+ W +  L  +D+VVI  + DLA LRN+KN++D+++  
Sbjct: 351 EEVTTRIRSTAPFVVLDLPHLWSPWMRRTLISADEVVIVATPDLAALRNAKNMMDLIRSG 410

Query: 325 RPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVD 384
           RP D PP LVLNQV  P +PEI   DF A LG+ PS IIPFD   FG +AN+G+MI +  
Sbjct: 411 RPNDAPPRLVLNQVGVPGRPEIPAKDFGAALGVHPSLIIPFDAKTFGAAANNGQMILDAG 470

Query: 385 PKSAIANLLVDFSRVLMGRV------TVSKPQSAMYTKIKKIF 421
            K+  A      ++++  R         +KP  A  T+ K +F
Sbjct: 471 AKTKAAEAFQTLAQIVSRREIPVIAGPKAKPGKAASTESKSLF 513


>gi|114797644|ref|YP_761689.1| pilus assembly protein CpaE [Hyphomonas neptunium ATCC 15444]
 gi|114737818|gb|ABI75943.1| pilus assembly protein CpaE [Hyphomonas neptunium ATCC 15444]
          Length = 468

 Score =  287 bits (734), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 153/392 (39%), Positives = 230/392 (58%), Gaps = 3/392 (0%)

Query: 26  LPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQT 85
           LP IS+ +F   +    ++E    D RM +  +    G I  A+     + TP+LI++++
Sbjct: 77  LPAISIKLFYEREETRLLMELCAQDRRMGRATVECLPGGIPSAIHYLRGNPTPNLILIES 136

Query: 86  KVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINS 145
              + +V+S ++ LAE CD   KV+VIG  ND+ LYR L++  VSEYL+ P     II +
Sbjct: 137 GSVAEQVVSEIDALAEHCDEHVKVLVIGAVNDIRLYRQLMARGVSEYLVPPFQPLQIIRA 196

Query: 146 ISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGT 205
           IS +FT  +      G  IS +G++GGVG+STIAHN A+S+A    + T L DLDL +GT
Sbjct: 197 ISNLFT--DPDAPFVGRQISVVGAKGGVGASTIAHNLAWSLAENIKVNTTLVDLDLSFGT 254

Query: 206 ANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIV 265
             ++F+++   +I+DA+    R D A + RL     E LS+ TAPA +++  D  +    
Sbjct: 255 TALDFNQETPQTIADALLAPERADDAVIERLLARATERLSLFTAPAHINQIIDIPDDAYT 314

Query: 266 PVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
            V+  + +  P ++LD+PHVWN W + +L  SD+V++    DLA LRN KNLID LK  R
Sbjct: 315 TVIQGVRRNVPFMVLDLPHVWNHWLRTMLIQSDEVIVVCQPDLASLRNGKNLIDQLKGHR 374

Query: 326 PADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDP 385
             D PP LVLN    PK+PEI + DF A +G+ P  ++PFD  VFG +AN+G+MI E  P
Sbjct: 375 VNDHPPRLVLNMCGVPKRPEIPVKDFAAAIGVEPEIVVPFDPEVFGTAANNGQMISETGP 434

Query: 386 KSAIANLLVDFSRVLMGRVTVSKPQSAMYTKI 417
            S  A  + + +  L GR T+ + + +   K+
Sbjct: 435 ASRPAMAIDELAASLSGR-TLQRVEKSFLKKL 465


>gi|110632965|ref|YP_673173.1| TadE-like [Mesorhizobium sp. BNC1]
 gi|110283949|gb|ABG62008.1| TadE-like protein [Chelativorans sp. BNC1]
          Length = 580

 Score =  280 bits (715), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 138/382 (36%), Positives = 233/382 (60%), Gaps = 2/382 (0%)

Query: 22  SMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLI 81
           ++ ++P+I +  FC +  + + +    +D RM++ N+ +  G + EA S +  + +P+L+
Sbjct: 18  ALHAIPKIDITAFCASPEIAAAIRTGALDRRMARANVTVRDGGMREAASFYRSTPSPNLV 77

Query: 82  IVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVAD 141
           +V+      ++++ LE LA  C +GTK+IVIG +NDV+LYR LI+  V +YL+ P+    
Sbjct: 78  VVECNDGKEKLMADLEALALECIAGTKLIVIGSSNDVNLYRDLIAAGVDDYLLAPVEPMA 137

Query: 142 IINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDL 201
            I ++S  F    E K   G  I+FIG++GG GSST++HN A ++      + L+ADLDL
Sbjct: 138 FIEAVSRCFRDAVEQK--LGRIIAFIGAKGGTGSSTVSHNVAAAMVERSDADVLVADLDL 195

Query: 202 PYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDE 261
            +GT +++FD D    +SD +    R+D+  + R+ V ++E L +L   A   R+++  +
Sbjct: 196 QFGTVSLDFDIDAPQGMSDILESASRVDEVLIKRIAVKHSERLHLLPVNAAFDRSFNLKD 255

Query: 262 KMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL 321
             I  +LD+       ++LD+PH+W  WT++ L  +D++VIT + DLA +RN+KN++  L
Sbjct: 256 GEIDRLLDVARSSSWHLVLDLPHLWTLWTKKALLSADEIVITATPDLASMRNAKNIVSFL 315

Query: 322 KKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIH 381
           KK RP D PP LVLN+V TPK+PEI+  DF + +G+    I+PFD   FG +AN G+M+ 
Sbjct: 316 KKARPNDPPPRLVLNRVGTPKQPEIAPKDFTSAIGLEQCVIVPFDPQTFGKAANEGRMVT 375

Query: 382 EVDPKSAIANLLVDFSRVLMGR 403
           +V   S  A  + + +  + G+
Sbjct: 376 KVARGSKAARAMSELAWRVSGQ 397


>gi|307318080|ref|ZP_07597516.1| response regulator receiver protein [Sinorhizobium meliloti AK83]
 gi|306896121|gb|EFN26871.1| response regulator receiver protein [Sinorhizobium meliloti AK83]
          Length = 578

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 142/397 (35%), Positives = 233/397 (58%), Gaps = 2/397 (0%)

Query: 26  LPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQT 85
           LP++ + VFC ++ +   V  + ID RM++  + +  G + EA + +   ++P+L++V++
Sbjct: 20  LPKVDIAVFCQSEEVREAVGTAAIDRRMARATVTVKAGGMKEATALYGGVTSPNLVVVES 79

Query: 86  KVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINS 145
                 +++ LE LA  C +GTKVIVIG +NDV LY+ L+   VS+YL++PL   D + +
Sbjct: 80  DDGEARLMATLETLAMECVTGTKVIVIGRSNDVGLYKKLLDAGVSDYLVKPLEPMDFVAA 139

Query: 146 ISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGT 205
           +   F    E K   G  ++F+G++GG GSST+AHN A++++     + LLADLDL  GT
Sbjct: 140 VHRCFRDSTEEK--LGRIVAFVGAKGGTGSSTLAHNVAYAMSKRVDADVLLADLDLQSGT 197

Query: 206 ANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIV 265
             +NFD +  + + D +    R+D   + RL V Y + L +L A   L +  +  E  + 
Sbjct: 198 LGLNFDIEAKHGMVDVLQSPDRLDDVLLRRLAVSYTDRLHLLPATTDLDKFINLQEGDVD 257

Query: 266 PVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
            +LD+       V++D+PH+   WT+++L  +D++V+T + DLAG+RN+KNLID LKK R
Sbjct: 258 HLLDVARSSSWHVVVDLPHILTQWTRKILLEADEIVVTATPDLAGMRNAKNLIDFLKKAR 317

Query: 326 PADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDP 385
           P D PP LVLN+V TPK  EI   DF A +G+  S  + F+ ++FG +AN G+++ E  P
Sbjct: 318 PNDPPPRLVLNKVGTPKLQEIKPKDFVAAVGLEESVSLAFEPSLFGAAANHGRLVIESAP 377

Query: 386 KSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFN 422
            S     +V  +  + G       Q  +   ++K+F 
Sbjct: 378 DSKAGKAIVSLAWRVGGTRERRTRQKGVKALLQKVFK 414


>gi|307304373|ref|ZP_07584124.1| response regulator receiver protein [Sinorhizobium meliloti BL225C]
 gi|306902575|gb|EFN33169.1| response regulator receiver protein [Sinorhizobium meliloti BL225C]
          Length = 581

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 140/400 (35%), Positives = 234/400 (58%), Gaps = 2/400 (0%)

Query: 23  MCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLII 82
           +  +P++ + VFC ++ +   V  + ID RM++  + +  G + EA + +   ++P+L++
Sbjct: 20  LLPIPKVDIAVFCQSEEVREAVGTAAIDRRMARATVTVKAGGMKEATALYGGVTSPNLVV 79

Query: 83  VQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADI 142
           V++      +++ LE LA  C +GTKVIVIG +NDV LY+ L+   VS+YL++PL   D 
Sbjct: 80  VESDDGEARLMATLETLAMECVTGTKVIVIGRSNDVGLYKKLLDAGVSDYLVKPLEPMDF 139

Query: 143 INSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLP 202
           + ++   F    E K   G  ++F+G++GG GSST+AHN A++++     + LLADLDL 
Sbjct: 140 VAAVHRCFRDSTEEK--LGRIVAFVGAKGGTGSSTLAHNVAYAMSKRVDADVLLADLDLQ 197

Query: 203 YGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEK 262
            GT  +NFD +  + + D +    R+D   + RL V Y + L +L A   L +  +  E 
Sbjct: 198 SGTLGLNFDIEAKHGMVDVLQSPDRLDDVLLRRLAVSYTDRLHLLPATTDLDKFINLREG 257

Query: 263 MIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK 322
            +  +LD+       V++D+PH+   WT+++L  +D++V+T + DLAG+RN+KNLID LK
Sbjct: 258 DVDHLLDVARSSSWHVVVDLPHILTQWTRKILLEADEIVVTATPDLAGMRNAKNLIDFLK 317

Query: 323 KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHE 382
           K RP D PP LVLN+V TPK  EI   DF A +G+     + F+ ++FG +AN+G+++ E
Sbjct: 318 KARPNDPPPRLVLNKVGTPKLQEIKPKDFVAAVGLEEGVSLAFEPSLFGAAANNGRLVIE 377

Query: 383 VDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFN 422
             P S     +V  +  + G       Q  +   ++K+F 
Sbjct: 378 SAPDSKAGKAIVSLAWRVGGTRERRTRQKGVKALLQKVFK 417


>gi|16263308|ref|NP_436101.1| CpaE2 pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|14523987|gb|AAK65513.1| CpaE2 pilus assembly protein [Sinorhizobium meliloti 1021]
          Length = 586

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 140/400 (35%), Positives = 234/400 (58%), Gaps = 2/400 (0%)

Query: 23  MCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLII 82
           +  +P++ + VFC ++ +   V  + ID RM++  + +  G + EA + +   ++P+L++
Sbjct: 25  LLPIPKVDIAVFCQSEEVREAVGTAAIDRRMARATVTVKAGGMKEATALYGGVTSPNLVV 84

Query: 83  VQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADI 142
           V++      +++ LE LA  C +GTKVIVIG +NDV LY+ L+   VS+YL++PL   D 
Sbjct: 85  VESDDGEARLMATLETLAMECVTGTKVIVIGRSNDVGLYKKLLDAGVSDYLVKPLEPMDF 144

Query: 143 INSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLP 202
           + ++   F    E K   G  ++F+G++GG GSST+AHN A++++     + LLADLDL 
Sbjct: 145 VAAVHRCFRDSTEEK--LGRIVAFVGAKGGTGSSTLAHNVAYAMSKRVDADVLLADLDLQ 202

Query: 203 YGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEK 262
            GT  +NFD +  + + D +    R+D   + RL V Y + L +L A   L +  +  E 
Sbjct: 203 SGTLGLNFDIEAKHGMVDVLQSPDRLDDVLLRRLAVSYTDRLHLLPATTDLDKFINLREG 262

Query: 263 MIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK 322
            +  +LD+       V++D+PH+   WT+++L  +D++V+T + DLAG+RN+KNLID LK
Sbjct: 263 DVDHLLDVARSSSWHVVVDLPHILTQWTRKILLEADEIVVTATPDLAGMRNAKNLIDFLK 322

Query: 323 KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHE 382
           K RP D PP LVLN+V TPK  EI   DF A +G+     + F+ ++FG +AN+G+++ E
Sbjct: 323 KARPNDPPPRLVLNKVGTPKLQEIKPKDFVAAVGLEEGVSLAFEPSLFGAAANNGRLVIE 382

Query: 383 VDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFN 422
             P S     +V  +  + G       Q  +   ++K+F 
Sbjct: 383 SAPDSKAGKAIVSLAWRVGGTRERRTRQKGVKALLQKVFK 422


>gi|13474662|ref|NP_106231.1| pilus assembly protein cpaE [Mesorhizobium loti MAFF303099]
 gi|14025417|dbj|BAB52017.1| pilus assembly protein; CpaE [Mesorhizobium loti MAFF303099]
          Length = 286

 Score =  273 bits (697), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 127/275 (46%), Positives = 195/275 (70%), Gaps = 4/275 (1%)

Query: 139 VADIINSISAIFT-PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLA 197
           +ADI++ +S+IF  P+ E     G SI+F+G++GGVGSSTIAHN A++++S+F  E ++A
Sbjct: 1   MADIVSVVSSIFVDPEAE---PIGRSIAFVGAKGGVGSSTIAHNVAWAMSSLFKSEVVVA 57

Query: 198 DLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTY 257
           DLDL +GTANINFD+DP   I++A++   R+D+ ++ RL    AE+LS+L AP+ L R Y
Sbjct: 58  DLDLAFGTANINFDQDPAQGIAEAVFSPERVDEVYLDRLLTQCAEHLSLLAAPSTLERVY 117

Query: 258 DFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNL 317
           DFD      ++D  ++  PL++LDVPH+W  W +  L  +D++VIT + +LA LRN+KN+
Sbjct: 118 DFDPDAFAQLVDTAQRSVPLLVLDVPHIWTGWAKNTLVKADEIVITATPELANLRNTKNM 177

Query: 318 IDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
           +D+LK+LRP D PP L++NQ   PK+PEIS SDF  PLG+TP ++I FD  +FG +AN+G
Sbjct: 178 VDMLKRLRPNDPPPKLIINQAGVPKRPEISPSDFAEPLGLTPMSVIGFDPLLFGNAANNG 237

Query: 378 KMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSA 412
           +M+ E+D K+ +  ++ + + VL GR  +   + A
Sbjct: 238 RMLGEMDAKNPVVAIINEIAHVLTGRSEIRMKKKA 272


>gi|150377240|ref|YP_001313835.1| response regulator receiver protein [Sinorhizobium medicae WSM419]
 gi|150031787|gb|ABR63902.1| response regulator receiver protein [Sinorhizobium medicae WSM419]
          Length = 587

 Score =  269 bits (688), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 138/397 (34%), Positives = 232/397 (58%), Gaps = 2/397 (0%)

Query: 26  LPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQT 85
           +P++ + VFC ++ +   +  + ID RM++  + +  G I EA + +   ++P+L++V++
Sbjct: 29  IPKVDIAVFCQSEEVREAIGTAAIDRRMARATVAVKAGGIKEAAALYGGVTSPNLVVVES 88

Query: 86  KVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINS 145
                 +++ALE LA  C +GTKVIVIG +NDV LY+ L+   VS+YL+ PL   D + +
Sbjct: 89  DEGEARLMAALETLAMECVTGTKVIVIGRSNDVGLYKKLLDAGVSDYLVTPLEPMDFVAA 148

Query: 146 ISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGT 205
           +   F    E K   G  ++F+G++GG GSST+AHN A++++     + LLADLDL  GT
Sbjct: 149 VHRCFRHSTEEK--LGRIVAFVGAKGGTGSSTLAHNVAYAMSKRVDADVLLADLDLQSGT 206

Query: 206 ANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIV 265
             +NFD +  + + D +    R+D   + RL V Y + L +L A   L +  +  E+ + 
Sbjct: 207 LGLNFDIEAKHGMVDVLQSPDRLDDVLLRRLAVSYTDRLHLLPATTDLDKFINLREEDVD 266

Query: 266 PVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
            +LD+       V++D+P+    WT+++L  +D++VIT + DLAG+RN+++L+D L+K R
Sbjct: 267 HLLDVARSSSWHVVVDLPYALTQWTRKILLEADEIVITATPDLAGMRNARSLVDFLRKAR 326

Query: 326 PADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDP 385
           P D PP LVLN+V TPK  EI   DF A +G+  S    FD ++FG +AN+G+++ E  P
Sbjct: 327 PNDPPPRLVLNKVGTPKLQEIKPKDFLAAVGLEESVSFAFDPSLFGAAANNGRLVIESAP 386

Query: 386 KSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFN 422
            S     +V  +  + G          M   ++++F 
Sbjct: 387 DSKAGKAIVSLAWRVGGTRERRTRVKGMKALLQQVFK 423


>gi|23016181|ref|ZP_00055940.1| COG4963: Flp pilus assembly protein, ATPase CpaE [Magnetospirillum
           magnetotacticum MS-1]
          Length = 396

 Score =  231 bits (588), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 127/385 (32%), Positives = 217/385 (56%), Gaps = 7/385 (1%)

Query: 28  RISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKV 87
           R+++  FC        +  +  D ++++  + +  G +A A++ ++D  TP +++V+ + 
Sbjct: 4   RLTIEAFCCGAETAEALRNACTDRQLAKSRLGLMEGGLAAAITHYADLPTPQVLVVE-ES 62

Query: 88  DSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSIS 147
           D  ++ S L+ LAEVC SGTKV+VIG  ND+ LYR L++  V++YL  P     +++S++
Sbjct: 63  DPTQLRSRLDQLAEVCVSGTKVVVIGPVNDIRLYRELMAKGVADYLPAPAGARQLVDSLA 122

Query: 148 AIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN 207
            +F   +         ++  G+RGG GSST+A N A++ A   A + +L DLD+ +GT+ 
Sbjct: 123 GLFA--DPASAPRARVVACWGARGGTGSSTLAQNLAWAAARHLAEKVILIDLDIAFGTSV 180

Query: 208 INFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDE-KMIVP 266
           + F+ +   SI+D +    R+D+  V R    Y ++L IL AP    R +     + +  
Sbjct: 181 LAFNLEAKQSIADVLANPERLDEVLVDRCMAEYDDHLQILAAPGD-GRGHGVTTLEPLEH 239

Query: 267 VLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRP 326
           ++D+  ++  LV+LD+PHVW  W++ +L  +D+VV+T   D A LR++K L+D+L   R 
Sbjct: 240 LVDLASRMAALVVLDIPHVWAEWSEALLAGADEVVVTAIADFASLRDTKTLVDLLSPRRQ 299

Query: 327 ADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPK 386
              P  LVLN+ +T +K ++S  DF   L +TP  +IP D A+FG +A   +M+ EV   
Sbjct: 300 GMAPLRLVLNRAETGRKAQLSAKDFAETLKMTPDLVIPSDPALFGEAATEARMLGEVAAN 359

Query: 387 SAIANLLVDFSRVLMGR--VTVSKP 409
             I   L   +  L G+  V   KP
Sbjct: 360 HKIVQSLGQLAVTLSGKAPVVARKP 384


>gi|83312842|ref|YP_423106.1| Flp pilus assembly protein, ATPase CpaE [Magnetospirillum
           magneticum AMB-1]
 gi|82947683|dbj|BAE52547.1| Flp pilus assembly protein, ATPase CpaE [Magnetospirillum
           magneticum AMB-1]
          Length = 393

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 116/378 (30%), Positives = 210/378 (55%), Gaps = 3/378 (0%)

Query: 28  RISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKV 87
           R+++  FC +      +  +  + ++++  + +  G +A A+  ++D  TP +++V+ + 
Sbjct: 4   RLTIEAFCTSQETAQALRAAGAERQLAKSRLALLDGGLAAAIGHYADLPTPQVLVVE-ES 62

Query: 88  DSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSIS 147
           D   + S L+ LAEVC +GTKV+VIG  ND+ LYR L++  V++YL  P+    + +S++
Sbjct: 63  DPALLRSRLDQLAEVCVAGTKVVVIGPVNDIRLYRELMAKGVADYLPAPVVPRQLADSLT 122

Query: 148 AIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN 207
            +F   +         ++  G+RGG GSST+A N A++ A   A + +L DLD+ +GT+ 
Sbjct: 123 GLFA--DPASAPRARVVACWGARGGTGSSTMAQNLAWAAARHLAEKVILIDLDIAFGTSI 180

Query: 208 INFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPV 267
           + F+ +   S++DA+    R+D+  + R    Y ++L +L AP           + +  +
Sbjct: 181 LAFNLEAKQSVADALAHPERLDEVLMDRCMAEYDDHLQVLAAPGDGRSRVAMSSEAVEHL 240

Query: 268 LDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPA 327
           +++  ++  LV+LDVPHVW  W++ +L  +D+VVIT   D A LR++K L+++L   R  
Sbjct: 241 VELASRMAALVVLDVPHVWAEWSEGLLAAADEVVITAIPDFASLRDTKALLELLSPRRQG 300

Query: 328 DKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS 387
              P LVLN+ +  +K ++S  DF   L + P+  +P D A+FG +A   +M+ EV    
Sbjct: 301 MAAPRLVLNRAENGRKAQLSSKDFADTLKVVPALTVPADPALFGEAATEARMLAEVSANH 360

Query: 388 AIANLLVDFSRVLMGRVT 405
            I   L   +  L G+  
Sbjct: 361 KIVQSLGQLAATLSGKAA 378


>gi|23011547|ref|ZP_00051875.1| COG4963: Flp pilus assembly protein, ATPase CpaE [Magnetospirillum
           magnetotacticum MS-1]
          Length = 275

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 106/275 (38%), Positives = 165/275 (60%), Gaps = 2/275 (0%)

Query: 14  ENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFS 73
           ++ D     +  +PRI++  FC T    + +E    D RM + ++++  G  A AV  + 
Sbjct: 3   DSHDTQERIIAPVPRITIQAFCETPETAATIEGIAADRRMRKAHVKVQMGGGAAAVEAYR 62

Query: 74  DSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYL 133
            + TP++I+++        L  L+ LAEVCD GTKV+VIG  NDV LYR  I   VSEYL
Sbjct: 63  QAPTPNVILIEFLGLKSRPLECLDQLAEVCDEGTKVLVIGHVNDVMLYRQFIQRGVSEYL 122

Query: 134 IEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAME 193
           + P+   D+I ++S +FT    G      +++  G++GGVGSSTIAHN A+++A      
Sbjct: 123 MAPVDPVDLIAAVSDLFT--APGAKPLVRTVAVYGAKGGVGSSTIAHNLAWTVAREQDTA 180

Query: 194 TLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAML 253
           T++ADLD+ +GTA++NF++DP   I++A++   R+D   + RL    A+NLS+L+APA L
Sbjct: 181 TVIADLDVAFGTASLNFNQDPPQGIAEAVFAPERLDGNLLDRLLSKCADNLSLLSAPATL 240

Query: 254 SRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNS 288
            RT D  E     + D+L    P ++LDVPH W++
Sbjct: 241 DRTVDLTEPAFDALTDLLRAAVPCIVLDVPHQWSA 275


>gi|85707700|ref|ZP_01038766.1| hypothetical protein NAP1_00655 [Erythrobacter sp. NAP1]
 gi|85689234|gb|EAQ29237.1| hypothetical protein NAP1_00655 [Erythrobacter sp. NAP1]
          Length = 427

 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 112/350 (32%), Positives = 186/350 (53%), Gaps = 9/350 (2%)

Query: 59  RITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDV 118
           +  +G +  A+   S S++P ++IV    +S + L+ +  LAEVC+ GT VI IG  NDV
Sbjct: 42  KCNKGGLRNAIQSLSVSASPAILIVDLS-ESGDPLNDINALAEVCEPGTVVIAIGQVNDV 100

Query: 119 SLYRALISNHVSEYLIEPLS---VADIINSISAIFTPQEEGKGSS---GCSISFIGSRGG 172
            LYR L+++ + +YL++PLS   V D +N+  A+FT  + G G +     S + +G+RGG
Sbjct: 101 RLYRDLLASGIHDYLLKPLSAQAVHDALNAALAVFTSPKGGDGEAVKRHISTAVVGTRGG 160

Query: 173 VGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAF 232
           VG+STIA + ++  +      T L DLD+ +GT  +  D +P   ++DAI    RID  F
Sbjct: 161 VGASTIATSLSWLFSEEHGAPTALLDLDVHFGTGALALDLEPGRGLTDAIDNPSRIDGLF 220

Query: 233 VSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQE 292
           + R  +  ++NLSIL+A A +S+    D    V + +   Q F + ++D+P         
Sbjct: 221 IERAMIRASDNLSILSAEAPISQPLMTDGSAFVQLEEEFRQAFEMTVIDLPRNMLINFPH 280

Query: 293 VLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFC 352
           +L   + V++T  L LA  R++  ++  LK    A   P +V N+V+ P   EIS +DF 
Sbjct: 281 LLADVNLVLLTCELTLASARDTIRILSWLKT-NAAHAHPMIVANKVQ-PGVAEISKADFE 338

Query: 353 APLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMG 402
           A +      +IP+D      +A  G++  E +  S     +   +  +MG
Sbjct: 339 ASIERKIDFVIPYDVKAASNAAKLGQVFVEANKNSKATGAVKRIAERVMG 388


>gi|294012435|ref|YP_003545895.1| Flp pilus assembly protein ATPase CpaE [Sphingobium japonicum
           UT26S]
 gi|292675765|dbj|BAI97283.1| Flp pilus assembly protein ATPase CpaE [Sphingobium japonicum
           UT26S]
          Length = 428

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 115/410 (28%), Positives = 196/410 (47%), Gaps = 19/410 (4%)

Query: 28  RISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKV 87
           R   H F   D  + ++    +   M     ++ +G +  AV   S +++P ++ +    
Sbjct: 13  RDPFHAFVCDDHSFDLLR--VVAAEMGWAPEKVNKGGMRNAVQSLSITASPQILFIDMS- 69

Query: 88  DSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSIS 147
           +S + L+ +  LAEVC+ GT VI  G  NDV LYR L+++ + +YL++P     + ++++
Sbjct: 70  ESGDPLNDINSLAEVCEPGTVVIAAGQVNDVRLYRDLLASGIQDYLLKPFGADQLRDALA 129

Query: 148 A----IFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPY 203
                 F P++ G      + + IG+RGGVG+S+IA + A+ ++      T L DLD+ +
Sbjct: 130 QAQAVFFAPRDAGPERPHMTAAVIGTRGGVGASSIATSLAWLLSDKQKRPTALLDLDVHF 189

Query: 204 GTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKM 263
           GT  +  D +P   ++DAI    RID  F+ R  V  ++ L+IL+A A +S+    D   
Sbjct: 190 GTNALAMDLEPGRGLTDAIENPSRIDGLFIERAMVRASDTLAILSAEAPISQPLLTDGGA 249

Query: 264 IVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKK 323
              +L+     F   ++D+P         +++  +  V+ T L LA  R+S  ++  LK 
Sbjct: 250 FYQLLEEFRAAFECSVIDLPRAMLIQHPHLMSDVNVTVVVTELTLAAARDSIRILSWLKT 309

Query: 324 LRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEV 383
             P  +   LV+     P  PEIS  DF   +      +IPFD  V   +A  GK + E 
Sbjct: 310 NAPQSR--VLVVANRVHPGAPEISRKDFEQSIERKVDVLIPFDLKVASQAAKLGKTLAET 367

Query: 384 DPKSAIA---NLLVDF-------SRVLMGRVTVSKPQSAMYTKIKKIFNM 423
              S +    N L+D        +    GR T SK   ++  KI  + +M
Sbjct: 368 AKGSKVGAACNTLMDAVVGAAEDAEADEGRPTASKKGDSLLGKISDLKSM 417


>gi|326388862|ref|ZP_08210444.1| response regulator receiver domain-containing protein
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326206462|gb|EGD57297.1| response regulator receiver domain-containing protein
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 444

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 112/348 (32%), Positives = 190/348 (54%), Gaps = 18/348 (5%)

Query: 38  DTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALE 97
           D L SVV    ID  M     ++ +G +  A+   + +++P +++V    +S + L+ + 
Sbjct: 24  DVLRSVV----ID--MGWQPEKVMKGGLRNAIQSLAITASPAILLVDMS-ESGDPLNDIN 76

Query: 98  PLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSIS---AIFTPQE 154
            LAEVC+ GT VI +G  NDV LYR L+S+ + +YL++PL+   + +S++   AIFT   
Sbjct: 77  ALAEVCEPGTVVIAVGQVNDVRLYRDLLSSGIQDYLLKPLAPGALRDSLAQAQAIFTAPR 136

Query: 155 EGKGS---SGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFD 211
            G+G    S  S + +G+RGGVG+S +A + A+ +++   M T L DLD+ +GT  +  D
Sbjct: 137 NGEGGAAKSHVSTAIVGTRGGVGASMMATSLAWLLSTDNKMPTALLDLDVHFGTDALTLD 196

Query: 212 KDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDIL 271
            +P   ++DAI    RID  F+ R  +   +NLSIL+A A ++     D    V +++  
Sbjct: 197 LEPGRGLTDAIENPSRIDGLFIERAMIRANDNLSILSAEAPINSPLLTDGSAFVQLIEEF 256

Query: 272 EQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPP 331
              F   ++D+P         +L+  + V++ T L LAG R+   L+  LK   P     
Sbjct: 257 RHAFEATVIDLPRNMLINFPHLLSTVNVVLLVTELTLAGARDGIRLLSWLKSNAP-HATV 315

Query: 332 YLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKM 379
           ++V N+V++    EIS +DF + +    + +IPFD      +AN+GK+
Sbjct: 316 FVVANKVQS-GVAEISKADFESSIERKINYVIPFDAKA---AANAGKL 359


>gi|94497256|ref|ZP_01303828.1| response regulator receiver domain protein (CheY-like)
           [Sphingomonas sp. SKA58]
 gi|94423361|gb|EAT08390.1| response regulator receiver domain protein (CheY-like)
           [Sphingomonas sp. SKA58]
          Length = 424

 Score =  155 bits (391), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 108/367 (29%), Positives = 184/367 (50%), Gaps = 9/367 (2%)

Query: 28  RISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKV 87
           R   H F   D  + V+    +   M     ++ +G +  AV   S +++P ++ V    
Sbjct: 12  RDPFHAFVCDDHSFDVLR--AVAAEMGWAPEKVNKGGMRNAVQTLSITASPQILFVDMS- 68

Query: 88  DSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLS---VADIIN 144
           +S + L+ +  LAEVC+ GT VI  G  NDV LYR L+++ + +YL++P     + D + 
Sbjct: 69  ESGDPLNDINSLAEVCEPGTVVIAAGQVNDVRLYRDLVASGIQDYLLKPFGADQLRDALA 128

Query: 145 SISAIF-TPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPY 203
              A+F  P++ G     C+++ IG+RGGVG+S+IA + A+ ++      T L DLD+ +
Sbjct: 129 QAQAVFMAPRDAGPERPHCTMAVIGTRGGVGASSIATSLAWMLSDKKKRATALLDLDVHF 188

Query: 204 GTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKM 263
           GT  +  D +P   ++DAI    RID  F+ R  V  ++ L+IL+A A +S+    D   
Sbjct: 189 GTNALALDLEPGRGLTDAIENPSRIDGLFIERAMVRASDTLAILSAEAPISQPMLTDGGA 248

Query: 264 IVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKK 323
              +L+     F   ++D+P         ++   +  ++ T L LA  R++  ++  LK 
Sbjct: 249 FYQLLEEFHTAFECSVIDLPRGMLIQHPHLMGDVNTALVVTELTLAAARDTIRILSWLKT 308

Query: 324 LRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEV 383
             P  +   +V N+V+T   PEIS  DF   +      +IPFD  V   +A  GK + +V
Sbjct: 309 NAPQAR-AIVVANKVQT-GSPEISRKDFEQSIERKVDILIPFDLRVASQAAKLGKTMADV 366

Query: 384 DPKSAIA 390
              S + 
Sbjct: 367 AKGSKVG 373


>gi|87199099|ref|YP_496356.1| response regulator receiver domain-containing protein
           [Novosphingobium aromaticivorans DSM 12444]
 gi|87134780|gb|ABD25522.1| response regulator receiver domain protein (CheY-like)
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 424

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 110/357 (30%), Positives = 187/357 (52%), Gaps = 9/357 (2%)

Query: 62  RGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLY 121
           RG +  A+   S +++P++++V    +S + L+ +  LAEVC+ GT VI +G  NDV LY
Sbjct: 40  RGGLRNAIQSLSITASPNILMVDLS-ESGDPLNDINALAEVCEPGTVVIAVGQVNDVRLY 98

Query: 122 RALISNHVSEYLIEPLS---VADIINSISAIFT-PQEEGKGSSGCSIS--FIGSRGGVGS 175
           R LI++ + +YL++PL+   + D +    AIFT P+     ++   IS   +G+RGGVG+
Sbjct: 99  RDLIASGIQDYLLKPLNPGQLRDALVQAQAIFTAPKSHDPATAKRHISTAIVGTRGGVGA 158

Query: 176 STIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSR 235
           ST+A + A+  ++   + T L DLD+ +GT  +  D +P   ++DAI    RID  F+ R
Sbjct: 159 STLATSLAWLFSTDHRLPTALLDLDVHFGTGALTLDLEPGRGLTDAIDNPSRIDGLFIER 218

Query: 236 LPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLT 295
             +   +NL+IL+A A +S     D    + + +   Q F + ++D+P         +L 
Sbjct: 219 AMIRANDNLAILSAEAPISSPLMTDGSAFLQLEEEFRQAFEMTVIDMPRNMLINFPHLLA 278

Query: 296 LSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPL 355
             + V++ T L LAG R++  L+  LK    A   P +V N+++     EIS +DF A +
Sbjct: 279 DVNVVIVATELTLAGARDAIRLLSWLKT-NAAHARPLIVANKIQAGAN-EISKADFEASI 336

Query: 356 GITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSA 412
               + +IP+D      +A  G+     +  S    +L D    ++G V      SA
Sbjct: 337 ERKINYMIPYDIKGASNAAKLGQTFVAANRSSKAGTVLRDIGEAIIGSVGEDGSTSA 393


>gi|307293452|ref|ZP_07573298.1| Flp pilus assembly protein ATPase CpaE [Sphingobium
           chlorophenolicum L-1]
 gi|306881518|gb|EFN12734.1| Flp pilus assembly protein ATPase CpaE [Sphingobium
           chlorophenolicum L-1]
          Length = 428

 Score =  150 bits (379), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 104/367 (28%), Positives = 180/367 (49%), Gaps = 9/367 (2%)

Query: 28  RISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKV 87
           R   H F   D  + ++    +   +     ++++G +  AV   S +++P ++ +    
Sbjct: 13  RDPFHAFVCDDHSFDLLR--VVAAEIGWAPEKVSKGGMRNAVQSLSITASPQILFIDMS- 69

Query: 88  DSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSIS 147
           +S + L  +  LAEVC+ GT VI  G  NDV LYR L+++ + +YL++P     + ++++
Sbjct: 70  ESGDPLGDINSLAEVCEPGTVVIAAGQVNDVRLYRDLLASGIQDYLLKPFGADQLRDALA 129

Query: 148 A----IFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPY 203
                 F P++ G      + + IG+RGGVG+S+IA + A+ ++      T L DLD+ +
Sbjct: 130 QAQAVFFAPRDAGPEHPHMTAAIIGTRGGVGASSIATSLAWLLSDKKRRPTALLDLDVHF 189

Query: 204 GTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKM 263
           GT  +  D +P   ++DAI    RID  F+ R  V  ++NL+IL+A A +S+    D   
Sbjct: 190 GTNALAMDLEPGRGLTDAIENPSRIDGLFIERAMVRASDNLAILSAEAPISQPMLTDGGA 249

Query: 264 IVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKK 323
              +L+     F   ++D+P         +++  +  V+ T L LA  R+S  ++  LK 
Sbjct: 250 FYQLLEEFHAAFECSVIDLPRGMLIQHPHLMSDVNVAVVVTELTLAAARDSIRILSWLKT 309

Query: 324 LRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEV 383
             P  +   LV+     P  PEIS  DF   +      +IPFD  V   +A  GK + E 
Sbjct: 310 NAPQSR--VLVVANRVHPGSPEISRKDFEQSIERKVDILIPFDLKVASQAAKLGKTLAEA 367

Query: 384 DPKSAIA 390
              S + 
Sbjct: 368 AKGSKVG 374


>gi|85373129|ref|YP_457191.1| hypothetical protein ELI_01510 [Erythrobacter litoralis HTCC2594]
 gi|84786212|gb|ABC62394.1| hypothetical protein ELI_01510 [Erythrobacter litoralis HTCC2594]
          Length = 419

 Score =  147 bits (371), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 101/357 (28%), Positives = 184/357 (51%), Gaps = 9/357 (2%)

Query: 52  RMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIV 111
            M     +  +G +  AV   S S++P++++V    +S + L+ +  LAEVC+ GT V+ 
Sbjct: 27  EMGWAPEKCNKGGLRNAVQSLSVSASPNILMVDLS-ESGDPLNDINALAEVCEPGTVVVA 85

Query: 112 IGDTNDVSLYRALISNHVSEYLIEPLSVA---DIINSISAIFTPQEEGKGSS---GCSIS 165
           IG  NDV LYR L+++ + +YL++PLS     D +N   A+F   + G G +     S +
Sbjct: 86  IGQVNDVRLYRDLLASGIHDYLLKPLSAGQLRDSLNQAQAVFAAPKAGDGETVKRHISTA 145

Query: 166 FIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPV 225
            +G+RGGVG+S ++ + A+  +    M T L DLD+ +GT  +  D +P   ++DAI   
Sbjct: 146 VVGTRGGVGASMLSTSLAWLFSDEHKMPTALLDLDVHFGTGALALDLEPGRGLTDAIDNP 205

Query: 226 GRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHV 285
            RID  F+ R  +   +NL+IL+A A ++     D    V + +   Q F + ++D+P  
Sbjct: 206 SRIDGLFIERAMIRANDNLAILSAEAPINAPLMTDGSAFVQLEEEFRQAFEMTVIDLPRN 265

Query: 286 WNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPE 345
                  +L   + V + T + LA  R++  ++  LK    A   P ++ N+V++    E
Sbjct: 266 MLINFPHLLADVNVVALATEMTLASARDTIRILSWLKT-NAAHAVPIVIANKVQS-GVAE 323

Query: 346 ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMG 402
           IS +DF A +  +    +P+D      +A  G++  + +P +    ++   +  ++G
Sbjct: 324 ISKADFEASIERSIDFTVPYDVKSAANAAKLGQVFVDANPGAKSTQVVRQLAERIIG 380


>gi|332188350|ref|ZP_08390075.1| hypothetical protein SUS17_3501 [Sphingomonas sp. S17]
 gi|332011579|gb|EGI53659.1| hypothetical protein SUS17_3501 [Sphingomonas sp. S17]
          Length = 420

 Score =  145 bits (366), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 107/356 (30%), Positives = 177/356 (49%), Gaps = 14/356 (3%)

Query: 59  RITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDV 118
           R+ +G +  A+   S +++P +++V    D+ + +  +  LAEVC+ GT VI +G  NDV
Sbjct: 42  RVVKGGLRGAIQSLSVAASPQILLVDLS-DTSDPIGEISNLAEVCEPGTIVIAVGQVNDV 100

Query: 119 SLYRALISNHVSEYLIEPLS---VADIINSISAIF---TPQEEGKGSSGCSISFIGSRGG 172
            LYR L+++ + +YL++P++   + + I    A+     P E     + CS++ IG+RGG
Sbjct: 101 RLYRGLLASGLHDYLLKPINPEQLRETIGQARAVLHTPRPMEMAPEKAPCSVAVIGARGG 160

Query: 173 VGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAF 232
           VG+ST+A +  + +A      T L DLD+ +GTA +  D +P   + DAI    RID  F
Sbjct: 161 VGASTVATSLGWLMAERLDRTTGLLDLDVHFGTAALALDLEPGRGLVDAIDNPSRIDGLF 220

Query: 233 VSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQE 292
           + R  V   E LS+L+A A +      D      + + +   F   I+D+P         
Sbjct: 221 LERAMVKALEKLSVLSAEAPIGAPILTDGVAFTQLQEEMRANFETSIVDLPRDMLIQQPV 280

Query: 293 VLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFC 352
           + T +  +V+ T   LA  R++  L+  LK   P      +V N+V    + EI+  DF 
Sbjct: 281 LATSAQTIVLVTEFTLAAARDTIRLLSWLKTYAP-QASVLIVANRVHPAAQAEIAQGDFE 339

Query: 353 APLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS-AIANLLVDFSRVLMGRVTVS 407
             +      +IP+D  +   +A  GK I E+   S  IA L+      L GR+  S
Sbjct: 340 GSIERPVDFLIPYDQKLVVQAAKVGKPIAELGKTSRTIAPLI-----ALAGRICAS 390


>gi|149186257|ref|ZP_01864571.1| hypothetical protein ED21_31009 [Erythrobacter sp. SD-21]
 gi|148830288|gb|EDL48725.1| hypothetical protein ED21_31009 [Erythrobacter sp. SD-21]
          Length = 422

 Score =  143 bits (361), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 108/372 (29%), Positives = 188/372 (50%), Gaps = 9/372 (2%)

Query: 59  RITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDV 118
           +  +G +  AV   S S++P++++V    +S + L+ +  LAEVC+ GT VI IG  NDV
Sbjct: 43  KCNKGGLRNAVQSLSVSASPNILMVDLS-ESGDPLNDINALAEVCEPGTVVIAIGQVNDV 101

Query: 119 SLYRALISNHVSEYLIEPLSVA---DIINSISAIFTP---QEEGKGSSGCSISFIGSRGG 172
            LYR L+++ + +YL++PLS +   D +N+  A+F+     E        S + IG+RGG
Sbjct: 102 RLYRDLLASGIHDYLLKPLSASVLRDSLNAAQAVFSAPRGSESDTVKRHISTAIIGTRGG 161

Query: 173 VGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAF 232
           VG+ST+A + A+  ++  AM T L DLD+ +GT  +  D +P   ++DAI    RID  F
Sbjct: 162 VGASTLATSLAWHYSADKAMPTALLDLDVHFGTGALTLDLEPGRGLTDAIDNPSRIDGLF 221

Query: 233 VSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQE 292
           + R  +   +NL+IL+A A ++     D    + + +     F + I+D+P         
Sbjct: 222 IERAMIRANDNLAILSAEAPINSPLMTDGAAFLQLQEEFRHAFEMTIVDLPRNMLINFPH 281

Query: 293 VLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFC 352
           VL   +   +   + LA  R++  ++  LK        P +V N+V+     EIS +DF 
Sbjct: 282 VLNDVNVATVVCEMTLASARDTIRVLSWLKA-NAGHVTPLVVANKVQA-GAAEISKADFE 339

Query: 353 APLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSA 412
           A +       +PFD      +A  GK   +    S +++ +   +  ++G       ++A
Sbjct: 340 ASIERKIDVTLPFDQKGATAAAKLGKTFIDASSSSKVSSGIKQVASRIIGLGDEDSDEAA 399

Query: 413 MYTKIKKIFNMK 424
                K +F++K
Sbjct: 400 EAAGKKSLFDLK 411


>gi|288956971|ref|YP_003447312.1| two-component response regulator [Azospirillum sp. B510]
 gi|288909279|dbj|BAI70768.1| two-component response regulator [Azospirillum sp. B510]
          Length = 402

 Score =  141 bits (356), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 105/357 (29%), Positives = 181/357 (50%), Gaps = 19/357 (5%)

Query: 60  ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS 119
           I RGS+ +A+S    ++ P ++IV     SR  L+ ++ LA  C+ G  VIVIG  ND+ 
Sbjct: 48  IRRGSVRDAISYLGTAAPPRVLIVDVS-SSRLPLADIDELANACEPGVIVIVIGQQNDIG 106

Query: 120 LYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEG--KGSSGCSISFIGSRGGVGSST 177
           L+R L+   +S+YL++P++   +  SIS     Q  G  +  +G  I+  G+RGGVG+ST
Sbjct: 107 LFRDLMHLGISDYLVKPVTTELLRRSISVALGGQSGGAVRQRTGKIIAVTGARGGVGTST 166

Query: 178 IAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLP 237
           +  N  + +A+    +  L DLDL  G+ ++         + +A+    RID  F+ R  
Sbjct: 167 VMTNVGWLLANKIGRKVALVDLDLQCGSISLMLGLKKQAGMMEALKNAHRIDNVFLDRTL 226

Query: 238 VFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLS 297
           V + E LS+L+A   L     ++ + +  V+  LEQ F  V+ DVP   +   Q +L+ +
Sbjct: 227 VHHGERLSVLSAEEPLGDDTRYEPQSLDKVIRDLEQRFHYVMFDVPRRPDPIYQHLLSQA 286

Query: 298 DKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPP-----YLVLNQVKTPKKPEISISDFC 352
              V+  +  +A +R      DV++ ++ A +        LVL+    P + +IS  DF 
Sbjct: 287 QIRVVVANPTVASVR------DVMRIMKMAGRDDIGQRLVLVLSHTVPPSQADISRRDFE 340

Query: 353 APLGITPSAIIPF-DGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSK 408
             +G      IPF   A+F  + N+GK++ +   +    + L+  +  LMG+  V +
Sbjct: 341 KAVGRRADHEIPFTRHAMF--ADNAGKLLAQ--RRCPATDQLMRITDDLMGKRVVQR 393


>gi|296284554|ref|ZP_06862552.1| hypothetical protein CbatJ_13046 [Citromicrobium bathyomarinum
           JL354]
          Length = 427

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 105/370 (28%), Positives = 185/370 (50%), Gaps = 16/370 (4%)

Query: 38  DTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALE 97
           DTL  VV      P       +  +G +  A+   + +++P++++V    +  + L+ + 
Sbjct: 19  DTLRPVVAELGWAPE------KCAKGGLRNAIQSLAVAASPNILVVDLS-ECSDPLTDIN 71

Query: 98  PLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLS---VADIINSISAIFTPQE 154
            LAEVC+ GT VI +G  NDV LYR LI++ + +YL++PL+   V D +N   A+F+  +
Sbjct: 72  ALAEVCEPGTVVIAVGQVNDVRLYRDLIASGIHDYLLKPLASGQVRDALNEAQAVFSAPK 131

Query: 155 EGKGSSG---CSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFD 211
                +     S + +G+RGG G+STIA + A+  +    + T + DLD+ +GT  +  D
Sbjct: 132 AVDAQAARRHISTAVVGTRGGSGASTIATSLAWLFSDEHKLPTAMLDLDVHFGTGALTLD 191

Query: 212 KDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDIL 271
            +P   ++DAI   GRID  F+ R  +   +NLS+L+A A ++     D    V + +  
Sbjct: 192 LEPGRGLTDAIDNPGRIDGLFIERAMIRANDNLSVLSAEAPINSPLMTDGAGFVQLEEEF 251

Query: 272 EQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPP 331
            Q F + ++D+P        ++L   + V +     LA  R++  ++  LK   P  + P
Sbjct: 252 RQAFEMTVIDMPRNMLINFPQLLADVNVVALVCEFTLASARDTIRILSWLKTHAPHAQ-P 310

Query: 332 YLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAI-A 390
            L+ N+V+     EI+  D+ A +      +IP+D      +A  G+   E +  S + A
Sbjct: 311 LLLANRVQN-GLSEITRGDYEASVERKVDFVIPYDPKAATTAAKLGQAFVEANKSSKVTA 369

Query: 391 NLLVDFSRVL 400
            L     R+L
Sbjct: 370 QLRTVADRIL 379


>gi|148557759|ref|YP_001265341.1| response regulator receiver protein [Sphingomonas wittichii RW1]
 gi|148502949|gb|ABQ71203.1| response regulator receiver protein [Sphingomonas wittichii RW1]
          Length = 422

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 98/348 (28%), Positives = 166/348 (47%), Gaps = 9/348 (2%)

Query: 60  ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS 119
           + +G +  A+   S S++P ++ V    +S + L  +  LAEVC+ GT VI  G  NDV 
Sbjct: 43  VNKGGLRAAIQSLSVSASPTILFVDLS-ESTDPLGDVNALAEVCEPGTIVISAGTANDVR 101

Query: 120 LYRALISNHVSEYLIEPLSVADIINSISA----IFTPQEEGKGSSGCSI--SFIGSRGGV 173
           LYR L+++ + +YL++P +   I ++++     +  P+   +      I  + +G+RGGV
Sbjct: 102 LYRELLNSGIQDYLLKPFTADQIRDALAQAQMMLMGPRHGVQAEDSIHIMTAVVGARGGV 161

Query: 174 GSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFV 233
           G+ST+A + A+ +       T L DLD+ +GT  ++ D +P   ++DAI    RID  F+
Sbjct: 162 GASTVASSIAWLMGESGGHTTALLDLDVHFGTGALSLDLEPGRGLTDAIDNPARIDGLFL 221

Query: 234 SRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEV 293
            R  V   E LS+L+A A ++     D      + + ++  F   I+DVP         +
Sbjct: 222 ERALVKANEKLSVLSAEAPINHPIITDGGAYFQLQEEMKGAFECTIVDVPRTMMVQHPHL 281

Query: 294 LTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCA 353
                 VV+   L LA  R++  ++  LK   P  +   LV+     P   EIS  DF  
Sbjct: 282 FHEVQSVVLVVDLTLAATRDTIRILAWLKNNAP--QAGVLVVANRVHPSLTEISRKDFEN 339

Query: 354 PLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLM 401
            +      ++P+D      +A  GK I E    S +   L   +  L+
Sbjct: 340 SIEREIDFVLPYDHKQAVNAAKLGKPIAEAGKSSKLGQGLAQIADKLL 387


>gi|217978828|ref|YP_002362975.1| response regulator receiver protein [Methylocella silvestris BL2]
 gi|217504204|gb|ACK51613.1| response regulator receiver protein [Methylocella silvestris BL2]
          Length = 389

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 104/362 (28%), Positives = 174/362 (48%), Gaps = 15/362 (4%)

Query: 63  GSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYR 122
           G+I  A +  +  ++P L+IV     +  V S ++ LAE C+    VIVIGD ND+ LYR
Sbjct: 41  GNIETAAAALATQTSPKLLIVDVSGVADPV-SRIDELAERCEPDVGVIVIGDRNDIILYR 99

Query: 123 ALISNHVSEYLIEPLSVADII-NSISAIFTPQEEGKGSSGCSISFI-GSRGGVGSSTIAH 180
            L +  V EY  +PL V D++  + + + T   +        + F+ G RGGVG++TIA 
Sbjct: 100 NLKNAGVVEYFFKPL-VRDVVKRTCNNVLTGNNKQSTPRAAKLIFVVGLRGGVGATTIAT 158

Query: 181 NCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFY 240
           N A+ +A V     +LADLDL  G A +  D  P +++ +A     R+DK F+ R  +  
Sbjct: 159 NAAWYLAEVRQRWVMLADLDLYSGDAALQLDVSPSHALREAFAKPERVDKLFIERGRIHA 218

Query: 241 AENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKV 300
           AE L +L +   L   +  DE  ++ +L  L+Q +  V +D+P         VL      
Sbjct: 219 AERLDLLASLESLGEPFTIDESAVLSLLGKLQQRYRFVFVDLPVRAAIGIIRVLHQPSTC 278

Query: 301 VITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPS 360
           ++ ++  LA  R        +    P  +  + +LN    P    +  ++F    G +P 
Sbjct: 279 LLVSNGSLASAREVARWRARIGANTPERRTLH-ILNMSGAPGS--LPKAEFLRAAGQSPD 335

Query: 361 AIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKI 420
            IIP+D  +  +++N G  I      +++   +V   R LMG     +P+ A  + + +I
Sbjct: 336 IIIPYDREI-AVASNRG--ITATQKCASLNQGIVRLLRDLMG-----EPEEAPRSMLSRI 387

Query: 421 FN 422
           F 
Sbjct: 388 FG 389


>gi|197106460|ref|YP_002131837.1| pilus assembly protein CpaE [Phenylobacterium zucineum HLK1]
 gi|196479880|gb|ACG79408.1| pilus assembly protein CpaE [Phenylobacterium zucineum HLK1]
          Length = 411

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 90/317 (28%), Positives = 159/317 (50%), Gaps = 15/317 (4%)

Query: 59  RITRGSIAEAVSCFSDSS--TPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTN 116
           RI  G ++ A +     +   P +++V    D+ +VL+ ++ LAEVC+  T V+ +G  N
Sbjct: 46  RIREGGLSAACALLQTQAQAAPGVLLVDVS-DAADVLAGMDALAEVCEPHTSVVAVGTAN 104

Query: 117 DVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKG------SSGC-SISFIGS 169
           DV LYRALI   +S+YL++P+S   +     A+   +  G+          C +++ +G+
Sbjct: 105 DVDLYRALIGLGISDYLVKPVSPVALAE---ALRKAERAGRAPVTAAPQQACRTVALVGA 161

Query: 170 RGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRID 229
           RGGVG++++A    +S+A      T+L DLDL +G A ++ D +P   + + +    RID
Sbjct: 162 RGGVGATSLAVALGWSLAHEHERRTVLIDLDLQFGAAALSLDLEPGRGLRELLAHPDRID 221

Query: 230 KAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSW 289
              +       +  L +L A   L          +  +L  + +    VILD P   ++ 
Sbjct: 222 SLLIGSAASQESPRLRVLAAEEPLDAEPALSGAGLEALLSAVTEGSDAVILDAPRRLDAP 281

Query: 290 TQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISIS 349
            +  L  +D  ++ T L LAGLR+S+ L+ +L  +R A+    +V N+V      E+  +
Sbjct: 282 ARAALAAADVAIVVTDLSLAGLRDSQRLLALLGGMR-AEGEILVVANRVGGVAG-EVPQA 339

Query: 350 DFCAPLGITPSAIIPFD 366
           +F   LG     ++PFD
Sbjct: 340 EFERGLGRKLDLVLPFD 356


>gi|148253054|ref|YP_001237639.1| putative response regulator receiver [Bradyrhizobium sp. BTAi1]
 gi|146405227|gb|ABQ33733.1| putative Response regulator receiver [Bradyrhizobium sp. BTAi1]
          Length = 400

 Score =  117 bits (294), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 96/343 (27%), Positives = 157/343 (45%), Gaps = 15/343 (4%)

Query: 62  RGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLY 121
           +G++  A +  +   +P L+ V        V+   E LA+ C+    V+VIGD ND+ LY
Sbjct: 50  KGTVETATAYLATQPSPRLLFVDLSGVDDPVVHIYE-LADRCEPSVSVVVIGDRNDIILY 108

Query: 122 RALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGS--SGCSISFIGSRGGVGSSTIA 179
           R L +  VSEY  +PL +  +  + + I     E   S  +G  +  IG RGGVG++TIA
Sbjct: 109 RDLKNAGVSEYFFKPLIIDAVKATCNRILNDGREHSPSQRTGKLVFVIGVRGGVGATTIA 168

Query: 180 HNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVF 239
            N A+ +A       +L DLDL  G A + FD  P +++S+A     R+D+ F+ R  + 
Sbjct: 169 ANAAWYLAEKKQRWVMLVDLDLHNGDAALQFDSTPGHALSEAFEKPERVDRLFLERGTIH 228

Query: 240 YAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDK 299
             E L +L +   LS +    E  ++ +L  L   +  V +D+P +      +VL     
Sbjct: 229 VRERLDLLASLEPLSESTTLAEGAVLSLLGKLLHRYRFVFVDLPSIVALGLAQVLHQPSV 288

Query: 300 VVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITP 359
            V+ +   LA  R      + +     A++    VLN         +  ++F   +G  P
Sbjct: 289 CVLVSDASLASARELSRWREWIGP-NSAERRTLHVLNM--NGADGALPQAEFIRAVGQAP 345

Query: 360 SAIIPFD-----GAVFGMSANSGKMIHEVDPKSAIANLLVDFS 397
             IIP+D      + FG+ A     +        +A LL DF+
Sbjct: 346 DIIIPYDRDIAIASKFGVKATRKCAVL----NRGLARLLRDFT 384


>gi|170703889|ref|ZP_02894572.1| response regulator receiver protein [Burkholderia ambifaria
           IOP40-10]
 gi|170131204|gb|EDS99848.1| response regulator receiver protein [Burkholderia ambifaria
           IOP40-10]
          Length = 407

 Score =  114 bits (284), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 99/375 (26%), Positives = 174/375 (46%), Gaps = 14/375 (3%)

Query: 52  RMSQVNMRITR-----GSIAEAVSCFSD-SSTPDLIIVQTKVDSREVLSALEPLAEVCDS 105
           R++Q ++ ITR     G+  +A+        +P  +IV    DS   +S L  LAE+CD 
Sbjct: 38  RVAQ-DLSITRAHVQPGNCDDAIRLLQQHERSPRQLIVDVS-DSVLPVSDLMRLAEMCDP 95

Query: 106 GTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSIS 165
             +V+ IG  NDV L+R L+   V +Y+++PL+V  +  +++A    +      +G  +S
Sbjct: 96  SVRVVAIGTQNDVGLFRNLLGIGVQDYIVKPLTVELMRRALTAT---ESVVHARTGKIVS 152

Query: 166 FIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPV 225
           F+G+RGGVG++T+A + A  +A         ADL+L  G AN  F     N + + +   
Sbjct: 153 FVGARGGVGATTVAVSLARCLAGEKRRRVAYADLNLHGGGANSMFGLSSNNGLIELLNME 212

Query: 226 GRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHV 285
            R D A   R+ V   + L +L+A           +  I  ++D+L   F  V+ DV + 
Sbjct: 213 QRPDDALFDRMFVTKGDRLHVLSAELAYGEDAPLRDDAIAQLVDMLRDRFHYVLFDVGNR 272

Query: 286 WNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPE 345
                ++ L  SD V I     +     +  L   +K+L P ++   +VLN    P K  
Sbjct: 273 AGKLFEDALAASDLVYIVADRSVHAAYEAARLARFVKEL-PGERLLSMVLNNPLEPVKGR 331

Query: 346 ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGR-V 404
           ++ +DF    G      +P +     ++ N G+ I E   +    + +   +  + G  +
Sbjct: 332 VAQTDFEDAFGGVKLRELPHEPQPLAVAENLGEPI-EGGKRHGFLDEIRRLANGITGESM 390

Query: 405 TVSKPQSAMYTKIKK 419
            V++P  A + K +K
Sbjct: 391 AVAEPWYARFVKWRK 405


>gi|103486615|ref|YP_616176.1| response regulator receiver protein [Sphingopyxis alaskensis
           RB2256]
 gi|98976692|gb|ABF52843.1| response regulator receiver protein [Sphingopyxis alaskensis
           RB2256]
          Length = 422

 Score =  113 bits (282), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 106/391 (27%), Positives = 193/391 (49%), Gaps = 14/391 (3%)

Query: 35  CVTDTLYSV-VERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVL 93
           C  DTL  + V  S +   M + N    +G +  AV   S S++P+++ V    +S + +
Sbjct: 19  CDDDTLELIRVAASDMGWPMEKCN----KGGLRNAVQSLSVSASPNILFVDMS-ESGDPI 73

Query: 94  SALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSIS---AIF 150
           + +  LAEVC+ GT VI  G  NDV LYR L+S+ + +YL++PLS+  +  S++   A+ 
Sbjct: 74  NDINALAEVCEPGTVVIAAGQINDVRLYRDLLSSGIQDYLLKPLSLDQVRESLTMAQAML 133

Query: 151 TPQEEGK---GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN 207
           +  +            ++ +G RGGVG+S +A + A++I+     +T L DLD+ +GT  
Sbjct: 134 SAPKHADMHDDKPHHMMAVVGVRGGVGASMVATSLAWAISEQADRQTALLDLDVHFGTGA 193

Query: 208 INFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPV 267
           +  D +P   + DAI    RID  F+ R  V  ++ LS+L+A A + +    D      +
Sbjct: 194 LTLDLEPGRGLIDAIDNPSRIDGLFIERAMVRASDKLSLLSAEAPIHQPVMTDGSAFFQL 253

Query: 268 LDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPA 327
            + L   F + I+D+P         +++ +  +++ + + LA  R++  L+   K+  P 
Sbjct: 254 EEELRNAFEMTIVDIPRQVLIPFPHLVSEAGTILLVSDVTLAAARDTIRLLSWFKQNVPG 313

Query: 328 DKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS 387
            +   LV N+ ++    E+S  +F + +      +IPFD  +   +A  GK   E    +
Sbjct: 314 ARV-LLVANKFQSAIG-ELSRKEFESSIERAIDIVIPFDPKLVAQAAKLGKSYAETCKGT 371

Query: 388 AIANLLVDFSRVLMGRVTVSKPQSAMYTKIK 418
             A +  +  R+++    V    +A   K K
Sbjct: 372 KAAQVWTNLMRLILDGADVESEVAAASAKSK 402


>gi|171320620|ref|ZP_02909640.1| response regulator receiver protein [Burkholderia ambifaria MEX-5]
 gi|171094133|gb|EDT39220.1| response regulator receiver protein [Burkholderia ambifaria MEX-5]
          Length = 407

 Score =  112 bits (281), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 102/379 (26%), Positives = 176/379 (46%), Gaps = 22/379 (5%)

Query: 52  RMSQVNMRITR-----GSIAEAVSCFSD-SSTPDLIIVQTKVDSREVLSALEPLAEVCDS 105
           R++Q ++ ITR     G+  +A+        +P  +IV    DS   +S L  LAE+CD 
Sbjct: 38  RVAQ-DLSITRAHVQPGNCDDAIRLLQQHERSPRQLIVDVS-DSVLPVSDLMRLAEMCDP 95

Query: 106 GTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSIS 165
             +V+ IG  NDV L+R L+   V +Y+++PL+V  +  +++A  +        +G  +S
Sbjct: 96  SVRVVAIGTQNDVGLFRNLLGIGVQDYIVKPLTVELMRRALTATESIVH---ARTGKIVS 152

Query: 166 FIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPV 225
           F+G+RGGVG++T+A + A  +A         ADL+L  G AN        N + + +   
Sbjct: 153 FVGARGGVGATTVAVSLARCLAGEKRRRVAYADLNLHGGGANSMLGLSSNNGLIELLNME 212

Query: 226 GRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHV 285
            R D A   R+ V   + L +L+A           +  IV ++D+L+  F  V+ DV + 
Sbjct: 213 QRPDDALFDRMFVTKGDRLHVLSAELAYGEDAPLRDDAIVQLVDMLKDRFHYVLFDVGNR 272

Query: 286 WNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPE 345
                ++ L  SD V I     +     +  L   +K+L P ++   +VLN    P K  
Sbjct: 273 AGKLFEDALAASDLVYIVADRSVHAAYEAARLARFVKEL-PGERLLSMVLNNPLEPVKGR 331

Query: 346 ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVT 405
           ++ +DF    G      +P +     ++ N G+ I     + A  +  +D  R L   +T
Sbjct: 332 VAQTDFEDAFGGVKLRELPHEPQPLAVAENLGEPI-----EGAKRHGFLDEIRRLANGIT 386

Query: 406 -----VSKPQSAMYTKIKK 419
                V++P  A + K +K
Sbjct: 387 GESMAVAEPWYARFVKWRK 405


>gi|115358173|ref|YP_775311.1| response regulator receiver protein [Burkholderia ambifaria AMMD]
 gi|115283461|gb|ABI88977.1| response regulator receiver protein [Burkholderia ambifaria AMMD]
          Length = 407

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 99/376 (26%), Positives = 174/376 (46%), Gaps = 16/376 (4%)

Query: 52  RMSQVNMRITRGSIAEAVSC-------FSDSSTPDLIIVQTKVDSREVLSALEPLAEVCD 104
           R++Q ++ ITR  + +A +C            +P  +IV    DS   +S L  LAE+CD
Sbjct: 38  RVAQ-DLSITRAHV-QAGNCDDAIRLLQQHERSPRQLIVDVS-DSVLPVSDLMRLAEMCD 94

Query: 105 SGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSI 164
              +VI IG  NDV L+R L+   V +Y+++PL+V  +  +++A  +  +     +G  +
Sbjct: 95  PSVRVIAIGTQNDVGLFRNLLGIGVQDYIVKPLTVELMRRALTATESIVQ---ARTGKIV 151

Query: 165 SFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYP 224
           SF+G+RGGVG++T+A + A  +A         ADL+L  G AN        N + + +  
Sbjct: 152 SFVGARGGVGATTVAVSLARCLAGEKRRRVAYADLNLHGGGANSMLGLSSNNGLIELLNM 211

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH 284
             R D A   R+ V   + L +L+A           +  I  ++D+L   F  V+ DV +
Sbjct: 212 EQRPDDALFDRMFVTKGDRLHVLSAELAYGEDAPLRDDAIAQLVDMLRDRFHYVLFDVGN 271

Query: 285 VWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKP 344
                 ++ L  SD V I     +     +  L   +K+L P ++   +VLN    P K 
Sbjct: 272 RAGKLFEDALAASDLVYIVADRSVHAAYEAARLARFVKEL-PGERLLSMVLNNPLEPVKG 330

Query: 345 EISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGR- 403
            ++ +DF    G      +P +     ++ N G+ I E   +    + +   +  + G  
Sbjct: 331 RVAQTDFEDAFGGVKLRELPHEPQPLAVAENLGEPI-EGGKRHGFLDEIRRLANGITGES 389

Query: 404 VTVSKPQSAMYTKIKK 419
           + V++P  A + K +K
Sbjct: 390 MAVAEPWYARFVKWRK 405


>gi|167836687|ref|ZP_02463570.1| CpaE, putative [Burkholderia thailandensis MSMB43]
          Length = 404

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 93/365 (25%), Positives = 166/365 (45%), Gaps = 8/365 (2%)

Query: 57  NMRITRGSIAEAVSCFSDS-STPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDT 115
           + R+ RGSI +A+     +  +P  +IV     S  V S L  LAE C+    VIVIGD 
Sbjct: 44  HARVVRGSIDDAIEMMKHTEQSPQHLIVDVSGSSMPV-SDLARLAEACEPSVTVIVIGDR 102

Query: 116 NDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGS 175
           NDV L+R+L+   V +YL++PL+ A+++    A+          +G +ISF G+RGGVG 
Sbjct: 103 NDVGLFRSLLEIGVRDYLVKPLT-AELVR--RALHASDPHAAMRTGKAISFTGARGGVGV 159

Query: 176 STIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSR 235
           +TI    A  +A       +  DLDL  G A         N +S+ +    R+D   +S+
Sbjct: 160 TTITTALARHLADGTRRRIVYVDLDLYGGGATSMLGMVTNNGLSELLQNPQRLDDQLISQ 219

Query: 236 LPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLT 295
             +  ++ L +L+        +      I  ++ +L++ +  V+LDVP        E L 
Sbjct: 220 AVLAQSDRLHVLSCELPYDSDFTLRAGAIAELVGLLKRHYHYVLLDVPAHSGRPALEALD 279

Query: 296 LSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPL 355
            S  + +     +  +  +  L     + R ++    L++N  + P +  +   DF   L
Sbjct: 280 ASAVIHVVADRSVQAVHEATRLCRFADQ-RASEPLVTLLVNDAQAPVRARVKGEDFTRAL 338

Query: 356 GITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSK-PQSAMY 414
                   P++     ++ N G+ + + + ++  A  +V  +  L G  TV++ P  A  
Sbjct: 339 ARASVHQFPYEPDALALAENLGEPVPD-NKRAGFAKAIVALANSLTGSETVTRLPWYARL 397

Query: 415 TKIKK 419
           T  ++
Sbjct: 398 TGKRR 402


>gi|172062961|ref|YP_001810612.1| response regulator receiver protein [Burkholderia ambifaria MC40-6]
 gi|171995478|gb|ACB66396.1| response regulator receiver protein [Burkholderia ambifaria MC40-6]
          Length = 407

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 98/375 (26%), Positives = 175/375 (46%), Gaps = 14/375 (3%)

Query: 52  RMSQVNMRITR-----GSIAEAVSCFSD-SSTPDLIIVQTKVDSREVLSALEPLAEVCDS 105
           R++Q ++ ITR     G+  +A+        +P  +IV    DS   +S L  LAE+CD 
Sbjct: 38  RVAQ-DLSITRAHVQPGNCDDAIRLLQQHERSPRQLIVDVS-DSVLPVSDLMRLAEMCDP 95

Query: 106 GTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSIS 165
             +V+ IG  NDV L+R L+   V +Y+++PL+V  +  +++A  +  +     +G  +S
Sbjct: 96  SVRVVAIGTQNDVGLFRNLLGIGVQDYIVKPLTVELMRRALTATESVVQV---RTGKIVS 152

Query: 166 FIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPV 225
           F+G+RGGVG++T+A + A  +A         ADL+L  G AN        N + + +   
Sbjct: 153 FVGARGGVGATTVAVSLARCLAGEKRRRVAYADLNLHGGGANSMLGLSSNNGLIELLNME 212

Query: 226 GRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHV 285
            R D A   R+ V   + L +L+A           +  I  ++D+L+  F  V+ DV + 
Sbjct: 213 QRPDDALFDRMFVTKGDRLHVLSAELAYGEDAPLRDDAIAQLVDMLKDRFHYVLFDVGNR 272

Query: 286 WNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPE 345
                ++ L  SD V I     +     +  L   +K+L P ++   +VLN    P K  
Sbjct: 273 AGKLFEDALAASDLVYIVADRSVHAAYEAARLARFVKEL-PGERLLSMVLNNPLEPVKGR 331

Query: 346 ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGR-V 404
           ++ +DF    G      +P +     ++ N G+ I E   +    + +   +  + G  +
Sbjct: 332 VAQTDFEDAFGGVKLRELPHEPQPLAVAENLGEPI-EGGKRRGFLDEIRRLANGITGESM 390

Query: 405 TVSKPQSAMYTKIKK 419
            V++P  A + K +K
Sbjct: 391 AVAEPWYARFVKWRK 405


>gi|78062904|ref|YP_372812.1| response regulator receiver domain-containing protein [Burkholderia
           sp. 383]
 gi|77970789|gb|ABB12168.1| response regulator receiver domain protein (CheY-like)
           [Burkholderia sp. 383]
          Length = 415

 Score =  108 bits (270), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 88/332 (26%), Positives = 152/332 (45%), Gaps = 14/332 (4%)

Query: 93  LSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTP 152
           +S L  LA+VCD   +VI IG  NDV L+R L+   V +Y+++PL+V  +  +++A    
Sbjct: 91  VSDLMRLADVCDPSVRVIAIGTQNDVGLFRNLLGIGVQDYIVKPLTVELMRRALTAT--- 147

Query: 153 QEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDK 212
           +   +  +G  +SF+G+RGGVG++TI  + A  +AS         DL+L  G AN  F  
Sbjct: 148 ESVVQARTGKVVSFVGARGGVGATTITVSLARFLASEKRRRVAYVDLNLHGGGANSMFGL 207

Query: 213 DPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILE 272
              N + + +    R D A   R+ V   + L +L+A           ++ +  ++D+L+
Sbjct: 208 SSNNGLIELLNMGQRPDDALFERMFVTKGDRLHVLSAELAYGADAPLSDQAVARLVDMLK 267

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY 332
             F  V+ DV        ++ L  SD V +     +     +  L+  +++L P ++   
Sbjct: 268 DRFHYVLFDVGSSAGKLLEDALVASDLVHVVVDRSVHAAYEAARLVRFVREL-PGERLLS 326

Query: 333 LVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANL 392
           +VLN    P    +   DF    G      +P +     ++ N G+ I     + A  N 
Sbjct: 327 MVLNNPLAPVAGRVEPVDFEEAFGGAKLHELPHEPQTLAVAENLGEPI-----EGAKRNG 381

Query: 393 LVDFSRVLMGRVT-----VSKPQSAMYTKIKK 419
            +D  R L   +T     V++P  A   K +K
Sbjct: 382 FLDQIRQLANGITGEPMVVAEPWYARLVKWRK 413


>gi|167590422|ref|ZP_02382810.1| response regulator receiver protein [Burkholderia ubonensis Bu]
          Length = 404

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/320 (24%), Positives = 145/320 (45%), Gaps = 4/320 (1%)

Query: 99  LAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKG 158
           LAEVCD   +V+ +G  NDV L+R L+   V +Y+++PL+V  +  +++A    +   + 
Sbjct: 86  LAEVCDPSVRVVAVGTQNDVGLFRNLLGIGVQDYIVKPLTVELVRRALTAT---ESVVQA 142

Query: 159 SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSI 218
            +G ++SF+G+RGGVG++TIA + A  +A          DL+L  G AN  F     N +
Sbjct: 143 RTGKTVSFVGARGGVGATTIAVSLARCLAGEKRRRVAYVDLNLHGGGANSMFGLSSNNGL 202

Query: 219 SDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLV 278
            + +    R D A   R+ V   + L +L+A           +  +  ++D+L+  F  V
Sbjct: 203 IELLNMEQRPDDALFERMFVTKGDRLHVLSAELAYGADVPLRDAAVAGLVDMLKDRFHYV 262

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQV 338
           + DV        ++ L  SD V I     +     +  L    ++L P ++   +VLN  
Sbjct: 263 LFDVGSGAGRLFEDALEASDLVYIVADRSVHAAYEAARLARFTREL-PGERLLSMVLNNP 321

Query: 339 KTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSR 398
             P    +  +DF    G      +P +     ++ N G+ I     +  +  +    + 
Sbjct: 322 LAPVAGRVEPADFEEAFGSVKLRELPHEPQTLAVAENLGEPIDSAKRRGFLDEIRQMANG 381

Query: 399 VLMGRVTVSKPQSAMYTKIK 418
           +    + V++P  A + K +
Sbjct: 382 ITGESMAVAEPWYARFVKWR 401


>gi|254485918|ref|ZP_05099123.1| hypothetical protein RGAI101_574 [Roseobacter sp. GAI101]
 gi|214042787|gb|EEB83425.1| hypothetical protein RGAI101_574 [Roseobacter sp. GAI101]
          Length = 390

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 88/316 (27%), Positives = 156/316 (49%), Gaps = 11/316 (3%)

Query: 83  VQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADI 142
           V T++ +  + +A E ++E+C SG  V+V+G  +D+S+YRAL +   SEY   P++  +I
Sbjct: 49  VLTEMGNMPLDAACESVSEICKSGANVVVLGGRSDLSIYRALRNAGASEYFAFPVTAEEI 108

Query: 143 I--NSISAIFTPQEEG---KGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVF--AMETL 195
           I  N  +A  +P  +      SS C I  +G  GGVG S +A + AF  AS    A++T 
Sbjct: 109 IAANIQAAPSSPASQPIPLAPSSTC-IGVMGCTGGVGGSLLAQSLAFHAASPKGPALQTA 167

Query: 196 LADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSR 255
           L D DL +GT  I+ D++    + +A+    R+D  F++       + L++ + P+    
Sbjct: 168 LIDADLRFGTQAIDLDRNDTPGLQEALSAPDRVDPTFLAATMEPLNDRLALYSQPSRGFE 227

Query: 256 TYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSK 315
             D  E    P++  ++  F  +++D+P        E+    D +V+      AG+  + 
Sbjct: 228 NVDQLEASFAPLIQSMKGKFGALVVDLPRTTLVAQPELARKLDTLVLVIPAGYAGVNVAS 287

Query: 316 NLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSAN 375
            L+ +LK   P D     VL++ +   K  ++  D    +    +AI+P  GA+   +  
Sbjct: 288 RLMALLKTEAP-DLKILPVLSEFRQDAK--LTAKDLAKAIHQDVAAILPDSGAIIHRAHR 344

Query: 376 SGKMIHEVDPKSAIAN 391
           + K + E  P+SA A 
Sbjct: 345 AAKPVIESQPRSAYAK 360


>gi|319783872|ref|YP_004143348.1| response regulator receiver [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169760|gb|ADV13298.1| response regulator receiver [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 404

 Score =  106 bits (265), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 93/380 (24%), Positives = 178/380 (46%), Gaps = 27/380 (7%)

Query: 52  RMSQVNMRIT--RGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKV 109
           ++S V   +T  RG I EA     D      IIV       E + +L+ +    +    V
Sbjct: 34  QLSTVEKNVTELRGEIQEA-----DFGA---IIVDMDAARLEEVESLQRIMRRLEDKVPV 85

Query: 110 IVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSI-SAIFTPQEEGKGSSGCSISFIG 168
           +V+    + +  R L+   V+++L++P++ AD++ S+  A+  P  E    S    +F+ 
Sbjct: 86  VVVTQEFNAAAVRILVQLKVADFLVKPITTADLVRSVVRALQGPGREENTESQI-YTFMP 144

Query: 169 SRGGVGSSTIAHNCAFSI--ASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVG 226
           + GGVG++T+A   AF +  +      T + DL+   G      D +P   I++      
Sbjct: 145 AAGGVGTTTLALQTAFQLHHSVTRGASTCVVDLNFQQGACAEYLDLEPRFDITEIENQPE 204

Query: 227 RIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVW 286
           R+D+  +  +   +A  L +L APA  +    F   ++V +LD++   F  V++D+P  W
Sbjct: 205 RLDRQLLDVMLSKHASGLCVLAAPAHPAEMRSFKTDVVVRMLDLVSAYFDNVVIDMPRTW 264

Query: 287 NSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPK-KPE 345
             WT+ VL  S+K+ I   + +  LR+++ LI  + +    +  P +++N+ +       
Sbjct: 265 FPWTETVLLGSNKLYIVAEMTVPCLRHTQRLIQAVYETAGKEVKPNVIVNRFEQKMFDNG 324

Query: 346 ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVT 405
           I  +D    LG      I  +  +   + + G  +HE+DP    AN++ D  ++++    
Sbjct: 325 IKQADVQEILGEHFVGGIANNYRLVREAVDRGVPLHEIDPN---ANVVNDLKKIIL---- 377

Query: 406 VSKPQSAMYTKIK--KIFNM 423
              P+ A+ T+ K   +F M
Sbjct: 378 ---PEEAVPTRAKSRSLFGM 394


>gi|167581959|ref|ZP_02374833.1| CpaE, putative [Burkholderia thailandensis TXDOH]
 gi|257139202|ref|ZP_05587464.1| CpaE, putative [Burkholderia thailandensis E264]
          Length = 411

 Score =  105 bits (263), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 89/371 (23%), Positives = 162/371 (43%), Gaps = 11/371 (2%)

Query: 49  IDPRMSQVNMRITRGSIAEAVSCFSD-SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGT 107
           +D  M+  +  + RG I +A++   D    P  ++V     +   LS L  LA+VCD   
Sbjct: 43  VDQAMTGAH--VARGGIDDAIALMRDLPHGPQHLLVDVS-GAAMPLSDLARLADVCDPSV 99

Query: 108 KVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFI 167
            VIV+G+ NDV L+R+++   V +YL++PL+V  +  ++SA   P    +  +G +I F+
Sbjct: 100 NVIVVGEHNDVGLFRSMLRVGVRDYLVKPLTVELVHRALSAA-DPNAAAR--TGKAIGFV 156

Query: 168 GSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGR 227
           G+RGGVG ++IA   A  +A          D D   G A           + + +    R
Sbjct: 157 GARGGVGVTSIAVALARHLADRTRRRVAYVDFDCHGGAACSMLGVVSNQGLVELLQNPQR 216

Query: 228 IDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWN 287
           +D   + +  V  ++ LS+L+A              +  ++  L   F  V+LD+P    
Sbjct: 217 LDAQLIHQAMVAQSDRLSVLSAELPYDSEAPLRAGAVAGLVGALRHQFHYVLLDLPERAG 276

Query: 288 SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEIS 347
               E L     V +     +   R +  L+  ++  R  D    L+LN  + P +  + 
Sbjct: 277 RLVDEALAACASVYVVADRSVHAAREAARLLHHVQA-RDGDAHVSLILNNAQQPVRGRVE 335

Query: 348 ISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS-AIANLLVDFSRVLMGRVTV 406
            +DF   +G   +  +P++     ++ N G  +    P+S   A  +   ++ L G    
Sbjct: 336 PADFARAVGRASALELPYEPLTLAVAENLGAALDA--PRSGGFAAGIATLAQGLTGADAA 393

Query: 407 SKPQSAMYTKI 417
           S  +   Y ++
Sbjct: 394 SASRRPWYARL 404


>gi|83720991|ref|YP_442978.1| CpaE [Burkholderia thailandensis E264]
 gi|83654816|gb|ABC38879.1| CpaE, putative [Burkholderia thailandensis E264]
          Length = 405

 Score =  105 bits (263), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 89/371 (23%), Positives = 162/371 (43%), Gaps = 11/371 (2%)

Query: 49  IDPRMSQVNMRITRGSIAEAVSCFSD-SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGT 107
           +D  M+  +  + RG I +A++   D    P  ++V     +   LS L  LA+VCD   
Sbjct: 37  VDQAMTGAH--VARGGIDDAIALMRDLPHGPQHLLVDVS-GAAMPLSDLARLADVCDPSV 93

Query: 108 KVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFI 167
            VIV+G+ NDV L+R+++   V +YL++PL+V  +  ++SA   P    +  +G +I F+
Sbjct: 94  NVIVVGEHNDVGLFRSMLRVGVRDYLVKPLTVELVHRALSAA-DPNAAAR--TGKAIGFV 150

Query: 168 GSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGR 227
           G+RGGVG ++IA   A  +A          D D   G A           + + +    R
Sbjct: 151 GARGGVGVTSIAVALARHLADRTRRRVAYVDFDCHGGAACSMLGVVSNQGLVELLQNPQR 210

Query: 228 IDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWN 287
           +D   + +  V  ++ LS+L+A              +  ++  L   F  V+LD+P    
Sbjct: 211 LDAQLIHQAMVAQSDRLSVLSAELPYDSEAPLRAGAVAGLVGALRHQFHYVLLDLPERAG 270

Query: 288 SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEIS 347
               E L     V +     +   R +  L+  ++  R  D    L+LN  + P +  + 
Sbjct: 271 RLVDEALAACASVYVVADRSVHAAREAARLLHHVQA-RDGDAHVSLILNNAQQPVRGRVE 329

Query: 348 ISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS-AIANLLVDFSRVLMGRVTV 406
            +DF   +G   +  +P++     ++ N G  +    P+S   A  +   ++ L G    
Sbjct: 330 PADFARAVGRASALELPYEPLTLAVAENLGAALDA--PRSGGFAAGIATLAQGLTGADAA 387

Query: 407 SKPQSAMYTKI 417
           S  +   Y ++
Sbjct: 388 SASRRPWYARL 398


>gi|167620123|ref|ZP_02388754.1| CpaE, putative [Burkholderia thailandensis Bt4]
          Length = 366

 Score =  105 bits (263), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 80/322 (24%), Positives = 143/322 (44%), Gaps = 6/322 (1%)

Query: 60  ITRGSIAEAVSCFSD-SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDV 118
           + RG I +A++   D    P  ++V     +   LS L  LA+VCD    VIV+G+ NDV
Sbjct: 46  VARGGIDDAIALMRDLPHGPQHLLVDVS-GAAMPLSDLARLADVCDPSVNVIVVGEHNDV 104

Query: 119 SLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTI 178
            L+R+++   V +YL++PL+V  +  ++SA   P    +  +G +I F+G+RGGVG ++I
Sbjct: 105 GLFRSMLRVGVRDYLVKPLTVELVHRALSAA-DPNAAAR--TGKAIGFVGARGGVGVTSI 161

Query: 179 AHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPV 238
           A   A  +A          D D   G A           + + +    R+D   + +  V
Sbjct: 162 AVALARHLADRTRRRVAYVDFDCHGGAACSMLGVVSNQGLVELLQNPQRLDAQLIHQAMV 221

Query: 239 FYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSD 298
             ++ LS+L+A              +  ++  L   F  V+LD+P        E L    
Sbjct: 222 AQSDRLSVLSAELPYDSEAPLRAGAVAGLVGALRHQFHYVLLDLPERAGRLVDEALAACA 281

Query: 299 KVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGIT 358
            V +     +   R +  L+  ++  R  D    L+LN  + P +  +  +DF   +G  
Sbjct: 282 SVYVVADRSVHAAREAARLLHHVQA-RDGDAHVSLILNNAQQPVRGRVEPADFARAVGRA 340

Query: 359 PSAIIPFDGAVFGMSANSGKMI 380
            +  +P++     ++ N G  +
Sbjct: 341 SALELPYEPLTLAVAENLGAAL 362


>gi|260463896|ref|ZP_05812092.1| response regulator receiver protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259030271|gb|EEW31551.1| response regulator receiver protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 404

 Score =  105 bits (263), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 84/348 (24%), Positives = 164/348 (47%), Gaps = 13/348 (3%)

Query: 80  LIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSV 139
           +IIV       E + +L+ +    +    V+V+    + +  R L+   V+++L++P++ 
Sbjct: 56  VIIVDMDAARLEEVESLQRIMRRLEGKAPVVVVTQEFNAAAVRILVQLKVADFLVKPITT 115

Query: 140 ADIINSI-SAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSI--ASVFAMETLL 196
           AD++ S+  A+  P  E    S    +F+ + GGVG++T+A   AF +  +      T +
Sbjct: 116 ADLVRSVVRALQGPGREENTESQI-YTFMPAAGGVGTTTLALQTAFQLHHSVTRGASTCV 174

Query: 197 ADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRT 256
            DL+   G      D +P   I++      R+D+  +  +   +A  L +L AP   S  
Sbjct: 175 VDLNFQQGACAEYLDLEPRFDITEIENQPERLDRQLLDVMLSKHASGLCVLAAPTHPSEM 234

Query: 257 YDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKN 316
             F   ++V +LD++   F  V++D+P  W  WT+ VL  S+K+ I   + +  LR+++ 
Sbjct: 235 RSFKTDVVVRMLDLVSAYFDNVVIDMPRTWFPWTETVLLGSNKLYIVAEMTVPCLRHTQR 294

Query: 317 LIDVLKKLRPADKPPYLVLNQVKTPK-KPEISISDFCAPLGITPSAIIPFDGAVFGMSAN 375
           LI  + +    +  P +++N+ +       I  +D    LG      I  +  +   + +
Sbjct: 295 LIQAVYETVGKEVKPNVIVNRFEQKMFDNGIKQADVQEILGEHFVGGIANNYRLVREAVD 354

Query: 376 SGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNM 423
            G  +HE+DP    AN++ D  R+++    V     A+  K K +F +
Sbjct: 355 RGVPLHEIDPN---ANVVNDLKRIILPEEAV-----AIGAKSKSLFGL 394


>gi|167841783|ref|ZP_02468467.1| CpaE, putative [Burkholderia thailandensis MSMB43]
          Length = 382

 Score =  103 bits (258), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 88/355 (24%), Positives = 153/355 (43%), Gaps = 10/355 (2%)

Query: 49  IDPRMSQVNMRITRGSIAEAVSCFSD-SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGT 107
           +D  M+  +  + RG+I +A++   D    P  ++V     +   LS L  LA+VCD   
Sbjct: 37  VDQAMTGAH--VARGAIDDAIALMRDLPHGPQHLLVDVS-GAAMPLSDLARLADVCDPSV 93

Query: 108 KVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFI 167
            VIVIG+ NDV L+R ++   V +YL++PL+V  +  ++SA   P    +  +G +I F+
Sbjct: 94  NVIVIGEQNDVGLFRNMLRIGVRDYLVKPLTVELVHRALSAA-DPGAAAR--TGKAIGFV 150

Query: 168 GSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGR 227
           G+RGGVG ++IA   A  +A          D D   G A           + + +    R
Sbjct: 151 GARGGVGVTSIAVALARHLADRVRRRVAYVDFDCHGGAACSMLGVVSNQGLVELLQNPQR 210

Query: 228 IDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWN 287
           +D   +    V  ++ LS+L+A              +  ++  L   F  V+LD+P    
Sbjct: 211 LDAQLIKHAMVAQSDRLSVLSAELPYDSEAPLRAGAVAGLVGALRHQFHYVLLDLPERAG 270

Query: 288 SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEIS 347
               E L     V I     +   R    L+   + L   D    L+LN  + P +  + 
Sbjct: 271 RLADEALAACASVYIVADRSVHAAREVARLLHHAETL-DGDAHVSLILNNAQQPVRGRVE 329

Query: 348 ISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMG 402
            +DF   +G   +  +P++     ++ N G  +    P+   A  +   ++ L G
Sbjct: 330 PADFARAVGRASALELPYEPLTLAVAENLGAALDA--PRGGFAAGIAALAQGLTG 382


>gi|152994349|ref|YP_001339184.1| response regulator receiver protein [Marinomonas sp. MWYL1]
 gi|150835273|gb|ABR69249.1| response regulator receiver protein [Marinomonas sp. MWYL1]
          Length = 414

 Score =  103 bits (256), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 100/400 (25%), Positives = 180/400 (45%), Gaps = 48/400 (12%)

Query: 10  SDFLENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAV 69
           SD  + ++N S+ +      S  V    D+L           R+   + R+  G +  A 
Sbjct: 2   SDSNQKQNNESQFLAIFAADSAQVKQFGDSL----------SRLGYSSDRVFLGGVEAAE 51

Query: 70  SCFSDSSTPDLIIVQTKVDSR-EVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNH 128
           S   + + P L+ V   +D+    L ++  L E+C    K++  G    + LYRAL+SN 
Sbjct: 52  SWVKEHAIPSLLFVD--IDNEVATLVSISALIELCGPTCKIVAFGSEQSIDLYRALLSNG 109

Query: 129 VSEYLIEPLSVADIINSISAIFTPQEEGK---GSSGCSISFIGSRGGVGSSTIAHNCAFS 185
           V +YL++P+     ++ ISA+    E GK    ++G +I+  G+ GGVG+S ++   A S
Sbjct: 110 VFDYLLKPIP----LDMISAVIQRAERGKVDDATTGRTIAVTGTSGGVGASLVSLGLAQS 165

Query: 186 IASVFAMETLLADLDLPYGTANINFDKDPINSISDAI-----------YPVGRIDK--AF 232
           ++    M T L D D   G+  +    +    +  A+             +G++D   + 
Sbjct: 166 LSKKRHMMTALVDFDRKNGSLGLMLGYNGDAGLGSALSAENIDARLLGRSIGKVDTRLSL 225

Query: 233 VSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQE 292
           V+++P F+AE L + + PA++  +              L ++F  VI D+P      + +
Sbjct: 226 VAQVPDFHAEEL-VDSYPALVLGSS-------------LCRMFNQVIWDLPSAKPFGSMD 271

Query: 293 VLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFC 352
           VL  +   +I T   +A  RN+  L++ +     + +  +LV N  K   K  IS  +F 
Sbjct: 272 VLAHAQTRIIVTDFTVADARNTLRLLNEIGD-ESSGQRIFLVRNSSKHMDKEFISQKEFE 330

Query: 353 APLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANL 392
             +G     ++P+ G+  G S   GK+  E  P  A+  L
Sbjct: 331 EFIGCKIDMVLPYAGSGLGSSLLQGKLSLEAFPDFALGLL 370


>gi|167824267|ref|ZP_02455738.1| putative CpaE protein [Burkholderia pseudomallei 9]
          Length = 380

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 80/323 (24%), Positives = 140/323 (43%), Gaps = 6/323 (1%)

Query: 59  RITRGSIAEAVSCFSD-SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTND 117
           ++ RG I +A++   D S  P  ++V     +   LS L  LA+VCD    VIVIG+ ND
Sbjct: 51  QVARGGIDDAIALMRDLSHGPQHLLVDVS-GAAMPLSDLARLADVCDPSVNVIVIGERND 109

Query: 118 VSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSST 177
           V L+R+++   V +YL++PL+V  +  ++SA         G    +I F+G+RGGVG ++
Sbjct: 110 VGLFRSMLRIGVRDYLVKPLTVELVHRALSAADPNAAARAGK---AIGFVGARGGVGVTS 166

Query: 178 IAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLP 237
           IA   A  +A          D D   G A           + + +    R+D   + +  
Sbjct: 167 IAVALARHLADRTRRRVAYVDFDCHGGAACSMLGVVSNQGLVELLQNPQRLDAQLIHQAM 226

Query: 238 VFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLS 297
           V  ++ L +L+A         +    +  ++  L   F  V+LD+P        E L   
Sbjct: 227 VAQSDRLFVLSAELPYDSEAPWRAGAVAGLVGALRHQFHYVLLDLPERAGRLVDEALAAC 286

Query: 298 DKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGI 357
             V +     +   R +  L+    + R  D    L+LN  + P +  +  +DF   +G 
Sbjct: 287 ASVYVVADRSVHAAREAARLLH-HAQARDGDAHVSLILNNAQQPVRGRVEPADFARAVGR 345

Query: 358 TPSAIIPFDGAVFGMSANSGKMI 380
                +P++     ++ N G  +
Sbjct: 346 ASMLELPYEPQTLAVAENLGAAL 368


>gi|167919047|ref|ZP_02506138.1| putative CpaE protein [Burkholderia pseudomallei BCC215]
          Length = 373

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 80/323 (24%), Positives = 140/323 (43%), Gaps = 6/323 (1%)

Query: 59  RITRGSIAEAVSCFSD-SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTND 117
           ++ RG I +A++   D S  P  ++V     +   LS L  LA+VCD    VIVIG+ ND
Sbjct: 51  QVARGGIDDAIALMRDLSHGPQHLLVDVS-GAAMPLSDLARLADVCDPSVNVIVIGERND 109

Query: 118 VSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSST 177
           V L+R+++   V +YL++PL+V  +  ++SA         G    +I F+G+RGGVG ++
Sbjct: 110 VGLFRSMLRIGVRDYLVKPLTVELVHRALSAADPNAAARAGK---AIGFVGARGGVGVTS 166

Query: 178 IAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLP 237
           IA   A  +A          D D   G A           + + +    R+D   + +  
Sbjct: 167 IAVALARHLADRTRRRVAYVDFDCHGGAACSMLGVVSNQGLVELLQNPQRLDAQLIHQAM 226

Query: 238 VFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLS 297
           V  ++ L +L+A         +    +  ++  L   F  V+LD+P        E L   
Sbjct: 227 VAQSDRLFVLSAELPYDSEAPWRAGAVAGLVGALRHQFHYVLLDLPERAGRLVDEALAAC 286

Query: 298 DKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGI 357
             V +     +   R +  L+    + R  D    L+LN  + P +  +  +DF   +G 
Sbjct: 287 ASVYVVADRSVHAAREAARLLH-HAQARDGDAHVSLILNNAQQPVRGRVEPADFARAVGR 345

Query: 358 TPSAIIPFDGAVFGMSANSGKMI 380
                +P++     ++ N G  +
Sbjct: 346 ASMLELPYEPQTLAVAENLGAAL 368


>gi|167738672|ref|ZP_02411446.1| putative CpaE protein [Burkholderia pseudomallei 14]
          Length = 367

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 80/323 (24%), Positives = 140/323 (43%), Gaps = 6/323 (1%)

Query: 59  RITRGSIAEAVSCFSD-SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTND 117
           ++ RG I +A++   D S  P  ++V     +   LS L  LA+VCD    VIVIG+ ND
Sbjct: 45  QVARGGIDDAIALMRDLSHGPQHLLVDVS-GAAMPLSDLARLADVCDPSVNVIVIGERND 103

Query: 118 VSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSST 177
           V L+R+++   V +YL++PL+V  +  ++SA         G    +I F+G+RGGVG ++
Sbjct: 104 VGLFRSMLRIGVRDYLVKPLTVELVHRALSAADPNAAARAGK---AIGFVGARGGVGVTS 160

Query: 178 IAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLP 237
           IA   A  +A          D D   G A           + + +    R+D   + +  
Sbjct: 161 IAVALARHLADRTRRRVAYVDFDCHGGAACSMLGVVSNQGLVELLQNPQRLDAQLIHQAM 220

Query: 238 VFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLS 297
           V  ++ L +L+A         +    +  ++  L   F  V+LD+P        E L   
Sbjct: 221 VAQSDRLFVLSAELPYDSEAPWRAGAVAGLVGALRHQFHYVLLDLPERAGRLVDEALAAC 280

Query: 298 DKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGI 357
             V +     +   R +  L+    + R  D    L+LN  + P +  +  +DF   +G 
Sbjct: 281 ASVYVVADRSVHAAREAARLLH-HAQARDGDAHVSLILNNAQQPVRGRVEPADFARAVGR 339

Query: 358 TPSAIIPFDGAVFGMSANSGKMI 380
                +P++     ++ N G  +
Sbjct: 340 ASMLELPYEPQTLAVAENLGAAL 362


>gi|156740442|ref|YP_001430571.1| response regulator receiver protein [Roseiflexus castenholzii DSM
           13941]
 gi|156231770|gb|ABU56553.1| response regulator receiver protein [Roseiflexus castenholzii DSM
           13941]
          Length = 444

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 88/348 (25%), Positives = 154/348 (44%), Gaps = 14/348 (4%)

Query: 63  GSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYR 122
           GS+A  V   +  S PDL+IV   VD  +V +A+  +     + T  I +  + DV   R
Sbjct: 66  GSVAAGV-LLARQSRPDLVIVDRDVD--QVEAAIRQIFTHVPA-THCIAVTPSADVPTLR 121

Query: 123 ALISNHVSEYLIEPLSVADIINSISAIFTPQEE--------GKGSSGCSISFIGSRGGVG 174
            L+     + +  P+  ADI+NSI ++ T +          G   +G  +  +  +GGVG
Sbjct: 122 RLVMAGARDVISRPIHHADIMNSIRSVVTAERNRAVRAASTGDRQAGRLVVVVAPKGGVG 181

Query: 175 SSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVS 234
           ++TIA N A ++  V      LAD+ L +G   +  +    +++ D +   G +D     
Sbjct: 182 ATTIATNLAVALRQVTNTSVALADIGLQFGDVGVQLNIWSRHTLHDLVLHAGELDDTLFE 241

Query: 235 RLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVL 294
           ++   ++  + +L AP  L    D   + ++ VL  L      V+ D     +  T+ +L
Sbjct: 242 KVLQTHSSGVKVLLAPHELEAAGDISGEAMIAVLQGLLGRHTYVVCDTWSFLDEVTETLL 301

Query: 295 TLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAP 354
             +D V++ T+ ++  LRN+K  ++ L +         LVLN  + P    I++ D    
Sbjct: 302 QRADDVLVVTTPEVPALRNTKGFLEYLTRNELTRGRITLVLN--RFPSVNGIALHDVQKH 359

Query: 355 LGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMG 402
           L     A IP +G     S N G  I    P S  +  L+  +  + G
Sbjct: 360 LRYPVGANIPSEGQPITHSINRGVPIVMAQPHSWASQSLLRLAAYVAG 407


>gi|167902785|ref|ZP_02489990.1| putative CpaE protein [Burkholderia pseudomallei NCTC 13177]
          Length = 381

 Score =  102 bits (253), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/323 (24%), Positives = 140/323 (43%), Gaps = 6/323 (1%)

Query: 59  RITRGSIAEAVSCFSD-SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTND 117
           ++ RG I +A++   D S  P  ++V     +   LS L  LA+VCD    VIVIG+ ND
Sbjct: 45  QVARGGIDDAIALMRDLSHGPQHLLVDVS-GAAMPLSDLARLADVCDPSVNVIVIGERND 103

Query: 118 VSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSST 177
           V L+R+++   V +YL++PL+V  +  ++SA         G    +I F+G+RGGVG ++
Sbjct: 104 VGLFRSMLRIGVRDYLVKPLTVELVHRALSAADPNAAARAGK---AIGFVGARGGVGVTS 160

Query: 178 IAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLP 237
           IA   A  +A          D D   G A           + + +    R+D   + +  
Sbjct: 161 IAVALARHLADRTRRRVAYVDFDCHGGAACSMLGVVSNQGLVELLQNPQRLDAQLIHQAM 220

Query: 238 VFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLS 297
           V  ++ L +L+A         +    +  ++  L   F  V+LD+P        E L   
Sbjct: 221 VAQSDRLFVLSAELPYDSEAPWRAGAVAGLVGALRHQFHYVLLDLPERAGRLVDEALAAC 280

Query: 298 DKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGI 357
             V +     +   R +  L+    + R  D    L+LN  + P +  +  +DF   +G 
Sbjct: 281 ASVYVVADRSVHAAREAARLLH-HAQARDGDAHVSLILNNAQQPVRGRVEPADFARAVGR 339

Query: 358 TPSAIIPFDGAVFGMSANSGKMI 380
                +P++     ++ N G  +
Sbjct: 340 ASMLELPYEPQTLAVAENLGAAL 362


>gi|148261011|ref|YP_001235138.1| Flp pilus assembly protein ATPase CpaE-like protein [Acidiphilium
           cryptum JF-5]
 gi|146402692|gb|ABQ31219.1| Flp pilus assembly protein ATPase CpaE-like protein [Acidiphilium
           cryptum JF-5]
          Length = 400

 Score =  102 bits (253), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 83/310 (26%), Positives = 144/310 (46%), Gaps = 11/310 (3%)

Query: 60  ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS 119
           + R S AE +   +   TP  +++    +  + +SA+  L  V D GT+V++IG+   + 
Sbjct: 54  LQRVSFAETLDYLARVDTPRTVLIDISGEE-QPMSAVHRLEPVIDPGTRVLIIGEERSIG 112

Query: 120 LYRALISN-HVSEYLIEPLSVADIINSISAIFTPQ----EEGKGSSGCSISFIGSRGGVG 174
            YR+L     VSEYL +PL  A +   ++     +    E  +G  G  ++  G+ GGVG
Sbjct: 113 FYRSLTRTLGVSEYLSKPLDAALVSRELAPWAVGEVPAFETSRG--GSMVAVCGAAGGVG 170

Query: 175 SSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVS 234
           ++TIA   A+ I       T+L D DL  G+A +  +  P   + +A+    RID   + 
Sbjct: 171 ATTIATGLAWLIGGEIRRHTILLDADLQRGSAALASNAPPSTGLRNALDTPDRIDPLLIE 230

Query: 235 RLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVL 294
           R        L +L A   L+  +++       +L+ L Q + LV+ D+P     +  E+L
Sbjct: 231 RAAQPSIGRLHVLGAEEPLTEPWEYHPGGGRALLNALRQRYNLVVADIPARPTGFAAELL 290

Query: 295 TLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAP 354
            L+   VI T+     L N+   +  L   +     P +VLN+ +  + P   IS   + 
Sbjct: 291 ALAHMRVIVTTGAPRSLGNAARWL-ALPPGQMQTSAPIVVLNRYQRKRCP--PISTIAST 347

Query: 355 LGITPSAIIP 364
           LG   + ++P
Sbjct: 348 LGTEIAVVVP 357


>gi|167845813|ref|ZP_02471321.1| putative CpaE protein [Burkholderia pseudomallei B7210]
          Length = 399

 Score =  102 bits (253), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/323 (24%), Positives = 140/323 (43%), Gaps = 6/323 (1%)

Query: 59  RITRGSIAEAVSCFSD-SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTND 117
           ++ RG I +A++   D S  P  ++V     +   LS L  LA+VCD    VIVIG+ ND
Sbjct: 51  QVARGGIDDAIALMRDLSHGPQHLLVDVS-GAAMPLSDLARLADVCDPSVNVIVIGERND 109

Query: 118 VSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSST 177
           V L+R+++   V +YL++PL+V  +  ++SA         G    +I F+G+RGGVG ++
Sbjct: 110 VGLFRSMLRIGVRDYLVKPLTVELVHRALSAADPNAAARAGK---AIGFVGARGGVGVTS 166

Query: 178 IAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLP 237
           IA   A  +A          D D   G A           + + +    R+D   + +  
Sbjct: 167 IAVALARHLADRTRRRVAYVDFDCHGGAACSMLGVVSNQGLVELLQNPQRLDAQLIHQAM 226

Query: 238 VFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLS 297
           V  ++ L +L+A         +    +  ++  L   F  V+LD+P        E L   
Sbjct: 227 VAQSDRLFVLSAELPYDSEAPWRAGAVAGLVGALRHQFHYVLLDLPERAGRLVDEALAAC 286

Query: 298 DKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGI 357
             V +     +   R +  L+    + R  D    L+LN  + P +  +  +DF   +G 
Sbjct: 287 ASVYVVADRSVHAAREAARLLH-HAQARDGDAHVSLILNNAQQPVRGRVEPADFARAVGR 345

Query: 358 TPSAIIPFDGAVFGMSANSGKMI 380
                +P++     ++ N G  +
Sbjct: 346 ASMLELPYEPQTLAVAENLGAAL 368


>gi|134282339|ref|ZP_01769044.1| putative CpaE protein [Burkholderia pseudomallei 305]
 gi|237812167|ref|YP_002896618.1| putative CpaE protein [Burkholderia pseudomallei MSHR346]
 gi|134246377|gb|EBA46466.1| putative CpaE protein [Burkholderia pseudomallei 305]
 gi|237505579|gb|ACQ97897.1| putative CpaE protein [Burkholderia pseudomallei MSHR346]
          Length = 411

 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/328 (24%), Positives = 141/328 (42%), Gaps = 6/328 (1%)

Query: 54  SQVNMRITRGSIAEAVSCFSD-SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVI 112
           +    ++ RG I +A++   D S  P  ++V     +   LS L  LA+VCD    VIVI
Sbjct: 46  AMTGAQVARGGIDDAIALMRDLSHGPQHLLVDVS-GAAMPLSDLARLADVCDPSVNVIVI 104

Query: 113 GDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGG 172
           G+ NDV L+R+++   V +YL++PL+V  +  ++SA         G    +I F+G+RGG
Sbjct: 105 GERNDVGLFRSMLRIGVRDYLVKPLTVELVHRALSAADPNAAARAGK---AIGFVGARGG 161

Query: 173 VGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAF 232
           VG ++IA   A  +A          D D   G A           + + +    R+D   
Sbjct: 162 VGVTSIAVALARHLADRTRRRVAYVDFDCHGGAACSMLGVVSNQGLVELLQNPQRLDAQL 221

Query: 233 VSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQE 292
           + +  V  ++ L +L+A         +    +  ++  L   F  V+LD+P        E
Sbjct: 222 IHQAMVAQSDRLFVLSAELPYDSEAPWRAGAVAGLVGALRHQFHYVLLDLPERAGRLVDE 281

Query: 293 VLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFC 352
            L     V +     +   R +  L+    + R  D    L+LN  + P +  +  +DF 
Sbjct: 282 ALAACASVYVVADRSVHAAREAARLLH-HAQARDGDAHVSLILNNAQQPVRGRVEPADFA 340

Query: 353 APLGITPSAIIPFDGAVFGMSANSGKMI 380
             +G      +P++     ++ N G  +
Sbjct: 341 RAVGRASMLELPYEPQTLAVAENLGAAL 368


>gi|53719429|ref|YP_108415.1| putative fimbriae assembly-related protein [Burkholderia
           pseudomallei K96243]
 gi|76809592|ref|YP_333438.1| putative fimbriae assembly-like protein [Burkholderia pseudomallei
           1710b]
 gi|121600845|ref|YP_993004.1| putative CpaE protein [Burkholderia mallei SAVP1]
 gi|124385757|ref|YP_001026336.1| putative fimbriae assembly-related protein [Burkholderia mallei
           NCTC 10229]
 gi|126438416|ref|YP_001058910.1| putative CpaE protein [Burkholderia pseudomallei 668]
 gi|126448035|ref|YP_001080390.1| putative CpaE protein [Burkholderia mallei NCTC 10247]
 gi|126453450|ref|YP_001066152.1| putative CpaE protein [Burkholderia pseudomallei 1106a]
 gi|217421853|ref|ZP_03453357.1| putative CpaE protein [Burkholderia pseudomallei 576]
 gi|242316762|ref|ZP_04815778.1| putative CpaE protein [Burkholderia pseudomallei 1106b]
 gi|254178512|ref|ZP_04885167.1| response regulator receiver domain protein [Burkholderia mallei
           ATCC 10399]
 gi|254260198|ref|ZP_04951252.1| putative CpaE protein [Burkholderia pseudomallei 1710a]
 gi|52209843|emb|CAH35815.1| putative fimbriae assembly-related protein [Burkholderia
           pseudomallei K96243]
 gi|76579045|gb|ABA48520.1| putative fimbriae assembly-related protein [Burkholderia
           pseudomallei 1710b]
 gi|121229655|gb|ABM52173.1| putative CpaE protein [Burkholderia mallei SAVP1]
 gi|124293777|gb|ABN03046.1| putative fimbriae assembly-related protein [Burkholderia mallei
           NCTC 10229]
 gi|126217909|gb|ABN81415.1| putative CpaE protein [Burkholderia pseudomallei 668]
 gi|126227092|gb|ABN90632.1| putative CpaE protein [Burkholderia pseudomallei 1106a]
 gi|126240905|gb|ABO03998.1| putative CpaE protein [Burkholderia mallei NCTC 10247]
 gi|160699551|gb|EDP89521.1| response regulator receiver domain protein [Burkholderia mallei
           ATCC 10399]
 gi|217395595|gb|EEC35613.1| putative CpaE protein [Burkholderia pseudomallei 576]
 gi|242140001|gb|EES26403.1| putative CpaE protein [Burkholderia pseudomallei 1106b]
 gi|254218887|gb|EET08271.1| putative CpaE protein [Burkholderia pseudomallei 1710a]
          Length = 411

 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/328 (24%), Positives = 141/328 (42%), Gaps = 6/328 (1%)

Query: 54  SQVNMRITRGSIAEAVSCFSD-SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVI 112
           +    ++ RG I +A++   D S  P  ++V     +   LS L  LA+VCD    VIVI
Sbjct: 46  AMTGAQVARGGIDDAIALMRDLSHGPQHLLVDVS-GAAMPLSDLARLADVCDPSVNVIVI 104

Query: 113 GDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGG 172
           G+ NDV L+R+++   V +YL++PL+V  +  ++SA         G    +I F+G+RGG
Sbjct: 105 GERNDVGLFRSMLRIGVRDYLVKPLTVELVHRALSAADPNAAARAGK---AIGFVGARGG 161

Query: 173 VGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAF 232
           VG ++IA   A  +A          D D   G A           + + +    R+D   
Sbjct: 162 VGVTSIAVALARHLADRTRRRVAYVDFDCHGGAACSMLGVVSNQGLVELLQNPQRLDAQL 221

Query: 233 VSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQE 292
           + +  V  ++ L +L+A         +    +  ++  L   F  V+LD+P        E
Sbjct: 222 IHQAMVAQSDRLFVLSAELPYDSEAPWRAGAVAGLVGALRHQFHYVLLDLPERAGRLVDE 281

Query: 293 VLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFC 352
            L     V +     +   R +  L+    + R  D    L+LN  + P +  +  +DF 
Sbjct: 282 ALAACASVYVVADRSVHAAREAARLLH-HAQARDGDAHVSLILNNAQQPVRGRVEPADFA 340

Query: 353 APLGITPSAIIPFDGAVFGMSANSGKMI 380
             +G      +P++     ++ N G  +
Sbjct: 341 RAVGRASMLELPYEPQTLAVAENLGAAL 368


>gi|326404411|ref|YP_004284493.1| putative pilus assembly protein [Acidiphilium multivorum AIU301]
 gi|325051273|dbj|BAJ81611.1| putative pilus assembly protein [Acidiphilium multivorum AIU301]
          Length = 373

 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 83/310 (26%), Positives = 144/310 (46%), Gaps = 11/310 (3%)

Query: 60  ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS 119
           + R S AE +   +   TP  +++    +  + +SA+  L  V D GT+V++IG+   + 
Sbjct: 27  LQRVSFAETLDYLARVDTPRTVLIDISGEE-QPMSAVHRLEPVIDPGTRVLIIGEERSIG 85

Query: 120 LYRALISN-HVSEYLIEPLSVADIINSISAIFTPQ----EEGKGSSGCSISFIGSRGGVG 174
            YR+L     VSEYL +PL  A +   ++     +    E  +G  G  ++  G+ GGVG
Sbjct: 86  FYRSLTRTLGVSEYLSKPLDAALVSRELAPWAVGEVPAFETSRG--GSMVAVCGAAGGVG 143

Query: 175 SSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVS 234
           ++TIA   A+ I       T+L D DL  G+A +  +  P   + +A+    RID   + 
Sbjct: 144 ATTIATGLAWLIGGEIRRHTILLDADLQRGSAALASNAPPSTGLRNALDTPDRIDPLLIE 203

Query: 235 RLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVL 294
           R        L +L A   L+  +++       +L+ L Q + LV+ D+P     +  E+L
Sbjct: 204 RAAQPSIGRLHVLGAEEPLTEPWEYHPGGGRALLNALRQRYNLVVADIPARPTGFAAELL 263

Query: 295 TLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAP 354
            L+   VI T+     L N+   +  L   +     P +VLN+ +  + P   IS   + 
Sbjct: 264 ALAHMRVIVTTGAPRSLGNAARWL-ALPPGQMQTSAPIVVLNRYQRKRCP--PISTIAST 320

Query: 355 LGITPSAIIP 364
           LG   + ++P
Sbjct: 321 LGTEIAVVVP 330


>gi|226196297|ref|ZP_03791879.1| putative CpaE protein [Burkholderia pseudomallei Pakistan 9]
 gi|225931514|gb|EEH27519.1| putative CpaE protein [Burkholderia pseudomallei Pakistan 9]
          Length = 935

 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/323 (24%), Positives = 141/323 (43%), Gaps = 6/323 (1%)

Query: 59  RITRGSIAEAVSCFSD-SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTND 117
           ++ RG I +A++   D S  P  ++V     +   LS L  LA+VCD    VIVIG+ ND
Sbjct: 51  QVARGGIDDAIALMRDLSHGPQHLLVDVS-GAAMPLSDLARLADVCDPSVNVIVIGERND 109

Query: 118 VSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSST 177
           V L+R+++   V +YL++PL+V  +  ++SA           +G +I F+G+RGGVG ++
Sbjct: 110 VGLFRSMLRIGVRDYLVKPLTVELVHRALSAADPNAAA---RAGKAIGFVGARGGVGVTS 166

Query: 178 IAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLP 237
           IA   A  +A          D D   G A           + + +    R+D   + +  
Sbjct: 167 IAVALARHLADRTRRRVAYVDFDCHGGAACSMLGVVSNQGLVELLQNPQRLDAQLIHQAM 226

Query: 238 VFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLS 297
           V  ++ L +L+A         +    +  ++  L   F  V+LD+P        E L   
Sbjct: 227 VAQSDRLFVLSAELPYDSEAPWRAGAVAGLVGALRHQFHYVLLDLPERAGRLVDEALAAC 286

Query: 298 DKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGI 357
             V +     +   R +  L+    + R  D    L+LN  + P +  +  +DF   +G 
Sbjct: 287 ASVYVVADRSVHAAREAARLLH-HAQARDGDAHVSLILNNAQQPVRGRVEPADFARAVGR 345

Query: 358 TPSAIIPFDGAVFGMSANSGKMI 380
                +P++     ++ N G  +
Sbjct: 346 ASMLELPYEPQTLAVAENLGAAL 368


>gi|27365653|ref|NP_761181.1| Pilus assembly protein CpaE-like protein [Vibrio vulnificus CMCP6]
 gi|27361801|gb|AAO10708.1| Pilus assembly protein CpaE-like protein [Vibrio vulnificus CMCP6]
          Length = 358

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 88/346 (25%), Positives = 152/346 (43%), Gaps = 14/346 (4%)

Query: 33  VFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREV 92
           VF    +  +V+E S +D R+ Q++ +I   S++ A+S  ++    D++++Q +   RE 
Sbjct: 3   VFAKKGSQLTVIE-SAVD-RIPQLDCQIHARSMSAAISHLAERHCGDILLLQVE---RED 57

Query: 93  LSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTP 152
           L  L  LA+V   G +VI+ GD   +S YR L+   +++YL  PL    +  S+  +   
Sbjct: 58  LEQLPALAKVTPPGCQVILFGDEISLSEYRHLMQMGIADYLALPLDPTALHKSLLHLLGI 117

Query: 153 QEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDK 212
             +     G      G+ GGVG+ST+A N A  +A        L D +L +    I    
Sbjct: 118 HAQKGFQQGQVYLVSGTSGGVGTSTVAANLAVELAK--HRSVALVDFNLNFTQHPILLGV 175

Query: 213 DPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILE 272
           D   S+   ++ V R+D   + +        LS+  A        +   +  + V+  L+
Sbjct: 176 DYQPSLDRLVHDVERVDAVLIKQFGQNIGHQLSLFYAEG----QEELSVQQRINVVTKLK 231

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY 332
           Q F  VILDVPH      + +L  +D +++     L   R +     +L KL       +
Sbjct: 232 QQFAYVILDVPHYLIEKVEHLLVSADNLLLVHDFSLQAGRRADG---ILSKLDGYLHHVH 288

Query: 333 LVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
           LV NQ ++      S         IT  + +PFD      + + G+
Sbjct: 289 LVGNQSRSKSHKPWSEKQLFEAWSITQFSELPFDSKAVQAAEHHGE 334


>gi|37680192|ref|NP_934801.1| Flp pilus assembly protein CpaE-like [Vibrio vulnificus YJ016]
 gi|37198939|dbj|BAC94772.1| Flp pilus assembly protein CpaE-like [Vibrio vulnificus YJ016]
          Length = 378

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 89/351 (25%), Positives = 156/351 (44%), Gaps = 14/351 (3%)

Query: 28  RISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKV 87
           R S+ VF       +V+E S +D R+ Q++ +I   S++ A+S  ++    +++++Q + 
Sbjct: 18  RQSMMVFAKKGAQLTVIE-SAVD-RIPQLDCQIHARSMSAAISHLAERHCGEILLLQVE- 74

Query: 88  DSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSIS 147
             RE L  L  LA+V   G +VI+ GD   +S YR L+   +++YL  PL    +  S+ 
Sbjct: 75  --REDLEQLPALAKVTPPGCQVILFGDEISLSEYRHLMQMGIADYLALPLDPTALHKSLL 132

Query: 148 AIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN 207
            +     +     G      G+ GGVG+ST+A N A  +A   ++   L D +L +    
Sbjct: 133 HLLGIHAQKGFQQGQVYLVSGTSGGVGTSTVAANLAVELAKHRSVA--LVDFNLNFTQHP 190

Query: 208 INFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPV 267
           I    D   S+   ++ V R+D   + +        LS+  A        +   +  + V
Sbjct: 191 ILLGVDYQPSLERLVHDVERVDAVLIKQFGQNIGHQLSLFYAEG----QEELSVQQRINV 246

Query: 268 LDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPA 327
           +  L+Q F  VILDVPH      + +L  +D +++     L   R +     +L KL   
Sbjct: 247 VTKLKQQFAYVILDVPHYLIEKVEHLLVSADNLLLVHDFSLQAGRRADG---ILSKLDGY 303

Query: 328 DKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
               +LV NQ ++      S         IT  + +PFD      + + G+
Sbjct: 304 LHHVHLVGNQSRSKSHKPWSEKQLFEAWSITQFSELPFDSKAVQAAEHHGE 354


>gi|320156055|ref|YP_004188434.1| pilus assembly protein CpaE-like protein [Vibrio vulnificus
           MO6-24/O]
 gi|319931367|gb|ADV86231.1| pilus assembly protein CpaE-like protein [Vibrio vulnificus
           MO6-24/O]
          Length = 358

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 87/346 (25%), Positives = 151/346 (43%), Gaps = 14/346 (4%)

Query: 33  VFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREV 92
           VF       +V+E S +D R+ Q++ +I   S++ A+S  ++    +++++Q +   RE 
Sbjct: 3   VFAKKGAQLTVIE-SAVD-RIPQLDCQIHARSMSAAISHLAERHCGEILLLQVE---RED 57

Query: 93  LSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTP 152
           L  L  LA+V   G +VI+ GD   +S YR L+   +++YL  PL    +  S+  +   
Sbjct: 58  LEQLPALAKVTPPGCQVILFGDEISLSEYRHLMQMGIADYLALPLDPTALHKSLLHLLGI 117

Query: 153 QEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDK 212
             +     G      G+ GGVG+ST+A N A  +A        L D +L +    I    
Sbjct: 118 HAQKGFQQGQVYLVSGTSGGVGTSTVAANLAVELAK--HRSVALVDFNLNFTQHPILLGV 175

Query: 213 DPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILE 272
           D   S+   ++ V R+D   + +        LS+  A        +   +  + V+  L+
Sbjct: 176 DYQPSLDRLVHDVERVDAVLIKQFGQNIGHQLSLFYAEG----QEELSVQQRINVVTKLK 231

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY 332
           Q F  VILDVPH      + +L  +D +++     L   R +     +L KL       +
Sbjct: 232 QQFAYVILDVPHYLIEKVEHLLVSADNLLLVHDFSLQAGRRADG---ILSKLDGYLHHVH 288

Query: 333 LVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
           LV NQ ++      S         IT  + +PFD      + + G+
Sbjct: 289 LVGNQSRSKSHKPWSEKQLFEAWSITQFSELPFDSKAVQAAEHHGE 334


>gi|87199539|ref|YP_496796.1| Flp pilus assembly protein ATPase CpaE-like [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87135220|gb|ABD25962.1| Flp pilus assembly protein ATPase CpaE-like protein
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 398

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/298 (23%), Positives = 147/298 (49%), Gaps = 6/298 (2%)

Query: 106 GTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEG--KGSSGCS 163
            T +I   +  D++L R L+   V++ +  P    +++++         +     +    
Sbjct: 90  ATALIAAVENPDLTLTRTLVREGVTDVIALPFRADELVSATLDAMARHAQAIVPVTLAPV 149

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAME---TLLADLDLPYGTANINFDKDPINSISD 220
           I  + S GG G++T+A + A ++ + F+      ++ADLDL +G      D     SI+D
Sbjct: 150 IGVVRSCGGCGATTVATHLAHAL-NQFSWTNGPAIVADLDLQFGEVGAYLDSSRSGSITD 208

Query: 221 AIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVIL 280
            +    RID+ F+  +    +  + +L+APA ++     +   ++ VLD L + + +V+L
Sbjct: 209 LMLAHDRIDREFLYSMAPPTSGGVGVLSAPATINSIESVNVDDMLFVLDQLRRNYGVVVL 268

Query: 281 DVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKT 340
           D P  W++W   +  LSD +++ T + L+GLR +K  +D+ + L   D+   +V N+V+ 
Sbjct: 269 DFPSAWSNWAASLAVLSDILLLVTPVALSGLRQTKRTLDLFRTLEIPDEKVAIVANRVER 328

Query: 341 PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSR 398
                +  S+  A +G + +A +  +G     +   G +IH +  K++ +  L+  ++
Sbjct: 329 KLFRLVGTSEAEAAIGRSFAASLSDEGDQMVRAQEQGVLIHSIQKKTSFSTALMKLAQ 386


>gi|326423882|ref|NP_760639.2| type II/IV secretion system ATPase TadZ/CpaE [Vibrio vulnificus
           CMCP6]
 gi|319999255|gb|AAO10166.2| Type II/IV secretion system ATPase TadZ/CpaE, associated with Flp
           pilus assembly [Vibrio vulnificus CMCP6]
          Length = 416

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 101/371 (27%), Positives = 177/371 (47%), Gaps = 41/371 (11%)

Query: 69  VSCFSDSSTPDLIIVQTKVD-SREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISN 127
           VS  +  + PDLI V+T  + +++VLS  E  A   D    +IV GD +D    +  +  
Sbjct: 70  VSGLTHVTPPDLIFVETGPNWAQKVLSLQEYEAPSDDFEASLIVFGDESDNGALKIALRL 129

Query: 128 HVSEYLIEPLSVADIINSISAI----FTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCA 183
             ++++ +   V D  + +  +    F+ +E G+        FI ++GG G+ST+A N A
Sbjct: 130 GAADFVSDKALVGDFFHLLKNVSDEKFSSRELGELHL-----FINTKGGCGASTLALNTA 184

Query: 184 FSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDK----AFVSRLPV- 238
             IA     + LL D+D+P+G  +   +  P  S++D I     +D     A V+++   
Sbjct: 185 LEIAGSHPEKVLLLDVDIPFGVISEYLNISPQYSLTDVIEHSKDLDHDSLTAMVTKMESG 244

Query: 239 -----FYAENLSILTAPAMLSRTYDFDE-KMIVPVLDILEQIFPLVILDVPHVWNSWTQE 292
                F+ EN    TA        DFD+ K I  +L +L +I+P VI+D+    +     
Sbjct: 245 LHVLGFFHEN----TAE-------DFDKAKEIGRLLPVLREIYPYVIIDLSRGVDRIFSA 293

Query: 293 VLTLSDKVVITTSLDLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDF 351
           V+  + KV + T  +LA ++N+  ++ +L  +     +   L++N+ +  K+  I + D 
Sbjct: 294 VVAPATKVFLITQQNLAAIKNTSRILRMLTFEYGVTREQIELIVNRYE--KRASIKLKDI 351

Query: 352 CAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQS 411
              +   P  +IP D  V   SAN G+   E    SAI   +V+FS        ++KP+ 
Sbjct: 352 EHTITGIPVFMIPNDYRVAIESANLGRPFVENKKNSAITRSIVEFSH------HIAKPEE 405

Query: 412 AMYTKIKKIFN 422
              + +KKIF+
Sbjct: 406 EKKSWLKKIFS 416


>gi|37680838|ref|NP_935447.1| Flp pilus assembly protein, ATPase CpaE [Vibrio vulnificus YJ016]
 gi|37199587|dbj|BAC95418.1| Flp pilus assembly protein, ATPase CpaE [Vibrio vulnificus YJ016]
          Length = 416

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 101/371 (27%), Positives = 177/371 (47%), Gaps = 41/371 (11%)

Query: 69  VSCFSDSSTPDLIIVQTKVD-SREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISN 127
           VS  +  + PDLI V+T  + +++VLS  E  A   D    +IV GD +D    +  +  
Sbjct: 70  VSGLTHVTPPDLIFVETGPNWAQKVLSLQEYEAPSDDFEASLIVFGDESDNGALKIALRL 129

Query: 128 HVSEYLIEPLSVADIINSISAI----FTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCA 183
             ++++ +   V D  + +  +    F+ +E G+        FI ++GG G+ST+A N A
Sbjct: 130 GAADFVSDKALVGDFFHLLKNVSDEKFSSRELGELHL-----FINTKGGCGASTLALNTA 184

Query: 184 FSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDK----AFVSRLPV- 238
             IA     + LL D+D+P+G  +   +  P  S++D I     +D     A V+++   
Sbjct: 185 LEIAGSHPGKVLLLDVDIPFGVISEYLNISPQYSLTDVIEHSKDLDHDSLTAMVTKMESG 244

Query: 239 -----FYAENLSILTAPAMLSRTYDFDE-KMIVPVLDILEQIFPLVILDVPHVWNSWTQE 292
                F+ EN    TA        DFD+ K I  +L +L +I+P VI+D+    +     
Sbjct: 245 LHVLGFFHEN----TAE-------DFDKAKEIGRLLPVLREIYPYVIIDLSRGVDRIFSA 293

Query: 293 VLTLSDKVVITTSLDLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDF 351
           V+  + KV + T  +LA ++N+  ++ +L  +     +   L++N+ +  K+  I + D 
Sbjct: 294 VVAPATKVFLITQQNLAAIKNTSRILRMLTFEYGVTREQIELIVNRYE--KRASIKLKDI 351

Query: 352 CAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQS 411
              +   P  +IP D  V   SAN G+   E    SAI   +V+FS        ++KP+ 
Sbjct: 352 EHTITGIPVFMIPNDYRVAIESANLGRPFVENKKNSAITRSIVEFSH------HIAKPEE 405

Query: 412 AMYTKIKKIFN 422
              + +KKIF+
Sbjct: 406 EKKSWLKKIFS 416


>gi|320155494|ref|YP_004187873.1| type II/IV secretion system ATPase TadZ/CpaE, associated with Flp
           pilus assembly [Vibrio vulnificus MO6-24/O]
 gi|319930806|gb|ADV85670.1| type II/IV secretion system ATPase TadZ/CpaE, associated with Flp
           pilus assembly [Vibrio vulnificus MO6-24/O]
          Length = 369

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 96/361 (26%), Positives = 173/361 (47%), Gaps = 21/361 (5%)

Query: 69  VSCFSDSSTPDLIIVQTKVD-SREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISN 127
           VS  +  + PDLI V+T  + +++VLS  E  A   D    +IV GD +D    +  +  
Sbjct: 23  VSGLTHVTPPDLIFVETGPNWAQKVLSLQEYEAPSDDFEASLIVFGDESDNGALKIALRL 82

Query: 128 HVSEYLIEPLSVADIINSISAI----FTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCA 183
             ++++ +   V D  + +  +    F+ +E G+        FI ++GG G+ST+A N A
Sbjct: 83  GAADFVSDKALVGDFFHLLKNVSDEKFSSRELGELHL-----FINTKGGCGASTLALNTA 137

Query: 184 FSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAEN 243
             IA     + LL D+D+P+G  +   +  P  S++D I     +D   ++ +       
Sbjct: 138 LEIAGSHPGKVLLLDVDIPFGVISEYLNISPQYSLTDVIEHSKDLDHDSLTAMVTKMESG 197

Query: 244 LSILTAPAMLSRTYDFDE-KMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVI 302
           L +L      +   DFD+ K I  +L +L +I+P VI+D+    +     V+  + KV +
Sbjct: 198 LHVL-GFFHENTAEDFDKAKEIGRLLPVLREIYPYVIIDLSRGVDRIFSAVVAPATKVFL 256

Query: 303 TTSLDLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSA 361
            T  +LA ++N+  ++ +L  +     +   L++N+ +  K+  I + D    +   P  
Sbjct: 257 ITQQNLAAIKNTSRILRMLTFEYGVTREQIELIVNRYE--KRASIKLKDIEHTITGIPVF 314

Query: 362 IIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIF 421
           +IP D  V   SAN G+   E    SAI   +V+FS        ++KP+    + +KKIF
Sbjct: 315 MIPNDYRVAIESANLGRPFVENKKNSAITRSIVEFSH------HIAKPEEEKKSWLKKIF 368

Query: 422 N 422
           +
Sbjct: 369 S 369


>gi|297581610|ref|ZP_06943532.1| flp pilus assembly protein, ATPase CpaE [Vibrio cholerae RC385]
 gi|297534017|gb|EFH72856.1| flp pilus assembly protein, ATPase CpaE [Vibrio cholerae RC385]
          Length = 379

 Score = 97.4 bits (241), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 91/333 (27%), Positives = 143/333 (42%), Gaps = 35/333 (10%)

Query: 60  ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS 119
           + +G I  A       S PD+++V    D   + S L  L + C   TK+IV+G   DVS
Sbjct: 36  VKKGDIQAATQWCLKQSAPDVLVVDGG-DCLHLESDLNGLVQSCSPQTKLIVLGQKQDVS 94

Query: 120 LYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIA 179
           LYR L+   +++Y   PL    +  S+  +   +       G  +  +GS GG G STIA
Sbjct: 95  LYRRLLFAGINDYHSTPLDANALRVSLLHLQGHKVAKSLRQGRIVCVLGSAGGCGVSTIA 154

Query: 180 HNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRID--------KA 231
            N  + +A     +  L DLDL +    I    D    + + ++   RID          
Sbjct: 155 ANLGYCLAERQKQQVALVDLDLFHSQHPILLGADYEPHLDNILHDARRIDATLLAHSSHQ 214

Query: 232 FVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQ 291
           F  RL +FY+++       + LS T   D K     + +L + +  VI+DVP + +    
Sbjct: 215 FSERLHLFYSQD-------SQLSLT---DIKQPAEAIRVLAEHYGTVIVDVPDLHHPAML 264

Query: 292 EVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY----LVLNQVKTPKK--PE 345
           EVL  +D  +  T   L+ LR        L KLR      +    L+ NQ +  K   P+
Sbjct: 265 EVLNNADSCIYVTDYSLSSLR-------YLAKLRVRQSGHHQRTLLLGNQCRHSKGRVPK 317

Query: 346 ISISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
           + IS      G+     +PFD  VF  +  + +
Sbjct: 318 LEIS---KAAGLDIGFELPFDAKVFEKAERTAQ 347


>gi|27378604|ref|NP_770133.1| hypothetical protein blr3493 [Bradyrhizobium japonicum USDA 110]
 gi|27351752|dbj|BAC48758.1| blr3493 [Bradyrhizobium japonicum USDA 110]
          Length = 481

 Score = 97.1 bits (240), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 94/366 (25%), Positives = 165/366 (45%), Gaps = 25/366 (6%)

Query: 21  ESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCF-SDSSTPD 79
           E+   L R  +  F V D L +   R  ++      N+ I RG+I  A+    +D+    
Sbjct: 94  EATSVLARNRIVCF-VNDELSAAALRKGLE----GSNISIRRGTIRNAIRMLETDTDISA 148

Query: 80  LIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSV 139
           L+   + +D  +  + LE LA VC    +V++IG++ +++ YR L+   ++EYL +P++ 
Sbjct: 149 LVTDISGID--DPFAELERLAGVCPPDVRVVLIGESREITFYRELMELGLTEYLPKPITR 206

Query: 140 ADIINSIS-------AIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAM 192
             +++ +        A   P   G       IS  G++GG G+++IA N A  +A     
Sbjct: 207 DMVLDQLRPKLLGDVAHSQPDRGGH-----VISICGAQGGAGATSIAINLALQLAETTKA 261

Query: 193 ETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAM 252
           +  L DL L  G   +     P   +  A+    R D  F+ R  +   E + +++A   
Sbjct: 262 KVALLDLHLQAGETAVMLGVRPGPGLRIALENPMRADTLFLERAAIEVNERVCLISADEE 321

Query: 253 LSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLR 312
           L    D  E  +  VL +L Q F  +++DVP  +      V+TLS  V++    ++ GLR
Sbjct: 322 LDAQLDITEAGVRHVLGLLRQRFNYIVVDVPVPFPPSIHPVITLSRHVLVLLEAEVTGLR 381

Query: 313 NSKNLIDVLKKLRPADKPPYLVLNQVKTPKK-PEISISDFCAPLGITPSAIIPFDGAVFG 371
           N+  L   +  +   D+  + +LN+   P   P  +I      LG  P  ++P  G    
Sbjct: 382 NAHALRAAVTNIAGKDR-VFTLLNRADRPGGLPRAAI---VKALGAEPDMVVPDLGKGMT 437

Query: 372 MSANSG 377
            + N G
Sbjct: 438 QAVNLG 443


>gi|209515953|ref|ZP_03264814.1| response regulator receiver protein [Burkholderia sp. H160]
 gi|209503611|gb|EEA03606.1| response regulator receiver protein [Burkholderia sp. H160]
          Length = 405

 Score = 96.3 bits (238), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 91/358 (25%), Positives = 155/358 (43%), Gaps = 5/358 (1%)

Query: 63  GSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYR 122
           G+I +A+    +   P   ++     S   LS L  LA+VC     V+VIGD NDV LYR
Sbjct: 50  GNIDDAIRLLQNLPRPPSQLLVDVSGSDMPLSDLARLADVCAPSVAVVVIGDRNDVGLYR 109

Query: 123 ALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNC 182
           +L+   + +YL++P++V  ++ ++SA   P  + +  +G  ISF+G+RGGVG +TIA + 
Sbjct: 110 SLLEIGIQDYLVKPVTVELLLRALSA-RDPSAQVR--TGKVISFVGARGGVGLTTIAVSL 166

Query: 183 AFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAE 242
           A  +A       +  DL+L  G A         N ++D +     ID   + R  V   E
Sbjct: 167 ARHLADETLRHVVYVDLNLHGGAAVSMLGLPASNGLTDLLQDTRSIDPQALDRAVVAAGE 226

Query: 243 NLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVI 302
            L  L++       +      +  ++  L++ F  V+LD+P       +E L  S  V I
Sbjct: 227 RLYTLSSELPYETEFAVLPGALAELISTLKRRFHYVLLDLPARSGGSVEEALDASQVVCI 286

Query: 303 TTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAI 362
                +   R    L+   +  R  +    ++LN    P    +   DF   +G      
Sbjct: 287 VADPSVYAARECMRLLRFTED-RSGEPVISVLLNNQLEPVADRVQPLDFKRAIGRAVVHE 345

Query: 363 IPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVT-VSKPQSAMYTKIKK 419
           +P+D      + N G+ +         A  +   +  L GR +    P  A   K+++
Sbjct: 346 LPYDPKPLARAENLGEPVGARGNPQGFAAAIERVASSLTGRESPAPAPWHARLFKMRR 403


>gi|302391030|ref|YP_003826850.1| response regulator receiver protein [Acetohalobium arabaticum DSM
           5501]
 gi|302203107|gb|ADL11785.1| response regulator receiver protein [Acetohalobium arabaticum DSM
           5501]
          Length = 405

 Score = 95.9 bits (237), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 86/358 (24%), Positives = 168/358 (46%), Gaps = 17/358 (4%)

Query: 78  PDLIIVQTKVDSREVLSALEPLA-EVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEP 136
           PD+I++   +   + + A E +  EV ++   ++ + +  D  L +A+++    EYLI+P
Sbjct: 51  PDIILMDINMPKIKGIKATEIITREVPETSIIMMSVQEEQDY-LRKAMVAG-AREYLIKP 108

Query: 137 LSVADIINSISAIFTPQEEGKGSSGCS------------ISFIGSRGGVGSSTIAHNCAF 184
            S  ++I +I+ ++  + E K S   S            IS   S+GGVG + +A N A 
Sbjct: 109 FSDDELITAINQVYDLEVERKSSLKQSREETEEAVEEKTISIFSSKGGVGKTLLATNLAV 168

Query: 185 SIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENL 244
            +      + +L DLDL +G  ++  D  P  +I+DA+  +  ++   +    + Y   L
Sbjct: 169 YLQQNKKGDVVLVDLDLQFGDLDVLLDLTPRITIADAVDELDNLNVQNIDDYLLSYENGL 228

Query: 245 SILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITT 304
            +L +P         + + I  +L IL + F  VI+D    ++      L  S+ +++  
Sbjct: 229 QVLASPLRPEEAEMINGEQIKKLLSILSEKFNYVIIDTAQSFSEHILAALDNSELILLIA 288

Query: 305 SLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIP 364
            LDL+ +RN +  ++V+++L   ++   L+LN  +  K   ISI D    L  +    IP
Sbjct: 289 MLDLSTIRNVRLCLEVMEELEYPEESIKLILN--RYSKDIGISIEDLEENLNYSVDIKIP 346

Query: 365 FDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFN 422
            +G++   S N G      +P++ I+  L+  + ++ G     + +   + KI    N
Sbjct: 347 SNGSLTIDSINQGVPFILEEPRAKISKQLIKLTDLVTGEELKPEDKEGWFNKITDFLN 404


>gi|46203210|ref|ZP_00051874.2| COG4963: Flp pilus assembly protein, ATPase CpaE [Magnetospirillum
           magnetotacticum MS-1]
          Length = 142

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/125 (36%), Positives = 77/125 (61%)

Query: 290 TQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISIS 349
           T+ VL  +D+++I  + DLA LRN K L+ + ++ RP D    +VLN V  PK+PEI+ +
Sbjct: 5   TRRVLIGADEILIVAAPDLASLRNVKYLLALFQQQRPNDTRARVVLNGVGVPKRPEIAAA 64

Query: 350 DFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKP 409
           +F   L +   A+IPFD A+FG +AN+G+MI EV   S  A++  + +  + GR  + + 
Sbjct: 65  EFAKALDVPLQAVIPFDPALFGTAANNGQMIAEVQAGSKAADIFSELAATVTGRAEIRRA 124

Query: 410 QSAMY 414
           +  ++
Sbjct: 125 RPNLF 129


>gi|258627499|ref|ZP_05722280.1| Flp pilus assembly protein, ATPase CpaE [Vibrio mimicus VM603]
 gi|258580305|gb|EEW05273.1| Flp pilus assembly protein, ATPase CpaE [Vibrio mimicus VM603]
          Length = 405

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 93/357 (26%), Positives = 171/357 (47%), Gaps = 13/357 (3%)

Query: 69  VSCFSDSSTPDLIIVQTKVD-SREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISN 127
           VS  +  + PDLI V+T  + +++VL+  E  A   D    +IV GD +D    +  +  
Sbjct: 59  VSGLTHLTPPDLIFVETGPNWAQKVLALQEYEAPSDDFEASLIVFGDEDDNGALKIALRL 118

Query: 128 HVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIA 187
             ++++ +   + D  + +  + + ++      G    FI ++GG G+ST+A N A  IA
Sbjct: 119 GAADFVSDKAMMNDFFHLLKNV-SEEKLASRELGELHLFINTKGGCGASTLALNTALEIA 177

Query: 188 SVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSIL 247
           +    + LL DLD+P+G  +      P  S++D I     +D   +S +       L +L
Sbjct: 178 ASHPGKVLLLDLDIPFGVISEYLSITPQYSLTDVIEHAKDLDHDSLSAMVTKMDNGLHVL 237

Query: 248 TAPAMLSRTYDFDE-KMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSL 306
                 + T DFD+ + I  +L IL +I+P V++D+    +     V+  + KV +    
Sbjct: 238 -GFFHENTTEDFDKAREIGRLLPILREIYPYVVIDLSRGVDRIFSAVVAPATKVFLVAQQ 296

Query: 307 DLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPF 365
           +LA ++N+  ++ +L  +   A +   L++N+ +  K+  I+I D    +      +IP 
Sbjct: 297 NLAAIKNTSRILRLLTLEYGVAKEQIELIINRYE--KRASINIKDIEKTIAGISVFMIPN 354

Query: 366 DGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFN 422
           D  V   SAN G+ I      +AI   +VDFS        ++ P++   T  KK+F+
Sbjct: 355 DYRVAIESANLGRPIVMYKKNTAITRSIVDFSH------HIALPEAEKKTWFKKLFS 405


>gi|262171237|ref|ZP_06038915.1| type II/IV secretion system ATPase TadZ/CpaE associated with Flp
           pilus assembly [Vibrio mimicus MB-451]
 gi|261892313|gb|EEY38299.1| type II/IV secretion system ATPase TadZ/CpaE associated with Flp
           pilus assembly [Vibrio mimicus MB-451]
          Length = 369

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 93/357 (26%), Positives = 170/357 (47%), Gaps = 13/357 (3%)

Query: 69  VSCFSDSSTPDLIIVQTKVD-SREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISN 127
           VS  +  + PDLI V+T  + +++VL+  E  A   D    +IV GD +D    +  +  
Sbjct: 23  VSGLTHLTPPDLIFVETGPNWAQKVLALQEYEAPSDDFEASLIVFGDEDDNGALKIALRL 82

Query: 128 HVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIA 187
             ++++ +   + D  + +  + + ++      G    FI ++GG G+ST+A N A  IA
Sbjct: 83  GAADFVSDKAMMNDFFHLLKNV-SEEKLASRELGELHLFINTKGGCGASTLALNTALEIA 141

Query: 188 SVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSIL 247
                + LL DLD+P+G  +      P  S++D I     +D   +S +       L +L
Sbjct: 142 GSHPEKVLLLDLDIPFGVISEYLSITPQYSLTDVIEHAKDLDHDSLSAMVTKMDNGLHVL 201

Query: 248 TAPAMLSRTYDFDE-KMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSL 306
                 + T DFD+ + I  +L IL +I+P V++D+    +     V+  + KV +    
Sbjct: 202 -GFFHENTTEDFDKAREIGRLLPILREIYPYVVIDLSRGVDRIFSAVVAPATKVFLVAQQ 260

Query: 307 DLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPF 365
           +LA ++N+  ++ +L  +   A +   L++N+ +  K+  I+I D    +      +IP 
Sbjct: 261 NLAAIKNTSRILRLLTLEYGVAKEQIELIINRYE--KRASINIKDIEKTIAGISVFMIPN 318

Query: 366 DGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFN 422
           D  V   SAN G+ I      +AI   +VDFS        ++ P++   T  KK+F+
Sbjct: 319 DYRVAIESANLGRPIVMYKKNTAITRSIVDFSH------HIALPEAEKKTWFKKLFS 369


>gi|296121059|ref|YP_003628837.1| response regulator receiver [Planctomyces limnophilus DSM 3776]
 gi|296013399|gb|ADG66638.1| response regulator receiver [Planctomyces limnophilus DSM 3776]
          Length = 406

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 142/310 (45%), Gaps = 10/310 (3%)

Query: 107 TKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTP----QEEGKGSSGC 162
           T+V+VI  + + SL    + N   E+L  PL + D + +I  I         EG   S  
Sbjct: 79  TQVLVISSSTEGSLILQAMRNGAREFLNAPLKLDDFLAAIDRIQQAGGVRTSEGTVRSSQ 138

Query: 163 SISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAI 222
            I+  G  GG+G +++A N   ++AS  +    + DLDL  G A++  D  P  +I D  
Sbjct: 139 VIAVAGVSGGIGCTSLAVNLGCALASQPSASVAIIDLDLALGDADVWLDIIPDYTIQDVA 198

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDV 282
             + R+D A + R    +     +L  P  L        +++  V+ +L+  F  +++D+
Sbjct: 199 DNISRLDYALLKRSLTKHECGAFLLPRPVQLDDRISISPEVLRRVIALLKATFTHLVVDI 258

Query: 283 PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPK 342
              +       L ++D +++TT LDL  LRN+  L+          +   +V+N++   +
Sbjct: 259 SKSYGPSDLAALEVADMILLTTQLDLPSLRNTVRLLQFFSNHEGLSEKTRIVVNRIGL-E 317

Query: 343 KPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMG 402
             +IS++     LG    A IP D AV   + N+G  +    PKS +    +  ++ L  
Sbjct: 318 DSQISLTKALETLGREVFAQIPNDYAVMVEARNNGVPLIIQSPKSRLTKSFIQLAQQL-- 375

Query: 403 RVTVSKPQSA 412
              + KPQ++
Sbjct: 376 ---IEKPQAS 382


>gi|148658696|ref|YP_001278901.1| response regulator receiver protein [Roseiflexus sp. RS-1]
 gi|148570806|gb|ABQ92951.1| response regulator receiver protein [Roseiflexus sp. RS-1]
          Length = 416

 Score = 94.0 bits (232), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 83/348 (23%), Positives = 155/348 (44%), Gaps = 14/348 (4%)

Query: 63  GSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYR 122
           GS+A  V   +    PDL+IV   V+  E  SA+  +     S T  I +  + DV+  R
Sbjct: 38  GSVAAGV-LLAQQHRPDLVIVDRDVEQTE--SAIRQIFTQVPS-TLCIAVTPSADVTSLR 93

Query: 123 ALISNHVSEYLIEPLSVADIINSISAIFTPQEE--------GKGSSGCSISFIGSRGGVG 174
            L+     + +  P+  AD++NSI A+   + +        G   +G  +  I  +GGVG
Sbjct: 94  RLVMAGARDVIGRPIQHADLMNSIHAVIAAERDRVARSSAGGDRRNGRLVVVIAPKGGVG 153

Query: 175 SSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVS 234
           ++TIA N A ++  V      LAD+ L +G   ++ +    +++ D +     +D A   
Sbjct: 154 ATTIAANLAVALRQVTNTGVALADMGLQFGDVGVHLNIWSRHTLYDLVMHAYELDDALFE 213

Query: 235 RLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVL 294
           ++   ++  + +L AP  L    D   + +  V+  L +    V+ D     +  T+ +L
Sbjct: 214 KVLQAHSSGIKVLLAPHDLEMAGDISREAVAAVVHGLLERHTYVVCDTWSFLDEVTETLL 273

Query: 295 TLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAP 354
             +D V++ T+ ++  LR++K+ ++ + +         LVLN  + P    I++ D    
Sbjct: 274 EKADDVLVVTTPEVPALRHTKSFLEHISRNELTRGRITLVLN--RFPSVNGIALQDIQKH 331

Query: 355 LGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMG 402
           L     A IP +G     S N G  +    P+S      ++ +  + G
Sbjct: 332 LRYPVGANIPSEGQPITHSINRGVPVVMAHPQSWAGQSFLNLAAYVAG 379


>gi|262165917|ref|ZP_06033654.1| type II/IV secretion system ATPase TadZ/CpaE associated with Flp
           pilus assembly [Vibrio mimicus VM223]
 gi|262025633|gb|EEY44301.1| type II/IV secretion system ATPase TadZ/CpaE associated with Flp
           pilus assembly [Vibrio mimicus VM223]
          Length = 405

 Score = 94.0 bits (232), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 93/357 (26%), Positives = 169/357 (47%), Gaps = 13/357 (3%)

Query: 69  VSCFSDSSTPDLIIVQTKVD-SREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISN 127
           VS  +  + PDLI V+T  + +++VL+  E  A   D    +IV GD +D    +  +  
Sbjct: 59  VSGLTHLTPPDLIFVETGPNWAQKVLALQEYEAPSDDFEASLIVFGDEDDNGALKIALRL 118

Query: 128 HVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIA 187
             ++++ +   + D  + +  + + ++      G    FI ++GG G+ST+A N A  IA
Sbjct: 119 GAADFISDKAMMNDFFHLLKNV-SEEKLASRELGELHLFINTKGGCGASTLALNTALEIA 177

Query: 188 SVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSIL 247
           +    + LL DLD+P+G  +      P  S++D I     +D   +S +       L +L
Sbjct: 178 ASHPEKVLLLDLDIPFGVISEYLSITPQYSLTDVIEHAKDLDHDSLSAMVTKMDNGLHVL 237

Query: 248 TAPAMLSRTYDFDE-KMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSL 306
                 + T DFD+ + I  +L IL +I+P V++D+    +     V+  + KV +    
Sbjct: 238 -GFFHENTTEDFDKAREIGRLLPILREIYPYVVIDLSRGVDRIFSAVVAPATKVFLVAQQ 296

Query: 307 DLAGLRNSKNLIDVLKKLRPADKPPY-LVLNQVKTPKKPEISISDFCAPLGITPSAIIPF 365
           +LA ++N+  ++ +L       K    L++N+ +  K+  I+I D    +      +IP 
Sbjct: 297 NLAAIKNTSRILRLLTLEYGVSKEQIELIINRYE--KRASINIKDIEKTIAGISVFMIPN 354

Query: 366 DGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFN 422
           D  V   SAN G+ I      +AI   +VDFS        ++ P++   T  KK+F+
Sbjct: 355 DYRVAIESANLGRPIVMYKKNTAITRSIVDFSH------HIALPEAEKKTWFKKLFS 405


>gi|167894385|ref|ZP_02481787.1| putative CpaE protein [Burkholderia pseudomallei 7894]
          Length = 331

 Score = 93.2 bits (230), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 74/289 (25%), Positives = 126/289 (43%), Gaps = 6/289 (2%)

Query: 59  RITRGSIAEAVSCFSD-SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTND 117
           ++ RG I +A++   D S  P  ++V     +   LS L  LA+VCD    VIVIG+ ND
Sbjct: 45  QVARGGIDDAIALMRDLSHGPQHLLVDVS-GAAMPLSDLARLADVCDPSVNVIVIGERND 103

Query: 118 VSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSST 177
           V L+R+++   V +YL++PL+V  +  ++SA         G    +I F+G+RGGVG ++
Sbjct: 104 VGLFRSMLRIGVRDYLVKPLTVELVHRALSAADPNAAARAGK---AIGFVGARGGVGVTS 160

Query: 178 IAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLP 237
           IA   A  +A          D D   G A           + + +    R+D   + +  
Sbjct: 161 IAVALARHLADRTRRRVAYVDFDCHGGAACSMLGVVSNQGLVELLQNPQRLDAQLIHQAM 220

Query: 238 VFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLS 297
           V  ++ L +L+A         +    +  ++  L   F  V+LD+P        E L   
Sbjct: 221 VAQSDRLFVLSAELPYDSEAPWRAGAVAGLVGALRHQFHYVLLDLPERAGRLVDEALAAC 280

Query: 298 DKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEI 346
             V +     +   R +  L+    + R  D    L+LN  + P +  +
Sbjct: 281 ASVYVVADRSVHAAREAARLLH-HAQARDGDAHVSLILNNAQQPVRGRV 328


>gi|117621200|ref|YP_855993.1| hypothetical protein AHA_1455 [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117562607|gb|ABK39555.1| conserved hypothetical protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 377

 Score = 93.2 bits (230), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 87/361 (24%), Positives = 163/361 (45%), Gaps = 32/361 (8%)

Query: 52  RMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIV 111
           R+++V  R  RGS+AEA +       PD+++V+ + + + + + L  LAE C    ++++
Sbjct: 27  RLTEVETRQVRGSLAEARAHCLTQGAPDILLVEVE-NPQTLAADLAALAECCPPQMRLVL 85

Query: 112 IGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRG 171
           +G+  DV+L+R LIS  V +Y   PL    +   +  +           G  I  +G+ G
Sbjct: 86  LGERGDVTLFRWLISVGVDDYYPAPLDPDALRTGLLRLLGVPLATSLRKGRVICVVGAAG 145

Query: 172 GVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKA 231
           GVG+ST+A N A ++A +   +  L DL+L +    I    D             R+D  
Sbjct: 146 GVGTSTVAANLAMALADLHHRQVALLDLNLHHSRHPILLGSDYAPPGEQWWQATERLDGT 205

Query: 232 FVS--------RLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVP 283
            ++        RL +FY E   ++              + +V  ++++ + +  +I+DVP
Sbjct: 206 LLAHTAHQLGPRLFLFYDEGQQLV-----------LGAEQLVAAVNVMAEHYSTLIIDVP 254

Query: 284 HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN--QVKTP 341
            + +   Q +L  +D  +      L  LR    L+    +  PA +   LV N  + K  
Sbjct: 255 DLRSHALQALLQQADVAIWLHDFSLGALR----LLGQFPQGGPAQR-RLLVGNNCRGKEG 309

Query: 342 KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLM 401
           + P  ++   C   G   +A++P+D   F  +  +G+ +  +  KS +A  L   +  L+
Sbjct: 310 RVPAQALERVC---GQPHAAVLPYDHGAFVRAERAGQPL--IQQKSKLARALTSLAAELV 364

Query: 402 G 402
           G
Sbjct: 365 G 365


>gi|251789648|ref|YP_003004369.1| response regulator receiver protein [Dickeya zeae Ech1591]
 gi|247538269|gb|ACT06890.1| response regulator receiver protein [Dickeya zeae Ech1591]
          Length = 401

 Score = 93.2 bits (230), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 78/330 (23%), Positives = 153/330 (46%), Gaps = 6/330 (1%)

Query: 52  RMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIV 111
           R+ +  +++  G +A A      +  P ++++    +    L  +E L  +C  GT+VI 
Sbjct: 38  RLRRPGVQVHAGGLAAARQWCELNLPPQILLIDLDGEPWP-LPEMETLLAMCGPGTRVIA 96

Query: 112 IGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGK--GSSGCSISFIGS 169
           +G T DV LYRAL+   V++YL++P ++ D++++  A    Q+ G      G +++ +G+
Sbjct: 97  LGKTQDVDLYRALLQLGVTDYLVKPCTL-DLLSATLAKCDGQQSGPEYARMGRTVAVVGA 155

Query: 170 RGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRID 229
            GGVG+ST+A + A  ++    +   L D D  +G   +    D    ++ A+    ++D
Sbjct: 156 SGGVGASTVAASLARLMSLERHLPVALVDFDRRHGDQLLLQGMDDDAGLT-AVLDSEQLD 214

Query: 230 KAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSW 289
              + R  +     L +L     L    D D   ++ +   L ++F  VI D+P    + 
Sbjct: 215 TRLLQRAMLQVDTRLHLLAQKPQLGELPDVDPDAVLNLGGTLCRMFNQVIWDLPGYLPTG 274

Query: 290 TQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISIS 349
             +V++ +D  ++ T L +   RN + L+  +       +   LV NQ        +S +
Sbjct: 275 ALDVISCADLRILVTELTVQDARNVRRLVQAIGDESEGQR-LLLVHNQSHFSGNAPLSRA 333

Query: 350 DFCAPLGITPSAIIPFDGAVFGMSANSGKM 379
            F + +      ++P  GA  G S + G +
Sbjct: 334 QFESLIERPLDVVLPHAGAALGQSLSLGAL 363


>gi|325108091|ref|YP_004269159.1| response regulator receiver protein [Planctomyces brasiliensis DSM
           5305]
 gi|324968359|gb|ADY59137.1| response regulator receiver protein [Planctomyces brasiliensis DSM
           5305]
          Length = 401

 Score = 92.0 bits (227), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 88/345 (25%), Positives = 152/345 (44%), Gaps = 11/345 (3%)

Query: 75  SSTPDLIIVQTKVDSREVLSALEPLAEVCDS--GTKVIVIGDTNDVSLYRALISNHVSEY 132
            + PD+ +V   +DS +  +AL+ +A++        V+ +  + + SL    + N   E+
Sbjct: 48  QTQPDIALV--TLDSNQA-AALDTIAKLRQQVPACSVLAVSSSQEGSLILQAMRNGAQEF 104

Query: 133 LIEPLSVADIINSISAIFTPQEEGKGSSGCS----ISFIGSRGGVGSSTIAHNCAFSIAS 188
           L  PLS+ D + ++  +    + G           I+  G  GGVGS+ +A N A  +A 
Sbjct: 105 LGIPLSLEDFMMALERVRHSGQSGSDEDEVRDSKVITVAGVNGGVGSTCVAVNLACVLAH 164

Query: 189 VFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILT 248
                  L DLDL  G A++  D  P  +I D    + RID + + R    +   L +L 
Sbjct: 165 NPKNSVALIDLDLALGDADVWLDIIPDYTIQDVAENISRIDYSLLKRSLTKHDSGLFLLP 224

Query: 249 APAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDL 308
            P  L  T+    + +  V+ +L+  F  +I+DV   +N+     + +S+ V++ T +DL
Sbjct: 225 RPVNLDNTFHLGAEELRRVVALLKATFTHLIIDVSKSYNNMEMAAIGMSNHVMLVTQMDL 284

Query: 309 AGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGA 368
             LRN   LI     L        +VLN+       +IS +     +G      IP D A
Sbjct: 285 PCLRNVVRLIQYFDTLESIGDKLQVVLNRFGLSDN-QISYNKALDTIGREVFWKIPNDYA 343

Query: 369 VFGMSANSGKMIHEVDPKSAIANLLVDFS-RVLMGRVTVSKPQSA 412
               S N+G  +    PK+ +    V+ + ++  G V+  K  S 
Sbjct: 344 TMVESRNNGVPLIMQAPKAKLTRSYVEMAEKISEGEVSTEKESSG 388


>gi|303241712|ref|ZP_07328209.1| response regulator receiver protein [Acetivibrio cellulolyticus
           CD2]
 gi|302590713|gb|EFL60464.1| response regulator receiver protein [Acetivibrio cellulolyticus
           CD2]
          Length = 399

 Score = 91.3 bits (225), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/313 (23%), Positives = 142/313 (45%), Gaps = 13/313 (4%)

Query: 75  SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLI 134
            S PD++++   +   + + A E ++ +    T VI++    +    R  ++    ++L 
Sbjct: 47  ESRPDIVLMDINMPVMDGIKATEEIS-LNVPETAVIIMSVQGESEYLRKAMTAGAKDFLN 105

Query: 135 EPLSVADIINSISAIFTPQEEGKGSSGCS----------ISFIGSRGGVGSSTIAHNCAF 184
           +P S  D+I +I   +  + + +  S  +          I+   ++GGVG +T+A N A 
Sbjct: 106 KPFSSDDLITTILKTYDIESQRRQRSNVTKVKEEVKSKIITVFSTKGGVGKTTLASNLAV 165

Query: 185 SIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENL 244
           S+A        L DLDL +G   I  +    N+ISD I  + ++D   V    V +   +
Sbjct: 166 SMARTTKKRVALVDLDLQFGDIAIMLNASVKNTISDIIKEINQLDGDVVEDYLVTHFSGV 225

Query: 245 SILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITT 304
            +L AP             +  +L+ L+  +  +I+D    ++    + L +SD++++ +
Sbjct: 226 RLLPAPLKPEYAEYITASHVEKILNTLKDHYHYIIVDTSASFHETVLQALDMSDRILMLS 285

Query: 305 SLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIP 364
           +LDL  ++N K  +DV++ L    +   ++LN  K  ++  I   DF   L     A IP
Sbjct: 286 TLDLPTIKNVKAGLDVMETLHYPKEKINIILN--KASEQFGIKYKDFENTLKHQIWAYIP 343

Query: 365 FDGAVFGMSANSG 377
            D      SAN G
Sbjct: 344 EDSQTVITSANKG 356


>gi|148976659|ref|ZP_01813346.1| Flp pilus assembly protein [Vibrionales bacterium SWAT-3]
 gi|145964010|gb|EDK29268.1| Flp pilus assembly protein [Vibrionales bacterium SWAT-3]
          Length = 404

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 92/348 (26%), Positives = 166/348 (47%), Gaps = 15/348 (4%)

Query: 78  PDLIIVQTKVDSREVLSALEPLA-EVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEP 136
           PDLI V+      + +  L+    ++ +    ++V GD +D    +  +    S++L   
Sbjct: 67  PDLIFVEASGGWAQKMVDLQSYNLQLEEHDLSLVVFGDESDNGSLKIALRLGASDFLSHD 126

Query: 137 LSVADIINSISAIFTPQEEGKGSS-GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETL 195
           +S++ ++  +    T  E+ + SS G    FI ++GG+G++T+A N A  IAS    E L
Sbjct: 127 ISISGLLPLLKK--TAAEKIENSSYGEVFLFINTKGGMGATTLALNTAVEIASYHPDEVL 184

Query: 196 LADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSR 255
           L D+DL +G      +  P  SISDAI     +D   +S L   ++  L IL+     + 
Sbjct: 185 LLDIDLQFGVIPEYLNLSPSYSISDAIDSSNDLDDMSLSSLVNKHSSGLHILSFKHE-NN 243

Query: 256 TYDFDE-KMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNS 314
             D++  + I  +L +L + +  +I+D     +      ++ + KV++ T   L  ++NS
Sbjct: 244 ADDYEHAQKIGKLLPVLRRFYRYIIIDFSRGLDHIFASAISPATKVLLVTQQTLVSVKNS 303

Query: 315 KNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMS 373
             LI  LK +         +++N+ +  K+  I +SD    +G     ++P D  V   S
Sbjct: 304 NRLIRTLKFEYGLQQDSIEIIVNRYE--KRQTIKLSDIEQTVGKHDIHVMPNDFKVALES 361

Query: 374 ANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIF 421
           AN G+ + E   KS+I   ++D S +L      S P+    + +KKIF
Sbjct: 362 ANLGQPLVESKKKSSITRSIIDLSHIL------SPPEQEEKSWLKKIF 403


>gi|253996764|ref|YP_003048828.1| response regulator receiver protein [Methylotenera mobilis JLW8]
 gi|253983443|gb|ACT48301.1| response regulator receiver protein [Methylotenera mobilis JLW8]
          Length = 391

 Score = 90.9 bits (224), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 86/340 (25%), Positives = 154/340 (45%), Gaps = 9/340 (2%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPL 137
           PDL+I+ +       LS LE ++   +    +++  + +   L  A+ S  V + L  PL
Sbjct: 48  PDLMIIDSICVENGNLSILEGISLRSNHMAIILLSQNASSEFLMTAMRSG-VKDVLSLPL 106

Query: 138 SVADIINSISAIFTP--QEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETL 195
             +D+  +++ +     Q   K   G  I+F+GS+GG G++ +A N A+ +A    ++  
Sbjct: 107 QTSDLQAAVNRVELKLSQSSQKNKKGKVIAFVGSKGGSGATFLACNLAYILAETSNVKVA 166

Query: 196 LADLDLPYGTANINF-DKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLS 254
           L DL+L +G A +   D  P N+++D    + R+D +F+    V    N S+L AP    
Sbjct: 167 LLDLNLQFGDAVLFVNDHVPSNTLADVAKNIRRLDASFLKSSMVHILPNFSVLAAPEDAE 226

Query: 255 RTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNS 314
              D   + I  +L +    F  V++D+    N+   + L  +D + I     L  +R+S
Sbjct: 227 SAQDVKPEHIDALLKLTTSEFDFVVMDIGRTLNATGVKALDYADLIFIVLQETLPFIRDS 286

Query: 315 KNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSA 374
           K L+     L  A +   ++LN  +  K  +I + D    LG+     IP        S 
Sbjct: 287 KRLLHAFHSLGYAKEKINIMLN--RHEKGGDIRLIDVETALGMKVYKTIPNSYLAVSASV 344

Query: 375 NSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMY 414
           N G  I ++    A+   L + +  L   V VSK + + +
Sbjct: 345 NQGVPILKIAKHDAVTKALQEVAESL---VEVSKAKKSGW 381


>gi|84387240|ref|ZP_00990261.1| Flp pilus assembly protein [Vibrio splendidus 12B01]
 gi|84377887|gb|EAP94749.1| Flp pilus assembly protein [Vibrio splendidus 12B01]
          Length = 406

 Score = 90.9 bits (224), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 97/400 (24%), Positives = 188/400 (47%), Gaps = 20/400 (5%)

Query: 28  RISVHVFCV--TDTLYSVVERSKIDPRMSQVNMRITRGSI-AEAVSCFSDSSTPDLIIVQ 84
           R ++ V+ V  TD  +S + +     R    N+ +T  S+ A +      +  P+LI V+
Sbjct: 20  RTNLKVWLVYSTDAFHSHMSQELKKCR----NVHVTSFSLGAMSEEYLKSADVPELIFVE 75

Query: 85  TKVDSREVLSALEPL-AEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADII 143
              +  + +  L+     + D    ++V+GD +D    +  +    S++L   ++++D++
Sbjct: 76  ANGNWAQKMVELQGYDLSLEDKDLSLVVLGDESDNGSLKIALRLGASDFLSHHVTLSDLL 135

Query: 144 NSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPY 203
             +    + + E   S G  I F+ ++GG+G++T+A N A  +A+    E LL D+DL +
Sbjct: 136 PLLKKTASEKLEN-SSYGEFILFLNTKGGMGATTLALNTAIEMATQHPNEVLLLDIDLQF 194

Query: 204 GTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDE-K 262
           G      +  P  S+SDAI     +D+  +  L   +   L +L+     +   DF++ +
Sbjct: 195 GVIPDYLNIAPTYSVSDAINSSNDLDEMSLGSLVNKHESGLHVLSFKHE-NNADDFEQAQ 253

Query: 263 MIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK 322
            I  +L IL + +P VI+D+    +      ++ + KV++     L  ++N+  LI  LK
Sbjct: 254 KIGRLLPILRRFYPYVIIDLSRGLDHVFASAISPATKVLLVLQQSLVSVKNTSRLIKSLK 313

Query: 323 -KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIH 381
            +         ++LN+ +  K+  I + D    +G     ++P D  V   SAN G+ + 
Sbjct: 314 FEYGLQSDSIEVILNRYE--KRHSIKLKDIEQAVGNHDIHLMPNDFKVALESANLGQPLV 371

Query: 382 EVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIF 421
           +   KS+I   ++D S VL      S P+      +KK+F
Sbjct: 372 QSRKKSSITRSIIDLSHVL------SPPEQEEKGWLKKLF 405


>gi|296134296|ref|YP_003641543.1| response regulator receiver protein [Thermincola sp. JR]
 gi|296032874|gb|ADG83642.1| response regulator receiver protein [Thermincola potens JR]
          Length = 402

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 76/337 (22%), Positives = 158/337 (46%), Gaps = 15/337 (4%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPL 137
           PD+I++   +   + + A E ++ +    T +I+I    +V   R  ++    EY+++P 
Sbjct: 49  PDIILMDINMPGLDGIKATEAIS-LKYPKTSIIIISVQGEVEYVRRAMAAGAREYMVKPF 107

Query: 138 SVADIINSISAIFTPQEEGKGSSG-----------CSISFIGSRGGVGSSTIAHNCAFSI 186
           +  ++  +I  ++  + + K  +              I+   ++GGVG +TI  N A S+
Sbjct: 108 TSDELAGTIKNVYDFEMKRKIQAADPLKLMDNKDPQIITVFSTKGGVGKTTIVTNLAVSL 167

Query: 187 ASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSI 246
                 + ++ DLDL +G   +  +  P  +I++ I  +G +D   +    V ++  + +
Sbjct: 168 FHESRKKVVIVDLDLQFGDVAVMMNVIPKRTITELIQDIGSLDAETLESYLVPHSSGVRV 227

Query: 247 LTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSL 306
           L AP             +  +L+ L+Q +  +I+D P  ++  T   L +  ++++  SL
Sbjct: 228 LPAPTRPEYAELITAAHVEKILNTLKQKYDYIIVDTPPFFHETTLTALDICQQILLIVSL 287

Query: 307 DLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFD 366
           DL  ++N K  ++VL+ L    K   L+LN  ++  +  I  SD    LG+  +A IP D
Sbjct: 288 DLPTIKNVKLGLEVLESLHHKGKVK-LILN--RSSNEIGIKCSDMERSLGMKVAAHIPSD 344

Query: 367 GAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGR 403
           G V   + N G       P + I+  + + +++++ R
Sbjct: 345 GRVVVGAVNKGVPFVISQPGAKISQSVKELAQMIIKR 381


>gi|283852075|ref|ZP_06369349.1| response regulator receiver protein [Desulfovibrio sp. FW1012B]
 gi|283572465|gb|EFC20451.1| response regulator receiver protein [Desulfovibrio sp. FW1012B]
          Length = 389

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 79/340 (23%), Positives = 156/340 (45%), Gaps = 18/340 (5%)

Query: 96  LEPLAE-VCDSGTK-VIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQ 153
           LE +AE V   G + V +     D  +   L+   V E+  +P+S  ++  ++  +   +
Sbjct: 56  LEAVAEIVARRGDREVFLTAGAYDTEILMRLMRQGVREFFPQPVSHEEVRMALWRLKARR 115

Query: 154 EEGKGSSGCS----ISFIGSRGGVGSSTIAHNCAFSIASVFAMETL-LADLDLPYGTANI 208
           E   G  G      ++  G++GGVG++T+A N A +  +     T+ L D++LP+G A +
Sbjct: 116 ESRLGPRGSKQGRIVNVFGAKGGVGTTTLAVNLAAACLTHKPGATVALMDMNLPFGEAQL 175

Query: 209 NFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVL 268
             D  P     + +  + R+D  ++  +   +A  L +L  P+ L        + I  +L
Sbjct: 176 FLDIAPKYHWGEVLGNISRLDATYLMSVMSRHASGLYLLAPPSRLDDLQMATPENISRLL 235

Query: 269 DILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPA- 327
           D++ Q+F  V++D+    +  T +V+ +SD +V+    +LA L N +  +D ++      
Sbjct: 236 DLMRQVFDTVVIDLGMYLDEITLKVMDISDAIVLVGVQNLACLANVRRFLDNIRHAEAGL 295

Query: 328 DKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS 387
           D+   +V+N  +   + ++ + D    L +     +P D      + N GK + E  PK+
Sbjct: 296 DEKLKIVVN--RHLDESDLVVEDMEKALALPVFWRVPNDYKTTLSAINQGKTLLETAPKA 353

Query: 388 AIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMKCFS 427
            +   + D +R L        P+     + K +F +K  S
Sbjct: 354 PVTRSISDLARAL---APAPDPE-----RKKGLFGLKLLS 385


>gi|188586925|ref|YP_001918470.1| response regulator receiver protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179351612|gb|ACB85882.1| response regulator receiver protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 392

 Score = 87.8 bits (216), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 131/279 (46%), Gaps = 16/279 (5%)

Query: 66  AEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALI 125
            E     ++   PD+I++   +   + +SA+E L+ +       IVI    +   ++  +
Sbjct: 39  GEQAISMAEKMKPDIILIDINMPLVDGISAIESLS-LKAPQVAPIVISVQGEAEYFKKAM 97

Query: 126 SNHVSEYLIEPLSVADIINSISAIFTPQEEGKGS--------SGCS-----ISFIGSRGG 172
                +YL++P S  ++I++I  +   +EE +          SG        S   ++GG
Sbjct: 98  RAGARDYLVKPFSGDELISTIKEVVQKEEEVREKQMNEALLRSGIKHKPRIFSVFSAKGG 157

Query: 173 VGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAF 232
            G +T+A N A  ++     +T++ DLDL +G   I F+  P  +I+D +  +  +D   
Sbjct: 158 TGKTTLAANLASCLSKFHDKKTVIVDLDLQFGDIPIMFNITPQQTITDLLSNINELDSET 217

Query: 233 VSRLPVFYAE-NLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQ 291
           +  + + + E  + +L  P          ++ +  +L +L + +  +++D P  ++    
Sbjct: 218 LENVLIHHEETGVKLLCPPKNPEEAEYVSDEHVEEILRVLTETYEYILVDTPPAFSGHVL 277

Query: 292 EVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL-RPADK 329
             L  S K+ + T+LDL  ++N+KN I+++  L  P DK
Sbjct: 278 SALDQSHKIFLVTTLDLPSIKNAKNSINIMDNLGYPEDK 316


>gi|149176580|ref|ZP_01855193.1| probable pilus assembly protein CpaE [Planctomyces maris DSM 8797]
 gi|148844693|gb|EDL59043.1| probable pilus assembly protein CpaE [Planctomyces maris DSM 8797]
          Length = 403

 Score = 87.8 bits (216), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 78/318 (24%), Positives = 145/318 (45%), Gaps = 7/318 (2%)

Query: 109 VIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGS-----SGCS 163
           VIV+  + + SL    + N   E+L  PL + D +++++ I     + +G      S   
Sbjct: 81  VIVVSSSQEGSLILKAMRNGAKEFLGFPLVLEDFLSALNRIQITSGKSEGEHNAPRSSQV 140

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           I+  G  GGVG +++A N A  +AS       + DLDL  G  ++  D  P  +I D   
Sbjct: 141 ITVAGVSGGVGCTSLAINLACCLASQERNSVAVIDLDLALGDTDVWLDIIPDYTIQDVAE 200

Query: 224 PVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVP 283
            + R+D + + R    +A    +L  P  +  +     +++  ++ +L   F  +++DV 
Sbjct: 201 NIARLDYSLLKRSLTKHACGAFLLPRPVQMDMSMQITTEVLRRIIALLRATFTHLVIDVS 260

Query: 284 HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKK 343
             +NS     + LSD V++T  LDL  LRN   L           +   +V+N++   + 
Sbjct: 261 KSYNSLDLAAMELSDTVLLTAQLDLPCLRNVVRLSQFFDTNDHIAEKIKVVMNRLGL-ED 319

Query: 344 PEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGR 403
            +IS+S     +G      IP D A    S N+G  +    PK+ +   ++  +  + G 
Sbjct: 320 TQISVSKALETIGREIFCQIPNDYATMVESRNNGIPLVMQAPKAKLTRTIMGLAANVSGE 379

Query: 404 VTVSKPQSAMYTKIKKIF 421
            +V++ + ++  K K +F
Sbjct: 380 -SVAEQEDSVSRKKKSLF 396


>gi|218710401|ref|YP_002418022.1| Flp pilus assembly protein [Vibrio splendidus LGP32]
 gi|218323420|emb|CAV19597.1| Flp pilus assembly protein [Vibrio splendidus LGP32]
          Length = 404

 Score = 87.4 bits (215), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 89/369 (24%), Positives = 174/369 (47%), Gaps = 14/369 (3%)

Query: 57  NMRITRGSI-AEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPL-AEVCDSGTKVIVIGD 114
           N+ +T  S+ A +      +  P+LI V+   +  + +  L+     + +    ++V+GD
Sbjct: 45  NVHVTSFSLGAMSEEYLKSADVPELIFVEAHGNWAQKMVELQGYDLSLEEQDLSLVVLGD 104

Query: 115 TNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVG 174
            +D    +  +    S++L   ++++D++  +      + E   S G  I F+ ++GG+G
Sbjct: 105 ESDNGSLKIALRLGASDFLSHNVTLSDLLPLLKKTAAEKLEN-SSYGEFILFLNTKGGMG 163

Query: 175 SSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVS 234
           ++T+A N A  +AS    E LL D+DL +G      +  P  S+SDAI     +D+  + 
Sbjct: 164 ATTLALNTAIEMASQHPGEVLLLDIDLQFGVIPDYLNIVPTYSVSDAINSSNDLDEISLG 223

Query: 235 RLPVFYAENLSILTAPAMLSRTYDFDE-KMIVPVLDILEQIFPLVILDVPHVWNSWTQEV 293
            L   +   L +L+     +   DF++ + I  +L IL + +P VI+D+    +      
Sbjct: 224 TLVNKHESGLHVLSFKHE-NNADDFEQAQKIGRLLPILRRFYPYVIIDLSRGLDHVFASA 282

Query: 294 LTLSDKVVITTSLDLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDFC 352
           ++ + KV++     L  ++N+  LI  LK +         ++LN+ +  K+  I + D  
Sbjct: 283 ISPATKVLLVLQQSLVSVKNTSRLIKSLKFEYGLQSDSIEVILNRYE--KRHSIKLKDIE 340

Query: 353 APLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSA 412
             +G     ++P D  V   SAN G+ + +   KS+I   ++D S +L      S P+  
Sbjct: 341 QAVGKHDIHLMPNDFKVALESANLGQPLVQSRKKSSITRSIIDLSHIL------SPPEQE 394

Query: 413 MYTKIKKIF 421
               +KK+F
Sbjct: 395 EKGWLKKLF 403


>gi|147677785|ref|YP_001212000.1| response regulator [Pelotomaculum thermopropionicum SI]
 gi|146273882|dbj|BAF59631.1| response regulator [Pelotomaculum thermopropionicum SI]
          Length = 408

 Score = 86.7 bits (213), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 80/346 (23%), Positives = 156/346 (45%), Gaps = 22/346 (6%)

Query: 72  FSDSSTPDLIIVQTKVDSREVLSALEPLA-EVCDSGTKVIVIGDTNDVSLYRALISNHVS 130
            ++   PD++++   +   + + A E +A +V D  T V++I    +    R  ++    
Sbjct: 44  LAEELKPDVVLMDINLPGMDGIRASEAIATKVPD--TAVVIISIQGEPEYLRKAMAAGAR 101

Query: 131 EYLIEPLSVADIINSISAI-FTPQEEGKGSSGCSIS---------------FIGSRGGVG 174
           +YL++P S +D+  +I  + +T +     ++   +S                  S+GGVG
Sbjct: 102 DYLVKPFSSSDLAETIRRVNYTCKLRAARTAAPPVSGAPAESNAPPRKIILVFSSKGGVG 161

Query: 175 SSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVS 234
            + ++ N A S+A     +  L DL+L  G   +  +  P  +I++ +     ++ + V+
Sbjct: 162 KTVLSCNLAISLAQQCGKKVALVDLNLQGGDVTVMLNLSPRGTIAELVQEEDYLEYSLVN 221

Query: 235 RLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVL 294
              V +   L +L AP             +  +L +L+  +  V++D    +N      L
Sbjct: 222 SYLVPHMSGLKVLPAPLRPEHADVVAAAHVEDILTLLKNNYDFVVVDTSPFFNDINLSAL 281

Query: 295 TLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAP 354
             +D +++T + DL  ++++K  +D+L+ L  A K   LVLNQ  T +   I ISD    
Sbjct: 282 EKADDILLTFTKDLPAIKHAKTDLDILESLNLAGK-VKLVLNQ--TAQDYGIKISDIEKN 338

Query: 355 LGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
             I+ +A++P+D      S N G       P S IA  + + +R L
Sbjct: 339 FKISLAAVLPYDEKTVLTSVNKGHPFVLTQPNSKIAQSIKNLAREL 384


>gi|121534344|ref|ZP_01666168.1| response regulator receiver protein [Thermosinus carboxydivorans
           Nor1]
 gi|121307114|gb|EAX48032.1| response regulator receiver protein [Thermosinus carboxydivorans
           Nor1]
          Length = 402

 Score = 86.7 bits (213), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 73/355 (20%), Positives = 158/355 (44%), Gaps = 13/355 (3%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPL 137
           PD+I++   +   + + A E +       + +I+        L RA+I+    +YLI+P 
Sbjct: 51  PDIILMDINMPGMDGIVATEIITTEAPQTSIIIMSVQGEQEYLRRAMIAG-AKDYLIKPF 109

Query: 138 SVADIINSISAIFTPQEEGKG---------SSGCSISFIGSRGGVGSSTIAHNCAFSIAS 188
           +  +++ ++  ++   +               G  I+   ++GG+G +TIA N A ++A+
Sbjct: 110 TGDELVQAVKQVYNNAQRRHNVLKFEPKTVEPGKIITVFSTKGGIGKTTIATNLAVALAA 169

Query: 189 VFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILT 248
               +  + D DL +G   +  +  P  +I+D +     +D+  +      Y+E + +L 
Sbjct: 170 RTGAKVGIVDADLQFGDVALFLNVLPQATIADLVRDGDELDEKLLDSYLASYSEQVKVLA 229

Query: 249 APAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDL 308
           AP    +        +  +L  ++  F  +I+D    ++     VL  SD V++ +++DL
Sbjct: 230 APLRPEQAETVTAGHLAAILRTMKNSFKYIIVDTAPSFSDTMLTVLDASDLVLVVSAMDL 289

Query: 309 AGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGA 368
             ++N K  +++++ L   D    LVLN+     +  + + +    L     A +P DG 
Sbjct: 290 PTIKNVKLCLEIMESLGYTDDKFKLVLNRANA--ECGMDVREVEESLRYAFVATLPSDGK 347

Query: 369 VFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQ-SAMYTKIKKIFN 422
               S N G       P +A++  +   +R++      ++P+   +  KIK++F 
Sbjct: 348 TVVASVNRGVPFVVSHPDTAVSQSIFHLARIIASGDWKAEPEPRGVIHKIKRLFG 402


>gi|292491524|ref|YP_003526963.1| Flp pilus assembly protein ATPase CpaE-like protein [Nitrosococcus
           halophilus Nc4]
 gi|291580119|gb|ADE14576.1| Flp pilus assembly protein ATPase CpaE-like protein [Nitrosococcus
           halophilus Nc4]
          Length = 395

 Score = 86.3 bits (212), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 86/376 (22%), Positives = 167/376 (44%), Gaps = 20/376 (5%)

Query: 50  DPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKV 109
           DP  S++ +RI           +  +  PD++++       E L AL   A     G  +
Sbjct: 26  DP--SELQVRIHHMENGHTDPLYGITVQPDILVLVLSAAWEEELRALRTRA--ASQGLPM 81

Query: 110 IVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINS----ISAIFTPQEEGKGSSGCSIS 165
           I IG   +  + R  +     ++   P    +++ S    +  + +P   G+G      +
Sbjct: 82  IAIGPAGNTQVMRRAMQAGARDFFTHPAPPEELLASTLQIVKDLHSPAVTGQG---VLTA 138

Query: 166 FIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPV 225
            I    G G++ +A N A  +     ++  L D+DL +G   +  D +  NS+S+    V
Sbjct: 139 VINGTNGSGATFLACNIAHMMTVHSGIKVALMDMDLQFGNLPLYLDMNIRNSLSEVFAAV 198

Query: 226 GRIDKAFVSRLPVFYAENLSIL-TAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH 284
            ++D   +      +   L +L +A   +   ++  EK +  +LDI  Q +  V++D+P 
Sbjct: 199 DQLDGVALEGYMGKHPSGLHLLASASEQVLLPWEISEKDLNRLLDISLQTYEHVVVDLPR 258

Query: 285 VWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKK-LRPADKPPYLVLNQVKTPKK 343
             +S T  VL  +  V+I     L  +R++K L+ ++++ L   D+  Y+V+N  +   K
Sbjct: 259 QIDSLTSTVLERAHHVIIVMQESLTSIRDAKRLLQIVQRDLAVLDENIYVVVN--RHQDK 316

Query: 344 PEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGR 403
             IS++D    L I+   +IP D      S N+G  + E +  +AI   +++ +  L G 
Sbjct: 317 NAISLADLRDALKISSFLLIPNDFKRVMQSINTGVPLFESEKNAAITKAVLEVAVKLSG- 375

Query: 404 VTVSKPQSAMYTKIKK 419
               KPQ+     +++
Sbjct: 376 ----KPQTQSQNILRR 387


>gi|86147462|ref|ZP_01065774.1| Flp pilus assembly protein [Vibrio sp. MED222]
 gi|85834755|gb|EAQ52901.1| Flp pilus assembly protein [Vibrio sp. MED222]
          Length = 404

 Score = 86.3 bits (212), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 89/348 (25%), Positives = 164/348 (47%), Gaps = 15/348 (4%)

Query: 78  PDLIIVQTKVDSREVLSALEPL-AEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEP 136
           PDLI V+      + +  L+    ++ +    ++V GD +D    +  +    S++L   
Sbjct: 67  PDLIFVEASGGWAQKMVDLQSYNLQLEEHDLSLVVFGDESDNGSLKIALRLGASDFLSHD 126

Query: 137 LSVADIINSISAIFTPQEEGKGSS-GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETL 195
           +S++ ++  +    T  E+ + SS G    FI ++GG+G++T+A N A  IAS    E L
Sbjct: 127 ISISGLLPLLKK--TAAEKIENSSYGEVFLFINTKGGMGATTLALNTAVEIASYHPNEVL 184

Query: 196 LADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILT-APAMLS 254
           L D+DL +G      +  P  SISDAI     +D+  +  L   +   L +L+      +
Sbjct: 185 LLDIDLQFGVIPEYLNITPSYSISDAIDSSNDLDEMSLGSLVNKHTSGLHVLSFKHENNA 244

Query: 255 RTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNS 314
             Y+  +K I  +L +L + +  +I+D     +      ++ + KV++     L  ++NS
Sbjct: 245 DDYEHAQK-IGKLLPVLRRFYRYIIIDFSRGLDHIFASAISPATKVLLVAQQTLVSVKNS 303

Query: 315 KNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMS 373
             L+  LK +         +++N+ +  K+  I +SD    +G     ++P D  V   S
Sbjct: 304 NRLVRTLKFEYGLQQDAIEIIVNRYE--KRQTIKLSDIEQTVGKHDIHLMPNDFKVALES 361

Query: 374 ANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIF 421
           AN G+ + E   KS+I   ++D S +L      S P+    + +KKIF
Sbjct: 362 ANLGQPLVESKKKSSITRSIIDLSHIL------SPPEQEEKSWLKKIF 403


>gi|116748934|ref|YP_845621.1| response regulator receiver protein [Syntrophobacter fumaroxidans
           MPOB]
 gi|116697998|gb|ABK17186.1| response regulator receiver protein [Syntrophobacter fumaroxidans
           MPOB]
          Length = 389

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 85/375 (22%), Positives = 172/375 (45%), Gaps = 11/375 (2%)

Query: 36  VTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSA 95
           +T  L SVV   +  P  + +  R+ +     A+    DS   DL++++   +  +   A
Sbjct: 1   MTQDLISVVLDVRDTPTRAALE-RVLKSVPGFAIGNPDDSGPADLLVMEIGYEPEKEFHA 59

Query: 96  LEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAI-----F 150
           L+ L  +   G +V +     D  +    +     E+L +P+   +   S+         
Sbjct: 60  LQSLLSLGTVG-EVFLTSSKPDKDILVQALRAGAREFLSQPIQEKEFRQSLEKFIERRRL 118

Query: 151 TPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETL-LADLDLPYGTANIN 209
           + +E+    SG  IS +GS+GGVG++TIA N A SI     ++++ L D++L +G   + 
Sbjct: 119 SLKEKKTSKSGRIISLVGSKGGVGTTTIAVNLAGSIIRNDHLKSVALMDMNLLFGEIPLL 178

Query: 210 FDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLD 269
            D  P     +    + R+D  F+  +   ++  L +L++P+ L+  +     ++  +L 
Sbjct: 179 LDITPSYHWGEIARNITRLDATFLMSVLHQHSSGLYVLSSPSQLAGQHAATPDVMEQLLT 238

Query: 270 ILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL-RPAD 328
           ++ ++F  V++D     +  + +VL ++D V + + L L  L N   L+ +   L  P +
Sbjct: 239 LMRRVFDFVVIDAGQTADDVSLKVLEMADTVFLVSVLSLPCLANVNRLLRLFFDLGYPHE 298

Query: 329 KPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSA 388
               ++++  +  K  ++S+ D    L       IP D      S N GK++  V P+S 
Sbjct: 299 DNVKVIVS--RYVKNTDVSLKDAERSLNKKIFWTIPNDYKATMSSMNQGKVLSVVAPRSP 356

Query: 389 IANLLVDFSRVLMGR 403
           +   + D +  L+G+
Sbjct: 357 VTASIDDLAVTLLGK 371


>gi|118581111|ref|YP_902361.1| response regulator receiver protein [Pelobacter propionicus DSM
           2379]
 gi|118503821|gb|ABL00304.1| response regulator receiver protein [Pelobacter propionicus DSM
           2379]
          Length = 373

 Score = 85.5 bits (210), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 132/295 (44%), Gaps = 6/295 (2%)

Query: 109 VIVIGDTNDVSLYRALISNHVSEYLIEPL---SVADIINSISAIFTPQEEGKGSSGCSIS 165
           V V  D N       L+     EYL  PL   ++ D I  +  I+ P  +     G  I+
Sbjct: 81  VFVTADNNTTEWVLGLMRAGAIEYLFHPLQTSALRDAIQKVGRIWMPMSDNVKQKGKVIT 140

Query: 166 FIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPV 225
                GG+G++TIA N A  +A+  A    L DL+L  G      + +P  ++S     +
Sbjct: 141 VYNPLGGMGTTTIAVNLATCLATESA-NVALIDLNLFSGDVATFLNINPTYTLSSVTKNI 199

Query: 226 GRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHV 285
            R+D  F++ +   +   +S+LT P  +  + +   + +  +L +L ++F  VI+D    
Sbjct: 200 SRLDSNFLASVMTQHPLGMSVLTEPLEVDESSEVTPEQLTRILHVLSEMFAYVIIDTGGH 259

Query: 286 WNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPE 345
                  V   SD ++ TT ++L GL+N+K  +   ++         L++N  +   + +
Sbjct: 260 IVGGNVSVFESSDHILYTTVMNLPGLKNTKRYVASFERKGFQRGKVKLIVN--RYIPRAD 317

Query: 346 ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
           ISI D    L       IP +      S N G  I ++ P+SA++  +V  + +L
Sbjct: 318 ISIEDAQKVLDWKVFHTIPNEYKDVVESINKGVPIVKLYPRSAVSKAIVQLAELL 372


>gi|253687070|ref|YP_003016260.1| response regulator receiver protein [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251753648|gb|ACT11724.1| response regulator receiver protein [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 399

 Score = 85.5 bits (210), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 84/358 (23%), Positives = 154/358 (43%), Gaps = 16/358 (4%)

Query: 29  ISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVD 88
           +++ +    + +  V + S +  R+ Q ++ +  G IA A      +  P +++V  +  
Sbjct: 12  LALPLVAFANDVRDVADISDLFTRLKQPDVPVMSGGIAAARQWCELNVPPRILLVDLE-G 70

Query: 89  SREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISA 148
           +   L ALE L  VC   ++VI  G   DV LYRAL+   V +YL++P ++ D++ +  A
Sbjct: 71  AHWPLPALEELLSVCGPTSQVIATGKEQDVGLYRALLQAGVVDYLVKPFTL-DLLAATLA 129

Query: 149 IFTPQEEGK--GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTA 206
               Q+ G      G +I+ +G+ GG G+ST+A   +  ++    +   L D D      
Sbjct: 130 KCEGQQAGPEYARMGRTIAVVGASGGSGASTVAMGLSRLLSGERHLPVALVDFD------ 183

Query: 207 NINFDKDPINSISD-----AIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDE 261
             N D+  +   +D     A+     +D   + R  +     L +L     L      D 
Sbjct: 184 RRNGDQLLLQGQTDDAGLAAVLETQELDTRLLQRAMLRVDTRLHLLAQKPELGELSPVDV 243

Query: 262 KMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL 321
             ++ +   L ++F  VI D+P  + +   +VLT +D  +I T L L   RN + +++ +
Sbjct: 244 DNVLNLGGALCRMFNQVIWDLPSSYPTGALDVLTYADLRIIVTELTLQDARNVRRVLNEI 303

Query: 322 KKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKM 379
                  +   LV NQ +      +S   F    G     ++P  G     S   G +
Sbjct: 304 GDESEGQR-LLLVHNQSRFASTAPLSREQFEQFTGRNIDVVLPNAGHALSQSLTLGAL 360


>gi|91788416|ref|YP_549368.1| response regulator receiver domain-containing protein [Polaromonas
           sp. JS666]
 gi|91697641|gb|ABE44470.1| response regulator receiver domain protein (CheY-like) [Polaromonas
           sp. JS666]
          Length = 387

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/338 (22%), Positives = 157/338 (46%), Gaps = 6/338 (1%)

Query: 67  EAVSCFSDSSTPDLIIV-QTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALI 125
           E ++  +D S+PD++++ Q  V+  + L  LE L+ +      +++        L +A+ 
Sbjct: 37  EKLAGIADLSSPDVLVLDQPSVEGGD-LERLERLSHLYPRMAFILLCQQKTPEFLIQAMR 95

Query: 126 SNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFS 185
           +  V E L  P+  ++++ +I  +    E    ++G  ++F+  +GG G++ +A N  ++
Sbjct: 96  AG-VREVLPSPVDASELVPAIERVEQKLESSAQANGQVLAFVSCKGGSGATFLATNLGYA 154

Query: 186 IASVFAMETLLADLDLPYGTANINF-DKDPINSISDAIYPVGRIDKAFVSRLPVFYAENL 244
           +A        L DL+L +G A++   D+ P  ++S+    + R+D +F +   +    N 
Sbjct: 155 LAVQEKKRVALIDLNLQFGDASLFVSDQKPQVTLSEVCQQIHRLDPSFFASSMLSIEPNY 214

Query: 245 SILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITT 304
            +L AP   +       + I  +L +  + +  ++LD+    ++ +   L  +D +    
Sbjct: 215 GVLAAPEDPTHASYVKPEHIDLILKLARRHYDFILLDMGRSLDAVSIRALDQADMIFPIL 274

Query: 305 SLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIP 364
              L  +R+ K L++V + L       +L++N  +  K  EI   D  A  G+     IP
Sbjct: 275 QTTLPFIRDGKRLLNVFRSLDYRKDKIHLIVN--RHEKNGEIRRQDLEAAYGMEVYRSIP 332

Query: 365 FDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMG 402
                   S N G  I ++   S ++  L +F+R L+G
Sbjct: 333 NHYEAAAASVNQGVPILKLAKNSPVSKALQEFARSLVG 370


>gi|77919349|ref|YP_357164.1| Flp pilus assembly ATPase CpaE [Pelobacter carbinolicus DSM 2380]
 gi|77545432|gb|ABA88994.1| Flp pilus assembly ATPase CpaE [Pelobacter carbinolicus DSM 2380]
          Length = 392

 Score = 84.7 bits (208), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 78/307 (25%), Positives = 143/307 (46%), Gaps = 13/307 (4%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLY-RALISNHVSEYLIEP 136
           PD+I++    D   + + L+ + +  +     + +  TN    +   ++   VSEYL+ P
Sbjct: 51  PDIILLDDTTDGTSIFNRLQLIRQ--NFPHAAVFVTSTNQFPQHIVEVMKAGVSEYLVTP 108

Query: 137 LSVADIINSISAI-FTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETL 195
           ++   + N++  +       G+ S G   SFI S+GG+GS+ +A N A ++A        
Sbjct: 109 INDKVLKNAVEDVRLKLASMGQVSRGSIYSFISSKGGLGSTVLAVNTACALAKHKESRIA 168

Query: 196 LADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSR 255
           L D+ +  G A +  D  P  ++SD +    R+D +F+      +A  L  + AP   + 
Sbjct: 169 LFDMSIQSGDATVLLDLYPQTTMSDIVRNYHRLDSSFLLAAMTKHASGLEFMAAP---NN 225

Query: 256 TYDFD---EKMIVPVLDILEQIFPLVILDVPHV-WNSWTQEVLTLSDKVVITTSLDLAGL 311
             D+D    + +  VLD+  +I+  V++D   +  N    E+  +S+ V + T + +  +
Sbjct: 226 PEDYDLIKTEHVSQVLDLARKIYDQVVVDCTSMSINDSNIEIFKMSEVVFLVTDMSVPAI 285

Query: 312 RNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFG 371
           RN   LI +L+KL   D    +V+N+    K   +S+SD    LG     + P D     
Sbjct: 286 RNCARLIKLLQKLGIDDNHIEVVVNRF--IKGGSLSLSDVEKNLGKKVFWLFPNDFKGVV 343

Query: 372 MSANSGK 378
            S N G+
Sbjct: 344 ASINKGE 350


>gi|167911031|ref|ZP_02498122.1| putative CpaE protein [Burkholderia pseudomallei 112]
          Length = 303

 Score = 84.0 bits (206), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 110/247 (44%), Gaps = 5/247 (2%)

Query: 59  RITRGSIAEAVSCFSD-SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTND 117
           ++ RG I +A++   D S  P  ++V     +   LS L  LA+VCD    VIVIG+ ND
Sbjct: 51  QVARGGIDDAIALMRDLSHGPQHLLVDVS-GAAMPLSDLARLADVCDPSVNVIVIGERND 109

Query: 118 VSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSST 177
           V L+R+++   V +YL++PL+V  +  ++SA         G    +I F+G+RGGVG ++
Sbjct: 110 VGLFRSMLRIGVRDYLVKPLTVELVHRALSAADPNAAARAGK---AIGFVGARGGVGVTS 166

Query: 178 IAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLP 237
           IA   A  +A          D D   G A           + + +    R+D   + +  
Sbjct: 167 IAVALARHLADRTRRRVAYVDFDCHGGAACSMLGVVSNQGLVELLQNPQRLDAQLIHQAM 226

Query: 238 VFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLS 297
           V  ++ L +L+A         +    +  ++  L   F  V+LD+P        E L   
Sbjct: 227 VAQSDRLFVLSAELPYDSEAPWRAGAVAGLVGALRHQFHYVLLDLPERAGRLVDEALAAC 286

Query: 298 DKVVITT 304
             V +  
Sbjct: 287 ASVYVVA 293


>gi|82703472|ref|YP_413038.1| response regulator receiver domain-containing protein [Nitrosospira
           multiformis ATCC 25196]
 gi|82411537|gb|ABB75646.1| response regulator receiver domain protein (CheY-like)
           [Nitrosospira multiformis ATCC 25196]
          Length = 412

 Score = 83.6 bits (205), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 78/343 (22%), Positives = 156/343 (45%), Gaps = 18/343 (5%)

Query: 67  EAVSCFSDSSTPDLIIVQTKVDSREVLSALEPL-AEVCDSGTKVIVIGDTNDVSLYRALI 125
           + V+  ++   PDL++++ +  S   L  L  + +   D G  V+++       L   ++
Sbjct: 63  QQVAAVAEQEQPDLLMLEGQYFSSMELETLNRVTSRFPDVG--VVMLCPAQPPELLIEVM 120

Query: 126 SNHVSEYLIEPLSVADIINSISAIFT-------PQEEGKGSSGCSISFIGSRGGVGSSTI 178
              V E L  PL+   +I+++            P  E K      ++FI  +GG G++ +
Sbjct: 121 RAGVREVLPTPLTRHGVIDAVERFQQRIALSRMPMHECK-----VLAFIPCKGGSGATFL 175

Query: 179 AHNCAFSIASVFAMETLLADLDLPYGTANINF-DKDPINSISDAIYPVGRIDKAFVSRLP 237
           A N A+++A+       L D +L +G A++   D  P  SI+D    + R+D +F++   
Sbjct: 176 ATNIAYALAAQENKRVALFDFNLQFGDASLFVQDGPPATSIADVARQIQRLDGSFLNSSM 235

Query: 238 VFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLS 297
           +    N  +L AP    +  +   + I P+  +  + +  VILDV    ++ + + L  +
Sbjct: 236 IQVLPNFGMLAAPESPEKAAEIRSEHINPLFQVAMKHYDFVILDVGRELDAISIQALDRA 295

Query: 298 DKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGI 357
           D +       L  +R+++ +      L   D+   L++N+ K  K  +I++ D  + L +
Sbjct: 296 DLIFPVLQQTLPSIRDARRMSAAFAALNYPDEKIRLIVNRYK--KNADITLDDIESTLNL 353

Query: 358 TPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
               ++P D AV   S N G    ++ P+S +A  L + +  L
Sbjct: 354 KIFKVVPNDYAVVTGSVNQGIPATKLAPRSPVAKSLQEIAHEL 396


>gi|323702115|ref|ZP_08113783.1| response regulator receiver protein [Desulfotomaculum nigrificans
           DSM 574]
 gi|323532997|gb|EGB22868.1| response regulator receiver protein [Desulfotomaculum nigrificans
           DSM 574]
          Length = 409

 Score = 83.6 bits (205), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 82/354 (23%), Positives = 155/354 (43%), Gaps = 19/354 (5%)

Query: 63  GSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYR 122
           G   EAV+  ++S  PD+I++   + + + + A E +   C     +IV     +  L R
Sbjct: 36  GDGEEAVA-LANSLKPDVILMDINMPNMDGIQATEIITNQCPQAAIIIVSIQGENEYLRR 94

Query: 123 ALISNHVSEYLIEPLSVADIINSISAIFTPQEEG--------------KGSSGCSISFIG 168
           A+ +    EYL++P S  ++ ++I  +    ++               K   G  I+   
Sbjct: 95  AMAAG-AREYLVKPFSSNELADTIRRVNESTKKRLSLMGLQSLASPRIKIQKGKIITLFC 153

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRI 228
           S+GGVG +T+A N A  +A     +  L DLDL  G  ++  + +   +I+D       +
Sbjct: 154 SKGGVGKTTMACNLAIGLAQSTKKKVALVDLDLQGGDISVMLNINAKGTIADLAQESDAM 213

Query: 229 DKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNS 288
           D   +    V +     IL AP    +    + + +  +L IL++ F  +++D   ++N 
Sbjct: 214 DMGLIDSYLVPHLSGAKILPAPLSPEQAELINLERVEELLHILQENFDYIVIDTSPLFND 273

Query: 289 WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISI 348
                L  +++++I  + DL  +++ K  +D+L  L  +DK   L++N      +  I I
Sbjct: 274 INLAALDAANQILILVTQDLPCVKHVKTNLDILATLGHSDKVK-LIVNCAGI--ESGIKI 330

Query: 349 SDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMG 402
           +D          A+IP+D  V   + N G         S +   L+D +  L G
Sbjct: 331 TDLEKSFNTAAFAVIPWDDKVVRSAINKGLPAVMSQANSKVGQSLLDLTAKLAG 384


>gi|315181055|gb|ADT87969.1| Flp pilus assembly protein, ATPase CpaE [Vibrio furnissii NCTC
           11218]
          Length = 372

 Score = 83.6 bits (205), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 86/345 (24%), Positives = 161/345 (46%), Gaps = 12/345 (3%)

Query: 71  CFSDSSTPDLIIVQTKVDSREVLSALE----PLAEVCDSGTKVIVIGDTNDVSLYRALIS 126
            F   S PDLI V+T  +  + +  L+    P  +  +  T +IV GD +D    +  + 
Sbjct: 25  SFKHFSPPDLIFVETGPNWAQKVIELQNYESPEVDEEEVNTSLIVFGDESDNGALKIALR 84

Query: 127 NHVSEYLIEPLSVADIINSISAIFTPQEE-GKGSSGCSISFIGSRGGVGSSTIAHNCAFS 185
              ++++ +  ++ +++  +    T +E+      G    FI ++GG G++TIA N A  
Sbjct: 85  IGAADFVSDQATLEELVPLLKN--TAEEKIAARKLGQLFVFINTKGGSGATTIALNTAVE 142

Query: 186 IASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLS 245
           +A     + LL DLD+ +G      + +P  SI+DAI  V  +D+  +  L   +   L 
Sbjct: 143 VALQHKNKVLLLDLDIHFGVIMDYLNLNPTYSINDAIANVADLDEISLHSLVSKHPSGLH 202

Query: 246 ILTAPAMLSRTYDFDEKM-IVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITT 304
           +L+     +   +FD+ M +  +L  L + +P V +D+    +     VL+ S KV + T
Sbjct: 203 VLSFKHE-NHNENFDKAMQLGKLLPTLMEYYPYVFVDLSMGVDRMFAPVLSHSSKVFLVT 261

Query: 305 SLDLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAII 363
             +L G++N+  +   L  +   A +   L++N+ +  K+ +I + D    +      +I
Sbjct: 262 QQNLVGIKNTSRIAKSLMLEYGIAKEQIELIVNRYE--KRQQIKMKDIEQTITGVNVHMI 319

Query: 364 PFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSK 408
           P D      SAN GK + E    S+I   +++ S+ L   V   K
Sbjct: 320 PNDFKAAIESANLGKPVVESKKNSSITKSVIELSQTLAPEVKEKK 364


>gi|86159248|ref|YP_466033.1| Flp pilus assembly protein ATPase CpaE-like [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85775759|gb|ABC82596.1| Flp pilus assembly protein ATPase CpaE-like protein
           [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 377

 Score = 82.8 bits (203), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 67/309 (21%), Positives = 137/309 (44%), Gaps = 6/309 (1%)

Query: 94  SALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQ 153
            A   +A +  SG +V V+G   D  L    +     EY +     A +  ++ ++  P 
Sbjct: 57  GAFATVARLAASGARVAVVGPAKDPDLILRSMRAGAREYAVAG-DAARLQQAVRSLARP- 114

Query: 154 EEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKD 213
            +G  ++G  ++   ++GG+G++T+A N A  +       T L DLDL  G  N   D  
Sbjct: 115 -DGAVAAGQVLAIFPAKGGMGATTLAANVAADLVR-GGDRTCLVDLDLQLGDVNAFLDVH 172

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
              +I+D +  + R+D+  +      +   + +L     L      D   +  ++  L Q
Sbjct: 173 GGYTITDVVANMRRLDRDLLDASVQAHRSGVHVLAQEERLEEAEHLDAAAVEKLIGFLRQ 232

Query: 274 IFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYL 333
            +  ++LD    ++  +   L  +D+VV+  + ++  +RN++  +++ +KL  +D    +
Sbjct: 233 HYQHLVLDGLRGFDERSLAALDAADRVVLVVTQEVPAVRNAQRCVELFRKLGYSDAKLAI 292

Query: 334 VLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
           V+N  +  +   I+       LG+  +A +  D      +   G  + E  P+SA+A  +
Sbjct: 293 VVN--RCLRASNITPEVIAETLGVPVTATVANDFVSASRAVQRGSTVMEEAPRSALARDV 350

Query: 394 VDFSRVLMG 402
              +R L G
Sbjct: 351 SALARKLSG 359


>gi|269926135|ref|YP_003322758.1| response regulator receiver protein [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269789795|gb|ACZ41936.1| response regulator receiver protein [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 420

 Score = 82.4 bits (202), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/237 (21%), Positives = 115/237 (48%), Gaps = 2/237 (0%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           ++F  ++GG G++T+  N A S+A +     ++ D  L      +  D D   +I+D   
Sbjct: 150 LTFHSAKGGSGTTTMVVNTAISLAQLTKKRVVIVDAALQSADVGVLLDLDHPTNIADLTP 209

Query: 224 PVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVP 283
            +  +D+  +S +   ++  + +L APA + R+    E+  + ++ +L +    V++D P
Sbjct: 210 HMKELDEDLLSEIMATHSSGVKVLLAPAQIERSELITEEQFLRIIGVLRKAADYVLIDTP 269

Query: 284 HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKK 343
           H+ ++ +   L   D++V+ ++ ++A LRN+   + +  +L    +  +L++N+  +  K
Sbjct: 270 HILDAVSMAALDTCDQIVVVSTPEVAALRNTARFLQLTSRLGYPQEKIFLLINRAGS--K 327

Query: 344 PEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
             +++ D    +     A IP  G     + N+G  +     KS++A   +  S  L
Sbjct: 328 GAVNLDDIKKHIKYEIGATIPSGGKKMISATNTGVPVTMEKGKSSMAKAFITLSTKL 384


>gi|258621452|ref|ZP_05716486.1| Flp pilus assembly protein, ATPase CpaE [Vibrio mimicus VM573]
 gi|258586840|gb|EEW11555.1| Flp pilus assembly protein, ATPase CpaE [Vibrio mimicus VM573]
          Length = 372

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 81/312 (25%), Positives = 150/312 (48%), Gaps = 7/312 (2%)

Query: 69  VSCFSDSSTPDLIIVQTKVD-SREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISN 127
           VS  +  + PDLI V+T  + +++VL+  E  A   D    +IV GD +D    +  +  
Sbjct: 59  VSGLTHLTPPDLIFVETGPNWAQKVLALQEYEAPSDDFEASLIVFGDEDDNGALKIALRL 118

Query: 128 HVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIA 187
             ++++ +   + D  + +  + + ++      G    FI ++GG G+ST+A N A  IA
Sbjct: 119 GAADFVSDKAMMNDFFHLLKNV-SEEKLASRELGELHLFINTKGGCGASTLALNTALEIA 177

Query: 188 SVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSIL 247
           +    + LL DLD+P+G  +      P  S++D I     +D   +S +       L +L
Sbjct: 178 ASHPEKVLLLDLDIPFGVISEYLSITPQYSLTDVIEHAKDLDHDSLSAMVTKMDNGLHVL 237

Query: 248 TAPAMLSRTYDFDE-KMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSL 306
                 + T DFD+ + I  +L IL +I+P V++D+    +     V+  + KV +    
Sbjct: 238 -GFFHENTTEDFDKAREIGRLLPILREIYPYVVIDLSRGVDRIFSAVVAPATKVFLVAQQ 296

Query: 307 DLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPF 365
           +LA ++N+  ++ +L  +   A +   L++N+ +  K+  I+I D    +      +IP 
Sbjct: 297 NLAAIKNTSRILRLLTLEYGVAKEQIELIINRYE--KRASINIKDIEKTIAGISVFMIPN 354

Query: 366 DGAVFGMSANSG 377
           D  V   SAN G
Sbjct: 355 DYRVAIESANVG 366


>gi|260771473|ref|ZP_05880398.1| type II/IV secretion system ATPase TadZ/CpaE associated with Flp
           pilus assembly [Vibrio furnissii CIP 102972]
 gi|260613599|gb|EEX38793.1| type II/IV secretion system ATPase TadZ/CpaE associated with Flp
           pilus assembly [Vibrio furnissii CIP 102972]
          Length = 372

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 85/345 (24%), Positives = 161/345 (46%), Gaps = 12/345 (3%)

Query: 71  CFSDSSTPDLIIVQTKVDSREVLSALE----PLAEVCDSGTKVIVIGDTNDVSLYRALIS 126
            F   S PDLI V+T  +  + +  L+    P  +  +  T +IV GD +D    +  + 
Sbjct: 25  SFKHFSPPDLIFVETGPNWAQKVIELQNYESPEVDEEEVNTSLIVFGDESDNGALKIALR 84

Query: 127 NHVSEYLIEPLSVADIINSISAIFTPQEE-GKGSSGCSISFIGSRGGVGSSTIAHNCAFS 185
              ++++ +  ++ +++  +    T +E+      G    FI ++GG G++TIA N A  
Sbjct: 85  IGAADFVSDQATLEELVPLLKN--TAEEKIAARKLGQLFVFINTKGGSGATTIALNTAVE 142

Query: 186 IASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLS 245
           +A     + LL DLD+ +G      + +P  SI+DAI  V  +D+  +  L   +   L 
Sbjct: 143 VALQHKNKVLLLDLDIHFGVIMDYLNLNPTYSINDAIANVADLDEISLHSLVSKHPSGLH 202

Query: 246 ILTAPAMLSRTYDFDEKM-IVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITT 304
           +L+     +   +FD+ M +  +L  L + +P V +D+    +     VL+ S KV + T
Sbjct: 203 VLSFKHE-NHNENFDKAMQLGKLLPTLMEYYPYVFVDLSMGVDRMFAPVLSHSSKVFLVT 261

Query: 305 SLDLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAII 363
             +L G++N+  +   L  +   + +   L++N+ +  K+ +I + D    +      +I
Sbjct: 262 QQNLVGIKNTSRIAKSLMLEYGISKEQIELIVNRYE--KRQQIKMKDIEQTITGVNVHMI 319

Query: 364 PFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSK 408
           P D      SAN GK + E    S+I   +++ S+ L   V   K
Sbjct: 320 PNDFKAAIESANLGKPVVESKKNSSITKSVIELSQTLAPEVKEKK 364


>gi|307294429|ref|ZP_07574273.1| Flp pilus assembly protein ATPase CpaE [Sphingobium
           chlorophenolicum L-1]
 gi|306880580|gb|EFN11797.1| Flp pilus assembly protein ATPase CpaE [Sphingobium
           chlorophenolicum L-1]
          Length = 406

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/313 (23%), Positives = 143/313 (45%), Gaps = 14/313 (4%)

Query: 94  SALEPLAEVCDSGTKVIVIGDTND--VSLYRALISNHVSEYLIEPLSVAD---IINSISA 148
           +++  LA +  +  K++++    D  +++ RAL+ + +++ +  PL   D   I++ + +
Sbjct: 79  ASMARLAGLRAANPKLMLVAAVRDAQIAVVRALLRSGINDVIELPLRAHDLAAILDDLKS 138

Query: 149 IFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCA---FSIASVFAMETLLADLDLPYGT 205
                 +    +G  +S I S GGVG++TIA   A      A     E  L DLD+ +G 
Sbjct: 139 RIAATRQDDVRTGQIVSIIKSVGGVGATTIATQAASLHARSAKQQGAEVCLFDLDIQFGN 198

Query: 206 ANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIV 265
           A          +++D +    R+D   +  + V  +  L ++TAPA +      +   I 
Sbjct: 199 AGTFLGISSPLTLADLLNGGNRVDSELLRTVTVETSTGLRLVTAPAEIMPIEAVNADQIF 258

Query: 266 PVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
            ++++ ++ F  V LD+P  W +W+  ++  S  V +   L +A LR ++  I +   LR
Sbjct: 259 RIVELAQRNFDTVYLDLPGNWTNWSMSLVARSQVVFLVCELTIASLRQARRQISL---LR 315

Query: 326 PADKPP---YLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHE 382
             D  P   +++ N+V+      I + D  A L       I  D  +   + + G +I E
Sbjct: 316 DQDIDPSRIHVIANRVEKKFFRAIGLEDAAAALDHPVKLSIANDFPLVSSALDQGVLIQE 375

Query: 383 VDPKSAIANLLVD 395
           +  +S I   L D
Sbjct: 376 LKARSRICKDLQD 388


>gi|13471030|ref|NP_102599.1| septum site-determining protein [Mesorhizobium loti MAFF303099]
 gi|14021774|dbj|BAB48385.1| probable septum site-determining protein [Mesorhizobium loti
           MAFF303099]
          Length = 262

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 121/258 (46%), Gaps = 15/258 (5%)

Query: 171 GGVGSSTIAHNCAFSI--ASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRI 228
           GGVG++T+A   AF +  +      T + DL+   G      D +P   I++      R+
Sbjct: 5   GGVGTTTLALQTAFQLHHSVTRGASTCVVDLNFQQGACAEYLDLEPRFDITEIENQPERL 64

Query: 229 DKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNS 288
           D+  +  +   +A  L +L AP   +    F   ++V +LD++   F  V++D+P  W  
Sbjct: 65  DRQLLDVMLSKHASGLCVLAAPTHPAEMRSFKTDVVVRMLDLVSAYFDNVVIDMPRTWFP 124

Query: 289 WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPK-KPEIS 347
           WT+ VL  S+K+ I   + +  LR+++ LI  + +    +  P +++N+ +       I 
Sbjct: 125 WTETVLLGSNKLYIVAEMTVPCLRHTQRLIQAVYETAGKEVKPNVIVNRFEQKMFDNGIK 184

Query: 348 ISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVS 407
            +D    LG      I  +  +   + + G  +HE+DP    AN++ D  ++++      
Sbjct: 185 QADVQEILGEHFVGGIANNYRLVREAVDRGVPLHEIDPN---ANVVNDLKKIIL------ 235

Query: 408 KPQSAMYT--KIKKIFNM 423
            P+ A+ T  K K +F +
Sbjct: 236 -PEEAVATGAKSKSLFGL 252


>gi|283769332|ref|ZP_06342231.1| hypothetical protein HMPREF9013_0307 [Bulleidia extructa W1219]
 gi|283103989|gb|EFC05373.1| hypothetical protein HMPREF9013_0307 [Bulleidia extructa W1219]
          Length = 398

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 82/321 (25%), Positives = 154/321 (47%), Gaps = 26/321 (8%)

Query: 110 IVIGDTNDVSLYRALISNHVSEYLIE-PLSVADIINSISAIFTP---------QEEGKGS 159
           IV+ D  D S+ R +++   S ++   P    +  ++I  I++          ++ G   
Sbjct: 79  IVMSDLTDESVARQVLNAGTSGFICPIPTDHNETCDAIKRIYSNSKSRIDLILEKSGAPR 138

Query: 160 SGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSIS 219
               I+  G++GG+G +T+A N A S+A    ++  + D D+ +G A++    +   +++
Sbjct: 139 KAEMITVFGTKGGIGKTTLATNLAVSLAKQ-KLKVCILDFDMRFGDAHMFLGVEVKETVT 197

Query: 220 DAIYP--VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
           D +    V  ID   + R  V +   + +L +P+      D   + + PV+++L   +  
Sbjct: 198 DMLQEQRVPTIDT--IRRFFVSHHSGVKLLGSPSSPEYASDISGEQLEPVINLLRAHYDY 255

Query: 278 VILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQ 337
           VI+DV   ++     +L +S+ V+  TSLD+A L+N+K  + +L  L    K   +V  +
Sbjct: 256 VIVDVSPEFSDINLLMLEMSNTVLFMTSLDIAALKNAKKSLLILDSLNLKGKVKLIVSRE 315

Query: 338 VKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSA-NSGKMIHEVDPKSAIANLLVDF 396
            K     +IS+ D    +G+   A IP DG +    A N G+ I   + KSAI+  +  F
Sbjct: 316 FKG----DISLKDVEKVMGLKVEASIP-DGYLDATKALNQGEPIVLFNEKSAISEAVDRF 370

Query: 397 S-----RVLMGRVTVSKPQSA 412
           S     +V + R   +K +SA
Sbjct: 371 SYRISRKVELNRNDKTKKKSA 391


>gi|145299826|ref|YP_001142667.1| flp pilus assembly protein FlpE [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|88866588|gb|ABD57356.1| FlpE [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142852598|gb|ABO90919.1| flp pilus assembly protein FlpE [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 374

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 86/366 (23%), Positives = 161/366 (43%), Gaps = 42/366 (11%)

Query: 52  RMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIV 111
           ++++V  R   GS+AEA +       PD+++V+ + + + + + L  LAE C    ++++
Sbjct: 27  QLAEVEARQIPGSLAEARAHCLAQGAPDILLVEVE-NPQTLAADLAALAECCPPQMRLVL 85

Query: 112 IGDTNDVSLYRALISNHVSEYLIEPL-----SVADIINSISAIFTPQEEGKGSSGCSISF 166
           +G+  DV+L+R LIS  V +Y   PL         +      + T   +G+      I  
Sbjct: 86  LGERGDVTLFRWLISVGVDDYYPAPLDPDALRTGLLRLLGVPLVTSLRKGR-----VICV 140

Query: 167 IGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVG 226
           +G+ GGVG+ST+A N A ++A     +  L DL+L +    I    D             
Sbjct: 141 VGAAGGVGTSTVAANLAMALADQHHRQVALLDLNLHHSRHPILLGSDYAPPGEQWWQATD 200

Query: 227 RIDKAFVS--------RLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLV 278
           R+D   ++        RL +FY E   ++              + +V  ++++ + +  +
Sbjct: 201 RLDGTLLAHTAHQLGPRLFLFYDEGQELV-----------LGAEQLVAAVNVMAEHYSTL 249

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQV 338
           I+DVP +     + +L  +D V+      L  LR    L+    +   A +   LV N  
Sbjct: 250 IIDVPDLRTHGLRALLQEADVVLWLHDFSLGALR----LLGQCPQGGQAQR-RLLVGNHC 304

Query: 339 --KTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDF 396
             K  + P   +   C   G   +A++P+D  VF  +  +G+ +  +  KS +A  L   
Sbjct: 305 RGKEGRVPAQELERVC---GQPHAAVLPYDHGVFVRAERAGQPL--IQQKSKLARALTLL 359

Query: 397 SRVLMG 402
           +  L+G
Sbjct: 360 AGELVG 365


>gi|222834140|gb|EEE72617.1| predicted protein [Populus trichocarpa]
          Length = 350

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/285 (23%), Positives = 129/285 (45%), Gaps = 3/285 (1%)

Query: 110 IVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGS 169
           I+I  + D S+    +   V + L  PL    ++ ++  +              IS I  
Sbjct: 33  ILITQSQDSSVLIQAMRAGVRDVLPWPLDKGQLVEALKRVEATHVPRMQEVAQVISMISC 92

Query: 170 RGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSISDAIYPVGRI 228
           +GG G+S +A N   ++A  F    L+ DL+  +G    I  DK P +++S+    + R+
Sbjct: 93  KGGAGTSFVAANLGDALARHFGKRVLVVDLNRYFGDLTYIVTDKAPPSTLSEICSQIDRM 152

Query: 229 DKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNS 288
           D AF+    V       +L   A   R     ++ +  +L +++  +  VI DV    + 
Sbjct: 153 DAAFLEACLVHVDNGFDMLAGAADPVRASQIQKEKLEWILSVMQPNYDYVIFDVGQSIDP 212

Query: 289 WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISI 348
            +  +L  SD++ + T   +A  R S+ L+D+L+ L   D    +VLN+V   +K E+  
Sbjct: 213 LSISMLDHSDRICVVTEPSIAFGRPSRRLLDILRALHYPDDKIRVVLNRVG--RKNEVPR 270

Query: 349 SDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
           +      G+  +  +P D A    + + G+ + ++  +S+IA  L
Sbjct: 271 TTMEEIFGMKVAFTLPDDPAAVDEAVSHGEPVAKLSKRSSIARAL 315


>gi|312116088|ref|YP_004013684.1| hypothetical protein Rvan_3402 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311221217|gb|ADP72585.1| hypothetical protein Rvan_3402 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 409

 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 108/241 (44%), Gaps = 2/241 (0%)

Query: 77  TPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEP 136
            P L+IV+     R   + +  L         V+VI +  D     AL+   V ++L   
Sbjct: 19  APQLLIVELDNARRVDTAFIGRLKAAKFETVPVVVISNLLDPETVGALVRLRVDDFLSSD 78

Query: 137 LSVADIINSIS-AIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETL 195
            ++ +   +   A+     E  G +    SF    GG G++T+A   AF I     M  +
Sbjct: 79  CTIGEFHKACQHALKQHARETPGRATSCYSFFPVSGGCGNTTLAIQSAFLIGRRNGMSNV 138

Query: 196 -LADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLS 254
            L DL+L  G      D  P   I +      R+D+  +  +   ++  LS+L AP   +
Sbjct: 139 CLVDLNLQDGAVADYLDLAPSFRIDEVASSPARLDRQLLDVMLSRHSSGLSVLAAPRCPA 198

Query: 255 RTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNS 314
           R  +   + +  VL +L Q F  +++D+P  W++WT+ V+  S++V I +S  +  LR +
Sbjct: 199 RHINVSAETVALVLGLLSQSFSTIVVDLPKTWHAWTENVVWGSNRVFIVSSFTVPALRQA 258

Query: 315 K 315
           +
Sbjct: 259 R 259


>gi|168702880|ref|ZP_02735157.1| probable pilus assembly protein CpaE [Gemmata obscuriglobus UQM
           2246]
          Length = 406

 Score = 80.9 bits (198), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 87/346 (25%), Positives = 155/346 (44%), Gaps = 20/346 (5%)

Query: 74  DSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYL 133
            +STPDL+IV    D  +   AL+ + ++     K+ ++  ++D       +      +L
Sbjct: 44  QASTPDLVIVTLDADKNK---ALQMIGQLSVEHPKLPILTISHDHQALLQSLQKGAKYFL 100

Query: 134 IEPLSVADIINSISAIF------TPQEEGKGS---SGCS--ISFIGSRGGVGSSTIAHNC 182
             P+ + D++ ++           P   G  S   +G S  I+ +GSRGGVG++T+A N 
Sbjct: 101 THPVGLEDMLAALRRALGEAGGEAPSAGGTASARQTGASSMIAVLGSRGGVGTTTLAVNM 160

Query: 183 AFSIASVFAMETLLADLDLPYGTANINFDKDPIN--SISDAIYPVGRIDKAFVSR-LPVF 239
           A ++AS       L DLDL  G A+I  + +     SISD    + R+D  F+ R +   
Sbjct: 161 AATLASDPTNAAALIDLDLALGDADIALEVNGFENISISDLARNIERLDMNFLKRAMAKH 220

Query: 240 YAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDK 299
               L+IL  P  ++      E+ +  VL++L+  +  ++LD+           L ++D 
Sbjct: 221 EPTGLAILRHPLEIAEVGLIHEQHVERVLNLLKISYTHLVLDLSKCLLPTDLMALRMADM 280

Query: 300 VVITTSLDLAGLRNSKNLIDVL-KKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGIT 358
           +++   L+L+ LRN   LI  L  +   ADK   ++  Q     +  IS+      +G  
Sbjct: 281 IILVAQLELSSLRNVVRLIHCLGGEENLADKIRVVINRQGADSVEEGISLKKAEEVIGKP 340

Query: 359 PSAIIPFD-GAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGR 403
               +P D  AV G       ++    PKS +   +   ++ L G+
Sbjct: 341 IFWQVPNDTKAVIGARVAGHPLVKHA-PKSRVQQSIYGLTQALYGK 385


>gi|94309587|ref|YP_582797.1| response regulator receiver domain-containing protein [Cupriavidus
           metallidurans CH34]
 gi|93353439|gb|ABF07528.1| flp pilus assembly ATPase [Cupriavidus metallidurans CH34]
          Length = 397

 Score = 80.9 bits (198), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 68/285 (23%), Positives = 129/285 (45%), Gaps = 3/285 (1%)

Query: 110 IVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGS 169
           I+I  + D S+    +   V + L  PL    ++ ++  +              IS I  
Sbjct: 80  ILITQSQDSSVLIQAMRAGVRDVLPWPLDKGQLVEALKRVEATHVPRMQEVAQVISMISC 139

Query: 170 RGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSISDAIYPVGRI 228
           +GG G+S +A N   ++A  F    L+ DL+  +G    I  DK P +++S+    + R+
Sbjct: 140 KGGAGTSFVAANLGDALARHFGKRVLVVDLNRYFGDLTYIVTDKAPPSTLSEICSQIDRM 199

Query: 229 DKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNS 288
           D AF+    V       +L   A   R     ++ +  +L +++  +  VI DV    + 
Sbjct: 200 DAAFLEACLVHVDNGFDMLAGAADPVRASQIQKEKLEWILSVMQPNYDYVIFDVGQSIDP 259

Query: 289 WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISI 348
            +  +L  SD++ + T   +A  R S+ L+D+L+ L   D    +VLN+V   +K E+  
Sbjct: 260 LSISMLDHSDRICVVTEPSIAFGRPSRRLLDILRALHYPDDKIRVVLNRVG--RKNEVPR 317

Query: 349 SDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
           +      G+  +  +P D A    + + G+ + ++  +S+IA  L
Sbjct: 318 TTMEEIFGMKVAFTLPDDPAAVDEAVSHGEPVAKLSKRSSIARAL 362


>gi|258405286|ref|YP_003198028.1| response regulator receiver protein [Desulfohalobium retbaense DSM
           5692]
 gi|257797513|gb|ACV68450.1| response regulator receiver protein [Desulfohalobium retbaense DSM
           5692]
          Length = 389

 Score = 80.5 bits (197), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 78/333 (23%), Positives = 155/333 (46%), Gaps = 14/333 (4%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPL 137
           PDL+I +   D   +   ++  +   D   ++ +  ++ D +L    + +   E+   P 
Sbjct: 42  PDLLIKEISDDPDHIFDLVQN-SLYNDEAGEIFLTSESKDQNLVLKAMRSGAREFF-GPY 99

Query: 138 SVADIINS-ISAIFTPQEEGKGSSGCS------ISFIGSRGGVGSSTIAHNCAFSIASVF 190
           +V D I+S +    T Q + +  +G +      ISF+GS+GGVG++T+A N A S+A+  
Sbjct: 100 TVEDEISSALDRFMTRQAKLRAVAGKTAKQSQVISFMGSKGGVGTTTLAVNLAVSLATNE 159

Query: 191 AMETL-LADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTA 249
             +++ L D++L +G   +  + DP  +  +    + R+D+ F+  +       + +L +
Sbjct: 160 PKQSVCLLDMNL-FGDLPLFLEIDPTYTWREITKNISRLDETFLKNILAVDPSGVYVLPS 218

Query: 250 PAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLA 309
           P  L        ++I  +  +L ++F  VI+D   + N    +V+ LSDKV + +   L 
Sbjct: 219 PGYLDSQNMATPEVIERLFKVLTKMFDFVIIDTGQLLNDTALKVVELSDKVFLVSVQSLP 278

Query: 310 GLRNSKNLIDVLKKLR-PADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGA 368
            L  +  ++   + LR P     ++++N  +  K   I+ SD    L    S  IP D  
Sbjct: 279 CLAKTNKILRTFRDLRFPESNSLHIIIN--RHLKNSSITTSDVENSLEKKVSWNIPNDYE 336

Query: 369 VFGMSANSGKMIHEVDPKSAIANLLVDFSRVLM 401
               + N G+ +++   K  I   + D +  L+
Sbjct: 337 STMTAINKGQPLYKTASKKEITQSIRDLAASLV 369


>gi|261251596|ref|ZP_05944170.1| type II/IV secretion system ATPase TadZ/CpaE associated with Flp
           pilus assembly [Vibrio orientalis CIP 102891]
 gi|260938469|gb|EEX94457.1| type II/IV secretion system ATPase TadZ/CpaE associated with Flp
           pilus assembly [Vibrio orientalis CIP 102891]
          Length = 387

 Score = 80.1 bits (196), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 68/272 (25%), Positives = 133/272 (48%), Gaps = 22/272 (8%)

Query: 105 SGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSI 164
           +G +V+ +GD  +++ YRA++S   SEYL+ P+     I++ +A      + + ++G  I
Sbjct: 78  TGAQVVAVGDNREIAFYRAMVSAGASEYLLNPVE----ISAFNATEFQANKAETTAGKVI 133

Query: 165 SFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYP 224
           + +G++GGVG+STIA N A  +A    + T +AD+D   G  ++ +D     ++ + +  
Sbjct: 134 AVVGAKGGVGASTIAVNLARELAERGEVLT-VADMDFATGDLDLQYDVQGNTALVEMLQY 192

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL-----VI 279
             R++     R  +  ++ +++ T    L  T  + EK     LD   + F L     ++
Sbjct: 193 PERLEPVVYERSGIKVSDRVTLFTGYLPLDSTPFWPEK---SALDHFRK-FSLQHSDSLV 248

Query: 280 LDVPHVWNSWTQEV----LTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR--PADKPPYL 333
           LD+P    S   ++    L  ++  V+     L+ +RN+  ++ +L       +DK   +
Sbjct: 249 LDLPSF--SMRDQIGFSSLAQANVRVLVVEPTLSSIRNTGQILALLDSTANGQSDKINLI 306

Query: 334 VLNQVKTPKKPEISISDFCAPLGITPSAIIPF 365
           V+N  K+ K   IS  D    LG     ++P+
Sbjct: 307 VVNHTKSDKASLISCHDVQRALGCAVDVVLPY 338


>gi|227114878|ref|ZP_03828534.1| hypothetical protein PcarbP_18035 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 399

 Score = 80.1 bits (196), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 125/275 (45%), Gaps = 15/275 (5%)

Query: 52  RMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIV 111
           R+ Q ++ +  G IA A      +  P +++V  +  +   L ALE L  VC   ++VI 
Sbjct: 35  RLKQPDVPVMSGGIAAARQWCELNVPPRILLVDLE-GAHWPLPALEELLSVCGPTSQVIA 93

Query: 112 IGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGK--GSSGCSISFIGS 169
            G   DV LYRAL+   V +YL++P ++ D++ +  A    Q+ G      G +I+ + +
Sbjct: 94  TGKEQDVGLYRALLQAGVVDYLVKPFTL-DLLAATLAKCEGQQAGPEYARMGRTIAVVSA 152

Query: 170 RGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISD-----AIYP 224
            GG G+ST+A   +  ++    +   L D D        N D+  +   +D     A+  
Sbjct: 153 SGGSGASTVAMGLSRLLSGERHLPVALVDFD------RRNGDQLLLQGQTDDAGLAAVLG 206

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH 284
              +D   + R  +     L +L     L      D   ++ +   L ++F  VI D+P 
Sbjct: 207 TQELDTRLLQRAMLRVDTRLHLLAQKPELGELAPVDVDNVLNLGGALCRMFNQVIWDLPS 266

Query: 285 VWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLID 319
            + +   +VLT +D  +I T L L   RN + +++
Sbjct: 267 SYPTGALDVLTYADLRIIVTELTLQDARNVRRVLN 301


>gi|260892926|ref|YP_003239023.1| response regulator receiver protein [Ammonifex degensii KC4]
 gi|260865067|gb|ACX52173.1| response regulator receiver protein [Ammonifex degensii KC4]
          Length = 391

 Score = 80.1 bits (196), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 80/348 (22%), Positives = 154/348 (44%), Gaps = 35/348 (10%)

Query: 77  TPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEP 136
            PD++++   +   + ++A E ++E     T V++I    +    R  ++   S+YLI+P
Sbjct: 49  APDVVLMDINMPGLDGIAATEAISERSPQ-TGVVIISIQGEQEYLRRAMAAGASDYLIKP 107

Query: 137 LSVADIINSISAIFTPQE-----------EGKGSSGCSISFIGSRGGVGSSTIAHNCAFS 185
            +  ++++++  ++               EGKG  G  + F GS+GGVG +T+A N A  
Sbjct: 108 FTAQEMVDAVRRVWEKNRRRQAMTAVRTGEGKGEVGRVVVFFGSKGGVGRTTLACNLAVL 167

Query: 186 IASVFAMETLLADLDLPYGTANINFDKDPINSISD-AIYPVGRIDKAFVSRLPVFYAENL 244
           +A        L D DL  G   + F+ D    +++ A+ P   ++   +    + +   +
Sbjct: 168 LAR-RGKRVSLVDFDLASGDVALFFNLDKGQGVAELALEP--SLNPETIEGYLLNHVTGV 224

Query: 245 SILTAPAMLSRTYDFDEKMIVPVLDILEQIF-------PLVILDVPHVWNSWTQEVLTLS 297
            IL       R   F E+ + P L +  +I          V++D P  + S T+E L  +
Sbjct: 225 RIL-------RAGGFSEETL-PRLGLGAEILTSLKVKTQYVLVDTPPFFCSLTEEALLAA 276

Query: 298 DKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGI 357
           D++V+    DL GL+  K  ++ L++ +      + VLNQV    +  +  +     LG 
Sbjct: 277 DEIVVVGRNDLPGLKQLKTDLNFLRE-KGYTGRIWTVLNQV---GEEGVDRAGLEKALGA 332

Query: 358 TPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVT 405
             +A++P +      + N G  +      + +A  L  F+  L G  T
Sbjct: 333 KLAAVLPAEWRACRQAVNKGNPLVLEAKGTRLAQALESFAGQLSGEET 380


>gi|294012234|ref|YP_003545694.1| Flp pilus assembly protein ATPase CpaE [Sphingobium japonicum
           UT26S]
 gi|292675564|dbj|BAI97082.1| Flp pilus assembly protein ATPase CpaE [Sphingobium japonicum
           UT26S]
          Length = 411

 Score = 79.7 bits (195), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 75/332 (22%), Positives = 148/332 (44%), Gaps = 22/332 (6%)

Query: 84  QTKVDSREVLSALEP--------LAEVCDSGTKVIVIGDTND--VSLYRALISNHVSEYL 133
           Q   D++ ++  ++P        LA +  +  K++++    D  +++ RAL+ + +++ +
Sbjct: 66  QLAADAKAIIIEVQPDNDASMARLAGLRAANPKLMLVAAVRDAQIAVVRALLRSGINDVI 125

Query: 134 IEPLSVAD---IINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVF 190
             PL   D   I++ + +      +    +G  +S I S GGVG++TIA   A   A   
Sbjct: 126 ELPLRAHDLAAILDDLRSRIAASRQDDVRTGQIVSIIKSVGGVGATTIATQAASLHARSK 185

Query: 191 AM---ETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSIL 247
                E  L D D+ +G A          +++D +    R+D   +  + V  +  L ++
Sbjct: 186 KQGGGEVCLFDFDIQFGNAGTFLGISSPLTLADLLNAGSRVDNELLRTVTVETSTGLRVV 245

Query: 248 TAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLD 307
           TAPA +      +   +  ++++ ++ F  V LD+P  W +W+  ++  S  V +   L 
Sbjct: 246 TAPAEIMPIEAVNADQVFRIVELAQRGFDTVYLDLPGNWTNWSMSLVARSQVVFLVCELT 305

Query: 308 LAGLRNSKNLIDVLKKLRPADKPP---YLVLNQVKTPKKPEISISDFCAPLGITPSAIIP 364
           +A LR ++  I +   LR  D  P   ++V N+V+      I + D  A L       I 
Sbjct: 306 IASLRQARRQISL---LRDQDIDPSRIHVVANRVEKKFFRAIGLEDAAAALDHPVKLSIA 362

Query: 365 FDGAVFGMSANSGKMIHEVDPKSAIANLLVDF 396
            D  +   + + G +I E+  +S I   + D 
Sbjct: 363 NDFPLVSSALDQGVLIQELKARSRICKDMQDI 394


>gi|162147492|ref|YP_001601953.1| pilus assembly protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786069|emb|CAP55651.1| putative pilus assembly protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 500

 Score = 79.3 bits (194), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 136/309 (44%), Gaps = 7/309 (2%)

Query: 60  ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS 119
           + R S  +AV       TP ++I+    +  + L+ L  LA V      V++IGD  D +
Sbjct: 136 VMRMSCQQAVEYLRSHETPGILILDVSGED-QPLTTLTELANVVSPDVTVLLIGDREDAN 194

Query: 120 LYRALISNH-VSEYLIEPLSVADIINSISAIFTPQEEGKGS--SGCSISFIGSRGGVGSS 176
            YR +     VSEYL +PL+ +        +    E    +   G  I+  G RGGVG++
Sbjct: 195 FYRQVTRGFGVSEYLYKPLNRSMATRFFGPVIMGGEVAPDAPRGGRVITVSGVRGGVGAT 254

Query: 177 TIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRL 236
           TI  N  + +A      T++ D DL  G   +       N +  A+    R+D  F+ R 
Sbjct: 255 TIMTNLGWYLAEEAKRHTVIVDFDLTTGKTALLLGTQSNNGLRSAMETPDRVDTLFLERS 314

Query: 237 PVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTL 296
                + L++L++ + L          +  ++  + + +  V+ + P   +     +L +
Sbjct: 315 AQLVGDRLNLLSSLSDLQTRPKTSAAAMRHLMATVTKRYNFVLAEAPLCPDETEAALLDV 374

Query: 297 SDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLG 356
           + + +I     LA +R++  ++ +L+  R     P +VLN +  P    +++ +    LG
Sbjct: 375 TFQRIIVLDPTLAAVRDTLRIMPLLQT-RGQGSQPLVVLNGLGRPGT--LTLDEVVKSLG 431

Query: 357 ITPSAIIPF 365
             P  +IPF
Sbjct: 432 DKPDVVIPF 440


>gi|209545599|ref|YP_002277828.1| putative pilus assembly protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209533276|gb|ACI53213.1| putative pilus assembly protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 413

 Score = 79.3 bits (194), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 136/309 (44%), Gaps = 7/309 (2%)

Query: 60  ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS 119
           + R S  +AV       TP ++I+    +  + L+ L  LA V      V++IGD  D +
Sbjct: 49  VMRMSCQQAVEYLRSHETPGILILDVSGED-QPLTTLTELANVVSPDVTVLLIGDREDAN 107

Query: 120 LYRALISNH-VSEYLIEPLSVADIINSISAIFTPQEEGKGS--SGCSISFIGSRGGVGSS 176
            YR +     VSEYL +PL+ +        +    E    +   G  I+  G RGGVG++
Sbjct: 108 FYRQVTRGFGVSEYLYKPLNRSMATRFFGPVIMGGEVAPDAPRGGRVITVSGVRGGVGAT 167

Query: 177 TIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRL 236
           TI  N  + +A      T++ D DL  G   +       N +  A+    R+D  F+ R 
Sbjct: 168 TIMTNLGWYLAEEAKRHTVIVDFDLTTGKTALLLGTQSNNGLRSAMETPDRVDTLFLERS 227

Query: 237 PVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTL 296
                + L++L++ + L          +  ++  + + +  V+ + P   +     +L +
Sbjct: 228 AQLVGDRLNLLSSLSDLQTRPKTSAAAMRHLMATVTKRYNFVLAEAPLCPDETEAALLDV 287

Query: 297 SDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLG 356
           + + +I     LA +R++  ++ +L+  R     P +VLN +  P    +++ +    LG
Sbjct: 288 TFQRIIVLDPTLAAVRDTLRIMPLLQT-RGQGSQPLVVLNGLGRPGT--LTLDEVVKSLG 344

Query: 357 ITPSAIIPF 365
             P  +IPF
Sbjct: 345 DKPDVVIPF 353


>gi|260778160|ref|ZP_05887053.1| type II/IV secretion system ATPase TadZ/CpaE associated with Flp
           pilus assembly [Vibrio coralliilyticus ATCC BAA-450]
 gi|260606173|gb|EEX32458.1| type II/IV secretion system ATPase TadZ/CpaE associated with Flp
           pilus assembly [Vibrio coralliilyticus ATCC BAA-450]
          Length = 388

 Score = 79.0 bits (193), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 122/275 (44%), Gaps = 22/275 (8%)

Query: 102 VCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSG 161
           V  +G KVI IGD   ++ YR+L+S    EYL+ P++  D   S+   F     G    G
Sbjct: 76  VHRTGCKVIAIGDDEKIAYYRSLLSAGALEYLVNPIA-PDAFASLD--FGHHHNGN-QRG 131

Query: 162 CSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDA 221
             IS +G++GGVG+ST+  N A  + S     T +ADLD   G  +++FD     ++ + 
Sbjct: 132 KRISVVGTKGGVGTSTVVANLARMMNSR-GQSTAVADLDFASGDLDLHFDVQGNTALVEM 190

Query: 222 IYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL---- 277
           +    R++     R  +    +L++ T    L      D     P  + LE         
Sbjct: 191 LQYPERLEPVVFERSGITVQPDLTLFTGYLPL------DTDPFWPDKNALEHFSKYCLEH 244

Query: 278 ---VILDVP--HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPAD--KP 330
              +I D+P   + +     VL  +D  VI     L+ +RN+  +   L     A   K 
Sbjct: 245 ADNLIFDIPSFSLRDQVGMSVLKSADVRVIVVEPTLSSIRNAGQIFSFLSAGAEAGLAKE 304

Query: 331 PYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPF 365
             LV+N+ K+ K   I+++D    LG+     +PF
Sbjct: 305 NLLVVNRTKSNKASLIALNDVHRALGVDIDVSVPF 339


>gi|239908019|ref|YP_002954760.1| hypothetical protein DMR_33830 [Desulfovibrio magneticus RS-1]
 gi|239797885|dbj|BAH76874.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 388

 Score = 78.6 bits (192), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/305 (21%), Positives = 140/305 (45%), Gaps = 12/305 (3%)

Query: 94  SALEPLAE-VCDSGTK-VIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFT 151
           + LE +AE V   G + V +     D  +   L+   V E+  +P+   ++  ++     
Sbjct: 53  AELEAVAEMVARRGDREVFLTAQVYDAEVLMRLMRQGVREFFPQPVDHEEVRMALWRFKE 112

Query: 152 PQEEGKG----SSGCSISFIGSRGGVGSSTIAHNCAFSIASVF-AMETLLADLDLPYGTA 206
            +E  +G      G  I+  G++GGVG++++A N A +  ++       L D++LP+G A
Sbjct: 113 RRESVRGPRRSKQGRIINIFGAKGGVGTTSLAVNLAAACQTLKDGASVALMDMNLPFGEA 172

Query: 207 NINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVP 266
            +  D  P     + +  + R+D  ++  +   +   L +L  P+ L        + I  
Sbjct: 173 QLFLDLAPKYHWGEVLGNISRLDATYLMSVMSRHPSGLYLLAPPSRLDDLQMATPENISK 232

Query: 267 VLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRP 326
           +L+++ Q+F  V++D+    +  T +V+ +SD +V+ +  +L  L N +  +D ++    
Sbjct: 233 LLELMRQVFDTVVIDLGMYLDEITLKVMDISDAIVLVSVQNLPCLANVRRFLDNVRHAEA 292

Query: 327 A--DKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVD 384
              DK   +V   +   ++ ++ + D    LG+     +P D      + N GK + E  
Sbjct: 293 GLEDKLKIVVNRHL---EESDLVVEDMEKALGLPVFWRVPNDYKTTLSAINQGKTLLETA 349

Query: 385 PKSAI 389
           PK+ +
Sbjct: 350 PKAPV 354


>gi|187927685|ref|YP_001898172.1| response regulator receiver protein [Ralstonia pickettii 12J]
 gi|187724575|gb|ACD25740.1| response regulator receiver protein [Ralstonia pickettii 12J]
          Length = 402

 Score = 78.6 bits (192), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 136/309 (44%), Gaps = 11/309 (3%)

Query: 120 LYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIA 179
           L RAL +  VS+ L  PL  A +  +++ + T            I+FI S+GG GSS IA
Sbjct: 91  LIRALRAG-VSDILTWPLERAQLTTALTRLETNHTPRTREEARVIAFISSKGGAGSSFIA 149

Query: 180 HNCAFSIASVFAMETLLADLDLPYG-TANINFDKDPINSISDAIYPVGRIDKAFVSRLPV 238
            N  +++A+      LL DL+  +  T  +  +K P  ++S+    V R+D AF+     
Sbjct: 150 SNVGYTLAAHEHKRVLLIDLNTQFSDTHFLVSNKTPPATLSEVCAQVDRLDDAFLEACLT 209

Query: 239 FYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSD 298
             A++  +L   +   +  +  +  I  VL ++  I+  +++DV    N  +  VL   D
Sbjct: 210 RVAKDFDVLAGASDPIKAGEIKKDKIEYVLSLVSPIYDFILVDVGQAINPLSIAVLDHCD 269

Query: 299 KVVITTSLDLAGLRNSKNLIDVLKKLR-PADKPPYLVLNQVKTPKKPEISISDFCAPLGI 357
           ++ +     +A  R  + L+D+L  L  P +K   LV    K  + P  ++       G 
Sbjct: 270 QICVVVQPTIAFARTGRRLLDILHGLHYPPEKLRILVNRHGKRDELPRSTLEQV---FGQ 326

Query: 358 TPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKI 417
               ++P D A    S   G  I +    SA+   L     + +G V  +  ++  +   
Sbjct: 327 KLFHVLPEDAAAVDDSICQGMPIAQHHRSSAMTKAL-----MALGNVFATARENDRHASQ 381

Query: 418 KKIFNMKCF 426
           +K F++  F
Sbjct: 382 EKGFSLSKF 390


>gi|78486067|ref|YP_391992.1| Flp pilus assembly protein ATPase CpaE-like [Thiomicrospira
           crunogena XCL-2]
 gi|78364353|gb|ABB42318.1| Flp (type IV) pilus assembly ATPase CpaE homolog [Thiomicrospira
           crunogena XCL-2]
          Length = 414

 Score = 78.6 bits (192), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/278 (19%), Positives = 130/278 (46%), Gaps = 5/278 (1%)

Query: 141 DIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLD 200
           ++ + +S +       KG +G   SF   +GGVG + +A N A  ++ +    T+L DL+
Sbjct: 111 EVFHILSILHMQDRRRKGKNGNVSSFFSLKGGVGCTALATNIASQLSGMTENRTVLVDLN 170

Query: 201 LPYGTAN--INFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYD 258
           +P G  +  +N + + + +++D +Y + R D+  + +    +   L +L+ P+ +    +
Sbjct: 171 MPLGDTSLYLNMEGERLYTLTDFVYNLNRFDENLIYKSLSQHESGLYLLSLPSEMGELDN 230

Query: 259 FDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLI 318
            +  +I  ++  L + F  V++D     +  T   L  SD +V+     L+ LR   ++I
Sbjct: 231 LNADLIKTIIQSLRKYFDHVVIDCSSDLSDVTLSCLDESDNIVLIAEPSLSSLRAVNSVI 290

Query: 319 DVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
            + ++L    +   L++N+  + +     + +    + +  +  +  D   F  S   G+
Sbjct: 291 KLTQRLGYLQESLKLIINRDHSNQDE--MMEEIIGVMDVDRTVRVYNDYQNFNGSLREGQ 348

Query: 379 MIHEVDPKSAIANLLVDFSRVLM-GRVTVSKPQSAMYT 415
           +++   P++ +   L   + +L  G   + +P +A+ T
Sbjct: 349 LLNTFSPEAKVNQQLNAIANMLHNGSFQIEQPATALQT 386


>gi|186474105|ref|YP_001861447.1| response regulator receiver protein [Burkholderia phymatum STM815]
 gi|184196437|gb|ACC74401.1| response regulator receiver protein [Burkholderia phymatum STM815]
          Length = 400

 Score = 78.6 bits (192), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/367 (21%), Positives = 154/367 (41%), Gaps = 17/367 (4%)

Query: 57  NMRITRGSIAEAVSCFSDSSTPDLIIVQ-TKVDSREVLSALEPLAEVCDSGTKVIVIGDT 115
            +R   GS+ +  +  +D  + DL+IV    ++  +++S  E L+ +       +++   
Sbjct: 29  RVRAQHGSVPQLRAHAADIKSADLLIVDDVDLEPHDMVSIEEALSHM--PQLNCMLVTPA 86

Query: 116 NDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGS 175
              +L  A +   V   L  PL        +S +++ +  G    G  +S    +GG G+
Sbjct: 87  PSTALLMAAMRAGVRHVLPWPLDAHAFAAELSHVWSKKTAGTRREGRVVSLTSCKGGTGT 146

Query: 176 STIAHNCAFSIASVFAMETLLADLDLPYGTANINF-DKDPINSISDAIYPVGRIDKAFVS 234
           + IA N A ++A+      LL D++  +  A++   D+ P  +++D    + R+D AF  
Sbjct: 147 TFIAMNVAHALATQRGKRVLLVDVNQQFADASLLVADQTPAATLADLCAQIDRLDNAFFD 206

Query: 235 RLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVL 294
              +   +N  +L       R  +     +  VL +    +  VI+D+    N     VL
Sbjct: 207 ACVMHMNDNFDVLAGAGDPIRAGELRPAQLERVLALARSQYDAVIVDLGLGINPLAIHVL 266

Query: 295 TLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAP 354
             SD++ +     +  LR  + ++D+  +L  A     +++NQ    K   + +  F   
Sbjct: 267 DQSDRICMLVRQSVLYLRAGRRMLDIFNELGYASSKISVLVNQYD--KHAPVDLQAFEQS 324

Query: 355 LGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL-----------MGR 403
            G + +     D    G + + G  I  V   SA+A  +V F+ +L           + R
Sbjct: 325 FGTSIAHRFSRDDKQAGAALDQGLPIMSVAKGSALAQDIVAFAHMLSPAPQKEKKGGLAR 384

Query: 404 VTVSKPQ 410
           +  SKP+
Sbjct: 385 LFASKPR 391


>gi|303248304|ref|ZP_07334566.1| conserved hypothetical protein [Desulfovibrio fructosovorans JJ]
 gi|302490329|gb|EFL50241.1| conserved hypothetical protein [Desulfovibrio fructosovorans JJ]
          Length = 390

 Score = 78.2 bits (191), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 68/305 (22%), Positives = 137/305 (44%), Gaps = 12/305 (3%)

Query: 94  SALEPLAE-VCDSGTK-VIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFT 151
            ALE LAE V   G + V +     D  +   L+   V E+  +P++  ++  ++  +  
Sbjct: 54  EALEALAETVARRGEREVFLTAQAYDAEVLMRLMRQGVREFFPQPVNHEEVRMALWRLKA 113

Query: 152 PQEEG----KGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVF-AMETLLADLDLPYGTA 206
            +E       G  G  I   G++GGVG++T A N A +  ++       L D++LP+G A
Sbjct: 114 RRESRLGPMAGKHGAIIDVFGAKGGVGTTTAAVNIAAACLTLRPGASVALVDMNLPFGEA 173

Query: 207 NINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVP 266
            +  D  P     + +  + R+D  ++  +   +   L +L  P+ L        + I  
Sbjct: 174 QLFLDITPKYHWGEVLGNISRLDATYLMSVMSRHPSGLYLLAPPSRLDDLQMASPENISR 233

Query: 267 VLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRP 326
           +L+++ Q+F  V++D+    +  T +V+ +SD +V+    +L  L N +  ++ +++   
Sbjct: 234 LLELMRQVFDTVVIDLGMYLDEITLKVMDISDAIVLVCVQNLPCLANVRRFLENIRQAEA 293

Query: 327 A--DKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVD 384
              DK   +V   +   +  ++ + D    L +     +P D      + N GK + E  
Sbjct: 294 GLEDKLKIVVNRHL---RDSDLVVEDMEKALSLPVFWRVPNDYPTTLTAINQGKTLLETA 350

Query: 385 PKSAI 389
           PK+ +
Sbjct: 351 PKAPV 355


>gi|90406748|ref|ZP_01214941.1| pilus assembly protein CpaE [Psychromonas sp. CNPT3]
 gi|90312201|gb|EAS40293.1| pilus assembly protein CpaE [Psychromonas sp. CNPT3]
          Length = 406

 Score = 78.2 bits (191), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 124/277 (44%), Gaps = 35/277 (12%)

Query: 109 VIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIIN-SISAIFTPQEE----GKGSSGCS 163
           +IV+G+ + ++ YR L+   V+EYL  PL  AD++N +I  +     E     K   G  
Sbjct: 93  LIVMGENDSINFYRDLLKIGVTEYLTLPLQ-ADLLNEAIHLVLNANTEISGTNKKQQGLR 151

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           IS   ++GG G STI  N A+ +A     +   ADLD   G  +++F+    N + + + 
Sbjct: 152 ISVASAKGGAGCSTILSNLAWQLAEDKKQQVACADLDFVSGDLDLHFNVSANNRLIEMLQ 211

Query: 224 PVGRIDKAFVSRLPVFYAENLSILTA----------PAMLSRTYDFDEKMIVPVLDILEQ 273
              R++     R  +   +NL + +           P +L+    FDE  +       ++
Sbjct: 212 FPDRLEPLVFKRSAIKVTDNLVLFSGYSQQLEQSFWPGLLA----FDEISL-----FCQK 262

Query: 274 IFPLVILDVP--HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK---KLRPAD 328
               ++ D+P   + +S   E L  +D  ++     L+ +R+++ L+D LK    LR   
Sbjct: 263 QVHYLLWDIPSFSLRDSLGFEALASADVCLVVMQPTLSSIRHTQQLLDKLKNRDNLR--- 319

Query: 329 KPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPF 365
               LVLN  K  K   IS  D    LG  P   IP+
Sbjct: 320 --IILVLNHTKPEKSSLISAIDVAQTLGKKPDIEIPY 354


>gi|253701801|ref|YP_003022990.1| response regulator receiver protein [Geobacter sp. M21]
 gi|251776651|gb|ACT19232.1| response regulator receiver protein [Geobacter sp. M21]
          Length = 373

 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 92/359 (25%), Positives = 156/359 (43%), Gaps = 26/359 (7%)

Query: 46  RSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSRE-------VLSALEP 98
           RS I   +   + RIT     E ++    S    L +V   VD  E        L+A  P
Sbjct: 17  RSAILSSLKTFSQRITLAGSVEHLAEERKSQKGALQVVFLGVDEMERGIKDIKALTAQYP 76

Query: 99  LAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAI------FTP 152
            A        VI      +V  + AL+     EYL+ P++  ++I S+  +       TP
Sbjct: 77  RA-------SVIACASEKNVEWFLALMRAGAVEYLLRPIAREELIQSLQKVSRLLFAGTP 129

Query: 153 QEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDK 212
           +E   G     I+     GG+G++T+A N A ++AS    +  L DL+L  G  N   + 
Sbjct: 130 EEHPHGEI---IAVYNPIGGMGTTTVAVNLAAALAS-DDTKVALVDLNLDAGDVNTFLNV 185

Query: 213 DPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILE 272
           +P  ++S     V R+D  F+  +   +A    ILT PA +        + +  V+++L 
Sbjct: 186 NPAYTLSSVTTNVDRLDANFLMSVMTRHASGPFILTEPADVDEAVCITAEQVQRVMEMLR 245

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY 332
            IF  V++D           +   +  ++ TT+L L GL+N+K  +  L++     +   
Sbjct: 246 GIFRYVVVDCVGQLAGCNMAIFQNASLILFTTTLSLPGLKNTKRYLSALERKGLGGERVK 305

Query: 333 LVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIAN 391
           LV+N  +   K +I + D    LG+     IP + A    S N G  + ++ PKS ++ 
Sbjct: 306 LVIN--RYLPKSDIQLKDAEKVLGMPVFQAIPNEYADVVDSINKGMPVVKLQPKSPVSK 362


>gi|167574009|ref|ZP_02366883.1| putative pilus assembly protein CpaE [Burkholderia oklahomensis
           C6786]
          Length = 402

 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 81/350 (23%), Positives = 160/350 (45%), Gaps = 14/350 (4%)

Query: 59  RITR--GSIAEAVSCFSDSSTPDLIIVQT-KVDSREVLSALEPLAEVCDSGTKVIVIGDT 115
           R+TR  G  A+ V         D++++    +D+ E L+A+E L+ +    T V+V  D 
Sbjct: 28  RVTRTVGRAAQIVQRTDGLDAFDILMIDGLALDTAE-LAAIEQLSRLHPGLTCVLVTTDA 86

Query: 116 NDVSLYRALISN--HVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGV 173
           +  +L  A+ +    V  + IEP ++ D +   +A    ++         +SF+  +GG 
Sbjct: 87  SSQTLLDAMRAGVRDVLHWPIEPHALDDALKRAAAQCAQRDTPDTRI---VSFMSCKGGA 143

Query: 174 GSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSISDAIYPVGRIDKAF 232
           G+S +A N A+ IA      TLL DL+  +  A  +  D+ P ++I+     + R+D AF
Sbjct: 144 GTSFVAGNVAYEIAEGSKRRTLLIDLNQQFADAAFLVSDQTPPSTIAQLCGQLERMDGAF 203

Query: 233 VSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQE 292
           +    V   +   +L       +  D  E  +  +L +    +  VI D+    N+ +  
Sbjct: 204 LDASVVRVTDTFHVLAGAGDPLKAADLREDALEWILGVAAPRYDFVIFDLGVSLNAVSMV 263

Query: 293 VLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR-PADKPPYLVLNQVKTPKKPEISISDF 351
            L  SD + +    ++  +R ++ L ++L  L  P D+   ++  Q +T ++   ++ + 
Sbjct: 264 ALDRSDHIEVVLQPNMPHVRAARRLKELLVSLGCPLDRIQLVLNRQTRTSERARTALEEV 323

Query: 352 CAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLM 401
              LG+  + +IP D A  G + + G  +  +     +A  L  F++ L+
Sbjct: 324 ---LGMRAAHVIPDDPAAVGEAVDQGVPLSRLARNCGVARSLQAFAKQLV 370


>gi|330830430|ref|YP_004393382.1| Flp pilus assembly protein FlpE [Aeromonas veronii B565]
 gi|328805566|gb|AEB50765.1| Flp pilus assembly protein FlpE [Aeromonas veronii B565]
          Length = 377

 Score = 77.4 bits (189), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 83/372 (22%), Positives = 159/372 (42%), Gaps = 43/372 (11%)

Query: 57  NMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTN 116
           ++++T GS+AEA +       PD+++V+ + + + + + L  LAE C    +++++G+  
Sbjct: 33  HLQLT-GSLAEARAHCLAHGAPDILLVEVE-NQQTLAADLAALAECCPPQMRLVLLGERG 90

Query: 117 DVSLYRALISNHVSEYLIEPL-----SVADIINSISAIFTPQEEGKGSSGCSISFIGSRG 171
           DV+L+R LIS  V +Y   PL         +      + T   +G+      I  +G+ G
Sbjct: 91  DVALFRWLISVGVDDYYPAPLDPDALRAGLLRLLGVPLVTSLRKGR-----VICVVGAAG 145

Query: 172 GVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKA 231
           GVG+ST+  N A  +A     +  L DL+L +    I    D             R+D  
Sbjct: 146 GVGTSTVCANLALELAEQHHRQVALLDLNLYHSRHPILLGSDYAPPGEQWWQATDRLDGT 205

Query: 232 FVS--------RLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVP 283
            ++        RL +FY E   ++              + +V  ++++ + +  +I+DVP
Sbjct: 206 LLAHTAHQLGPRLFLFYDEGAELV-----------LGAEQLVAAVNVMAEHYSTLIIDVP 254

Query: 284 HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQV--KTP 341
            + +   + +L  +D V+      L  LR   NL    +  R       LV N    K  
Sbjct: 255 DLRSHGLRALLQEADVVIWLHDFSLGALRLLGNLPKGGQAQR-----HLLVGNHCRGKEA 309

Query: 342 KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLM 401
           + P   +   C   G   +A++P+D   F  +  +G  +  +  KS +A  +   +  L+
Sbjct: 310 RVPAAELDRVC---GQPHAAVLPYDHGAFVRAERAGMAL--IKQKSKLARAIKWLAAELV 364

Query: 402 GRVTVSKPQSAM 413
           G     + +  +
Sbjct: 365 GTQPAGRRRGGL 376


>gi|167566940|ref|ZP_02359856.1| putative pilus assembly protein CpaE [Burkholderia oklahomensis
           EO147]
          Length = 402

 Score = 77.0 bits (188), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 81/350 (23%), Positives = 160/350 (45%), Gaps = 14/350 (4%)

Query: 59  RITR--GSIAEAVSCFSDSSTPDLIIVQT-KVDSREVLSALEPLAEVCDSGTKVIVIGDT 115
           R+TR  G  A+ V         D++++    +D+ E L+A+E L+ +    T V+V  D 
Sbjct: 28  RVTRTVGRAAQIVQRTDGLDAFDILMIDGLALDTAE-LAAIEQLSRLHPGLTFVLVTTDA 86

Query: 116 NDVSLYRALISN--HVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGV 173
           +  +L  A+ +    V  + IEP ++ D +   +A    ++         +SF+  +GG 
Sbjct: 87  SSQTLLDAMRAGVRDVLHWPIEPHALDDALKRAAAQCAQRDTPDTRI---VSFMSCKGGA 143

Query: 174 GSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSISDAIYPVGRIDKAF 232
           G+S +A N A+ IA      TLL DL+  +  A  +  D+ P ++I+     + R+D AF
Sbjct: 144 GTSFVAGNVAYEIAEGSKRRTLLIDLNQQFADAAFLVSDQTPPSTIAQLCGQLERMDGAF 203

Query: 233 VSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQE 292
           +    V   +   +L       +  D  E  +  +L +    +  VI D+    N+ +  
Sbjct: 204 LDASVVRVTDTFHVLAGAGDPLKAADLREDALEWILGVAAPRYDFVIFDLGVSLNAVSMV 263

Query: 293 VLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR-PADKPPYLVLNQVKTPKKPEISISDF 351
            L  SD + +    ++  +R ++ L ++L  L  P D+   ++  Q +T ++   ++ + 
Sbjct: 264 ALDRSDHIEVVLQPNMPHVRAARRLKELLVSLGCPLDRIQLVLNRQTRTSERARAALEEV 323

Query: 352 CAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLM 401
              LG+  + +IP D A  G + + G  +  +     +A  L  F++ L+
Sbjct: 324 ---LGMRAAHVIPDDPAAVGEAVDQGVPLSRLARNCGVARSLQAFAKQLV 370


>gi|227326304|ref|ZP_03830328.1| hypothetical protein PcarcW_02914 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 399

 Score = 76.6 bits (187), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 83/358 (23%), Positives = 154/358 (43%), Gaps = 16/358 (4%)

Query: 29  ISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVD 88
           +++ +    + +  V + S +  R+ Q ++ +  G IA A      +  P +++V  +  
Sbjct: 12  LALPLVAFANDVRDVADLSDLFTRLKQPDVPVMSGGIAAARQWCELNVPPRILLVDLE-G 70

Query: 89  SREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISA 148
           +   L ALE L  VC   ++VI IG   DV LYRAL+   V +YL++PL++  +  +++ 
Sbjct: 71  AHWPLPALEELLSVCGPTSQVIAIGKEQDVGLYRALLQAGVVDYLVKPLTLDLLAATLAK 130

Query: 149 IFTPQEEGK--GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTA 206
               Q+ G      G +I+ + + GG G+ST+A   +  ++    +   L D D      
Sbjct: 131 C-EGQQAGPEYARMGRTIAIVSASGGSGASTVAMGLSRLLSGERHLPVALVDFD------ 183

Query: 207 NINFDKDPINSISD-----AIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDE 261
             N D+  +   +D     A+     +D   + R  +     L +L     L      D 
Sbjct: 184 RRNGDQLLLQGQTDDAGLAAVLGTQELDTRLLQRAMLRVDTRLHLLAQKPELGELAPVDV 243

Query: 262 KMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL 321
             ++ +   L ++F  VI D+P  + +   +VLT +D  +I T L L   RN + +++ +
Sbjct: 244 DNVLNLGGALCRMFNQVIWDLPGSYPTGALDVLTYADLRIIVTELTLQDARNVRRVLNEI 303

Query: 322 KKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKM 379
                  +   LV NQ +      +S   F    G     ++P  G     S   G +
Sbjct: 304 GDESEGQR-LLLVHNQSRFATTAPLSRDQFEQFTGRKIDVVLPNAGHALSQSLTLGAL 360


>gi|330811034|ref|YP_004355496.1| response regulator, CheY family [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379142|gb|AEA70492.1| Putative response regulator, CheY family [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 406

 Score = 76.6 bits (187), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 80/347 (23%), Positives = 153/347 (44%), Gaps = 12/347 (3%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPL 137
           PDL++++     RE LSAL  L         ++V G   +    R  +     + L EP+
Sbjct: 65  PDLLLLRVSHLWREELSAL--LQRPAHERPPMLVCGPLGEQEGMRLAMQAGARDVLPEPI 122

Query: 138 SVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLA 197
           +  +++ +++ +      G G+ G  ++ I ++GG G + +A N A  + S  A  TLL 
Sbjct: 123 ADTELVAALNRLVADVRLGSGNEGKLVAVISAKGGSGGTLVACNLAQQL-SARAGNTLLL 181

Query: 198 DLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPA-MLSRT 256
           D+DL +G+     D    +S  + +  +  +D   +      ++  L +L   A  L   
Sbjct: 182 DMDLQFGSVTHYLDVAQSHSHLEVLQQIDDMDSVALRGFCSHFSPTLHVLGGRAGELCLP 241

Query: 257 YDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKN 316
            D   + +  +L +    +  V++D+P   +  T  VL   D+V +     ++ LR++  
Sbjct: 242 QDAQPEQLDALLQLARASYDWVVVDLPRQIDHLTGSVLEQVDRVYVVVQQSVSHLRDASA 301

Query: 317 LIDVLKK-LRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSAN 375
           L+ +L++ L        +V+N  +  K   +S+ D    L  T  + +P D  +   S N
Sbjct: 302 LVRILREDLGVRGDQLQIVIN--RYDKNAAVSLKDIGEALRCTNLSKLPNDFNLVSQSQN 359

Query: 376 SGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFN 422
           +G  +    PK+AI   L D +  L+G    +         +K+ FN
Sbjct: 360 TGVPLGLHAPKAAITAALRDLTEDLVGHQMATDK-----GLLKRAFN 401


>gi|197123316|ref|YP_002135267.1| Flp pilus assembly protein ATPase CpaE-like protein
           [Anaeromyxobacter sp. K]
 gi|196173165|gb|ACG74138.1| Flp pilus assembly protein ATPase CpaE-like protein
           [Anaeromyxobacter sp. K]
          Length = 377

 Score = 76.6 bits (187), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 70/309 (22%), Positives = 139/309 (44%), Gaps = 6/309 (1%)

Query: 94  SALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQ 153
            A   +A +  SGT+V V+G   D  L    +     EY +     A +  ++ ++  P 
Sbjct: 57  GAFATVARLSASGTRVAVVGPAKDPDLILRAMRAGAREYAVAG-DAARLQLAVRSLARP- 114

Query: 154 EEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKD 213
            +G  ++G  ++   ++GG+G++T+A N A  +       T L DLDL  G  N   D  
Sbjct: 115 -DGAAAAGQVLAIFPAKGGMGATTLAANLAADLVR-GGDRTCLVDLDLQLGDVNAFLDVH 172

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
              +I+D +  + R+D+  +    + +   + +L     L      D   +  ++  L +
Sbjct: 173 GGYTITDVVANMRRLDRELLDASVIAHRSGVHVLAQEERLEEAEHLDAPAVEKLIAFLRE 232

Query: 274 IFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYL 333
            +  ++LD    ++  +   L  +D+VV+  + ++  +RN++  +++ +KL   D    +
Sbjct: 233 HYQHLVLDGLRGFDERSLAALDAADRVVLVVTQEVPAVRNAQRCVELFRKLGYPDAKLAI 292

Query: 334 VLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
           V+N  +  +   I+       LG+  +A +  D A    +   G  I E  P+SA+A  L
Sbjct: 293 VVN--RCLRSSNITPEVIAETLGVPVTATVANDFASASRAVQRGSTILEEAPRSALARDL 350

Query: 394 VDFSRVLMG 402
              +R L G
Sbjct: 351 STLARQLSG 359


>gi|328474275|gb|EGF45080.1| putative pilus assembly protein [Vibrio parahaemolyticus 10329]
          Length = 402

 Score = 76.6 bits (187), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 77/348 (22%), Positives = 158/348 (45%), Gaps = 11/348 (3%)

Query: 76  STPDLIIVQTKVD-SREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLI 134
           S PDLI ++T  + +++V       + +  S T +IV GD +D +  +  +    ++Y  
Sbjct: 63  SIPDLIYIETGENWAQKVAHVYSSDSSLQHSHTALIVFGDESDTASLKMALRLGATDYFS 122

Query: 135 EPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMET 194
             + + ++   + +    +   K     ++ FI ++GG G++T+A N A  ++S    + 
Sbjct: 123 RSVELGELYPLLKSTAEEKVSNKQMGDLTL-FINTKGGSGATTLATNTAIELSSYAKSKV 181

Query: 195 LLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLS 254
           LL DLD+ +  A    +  P  +I+D I  V  +D+  +  L   +   L+ L       
Sbjct: 182 LLIDLDMQFSDAADYLNCKPKYNINDVIDSVNDLDELSLEGLVYQHPSGLNYLCFNQNDP 241

Query: 255 RTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNS 314
           R        +  +L IL Q +  +I+D+ H  +   Q++++ +  + +    ++  ++++
Sbjct: 242 RNNHKHAAQVSKLLPILRQFYSHIIVDLSHGVDHVYQQIVSPATHIFLIMQQNVTSVKHA 301

Query: 315 KNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMS 373
            + I  L+     ++    L++N+ +  KK  IS+ D    +G     ++P + A+   S
Sbjct: 302 VSYIRSLELDYGLSNHQVELIVNRFE--KKSTISLKDIENAVGGHAIHLVPNNFAIAIES 359

Query: 374 ANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIF 421
           AN G  I +    SA+   L + S +L        P     + IKK F
Sbjct: 360 ANLGNPIVQSKKNSALKASLAEISHLL------ESPTQEHQSWIKKFF 401


>gi|283778974|ref|YP_003369729.1| response regulator receiver protein [Pirellula staleyi DSM 6068]
 gi|283437427|gb|ADB15869.1| response regulator receiver protein [Pirellula staleyi DSM 6068]
          Length = 425

 Score = 76.3 bits (186), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 107/234 (45%), Gaps = 6/234 (2%)

Query: 75  SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVI------GDTNDVSLYRALISNH 128
           S +PDL++V+   +   + S    L  +    T   V        D ++ ++    I   
Sbjct: 49  SRSPDLVLVEMGRNLAALKSVTMELNSISPEMTVAAVFRPDVFGNDVSESAIVIEAIRAG 108

Query: 129 VSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIAS 188
           V ++L  P+S  ++ + +              G  ISFI ++GGVG ST+A N A  +A 
Sbjct: 109 VKDFLRRPVSTVELQDLLDRTRKQSARVSAPLGRVISFISNKGGVGKSTLAVNSACGLAQ 168

Query: 189 VFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILT 248
           ++    LL D  L  G A    D +P  +++DA+    R+D+ F+ +L   +   L +L 
Sbjct: 169 LYPGRVLLIDASLQLGVAASMLDLNPSATLTDAVRESSRLDEMFLRQLTAVHESGLHVLA 228

Query: 249 APAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVI 302
           AP       + D++ I  ++ +  + +  VI+D   +++     +L LSD+  +
Sbjct: 229 APRDAIEAAEVDDESISRIITLGRRSYDFVIVDTFPLFDRVVIAILDLSDRAYV 282


>gi|297618079|ref|YP_003703238.1| response regulator receiver protein [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297145916|gb|ADI02673.1| response regulator receiver protein [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 406

 Score = 76.3 bits (186), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 76/322 (23%), Positives = 140/322 (43%), Gaps = 16/322 (4%)

Query: 67  EAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALIS 126
           EAV   + +  PD+I++   +   + + A E ++      + +I+        L RA+++
Sbjct: 40  EAVE-LARAMAPDVILMDINMPEMDGIRATELISMEFPEISVIIISVQGEQEYLKRAMLA 98

Query: 127 NHVSEYLIEPLSVADIINSISAIF----------TPQEEGKGSSGCSISFIGSRGGVGSS 176
               EYLI+P +  ++ +++  +             Q E K      ++   ++GGVG +
Sbjct: 99  G-AQEYLIKPFTADELASTVKRVVELNRKRRERQKAQAEAKNHQPKIVTVFSTKGGVGKT 157

Query: 177 TIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRL 236
            I  N A ++A     +  L DLDL +G   +  +  P  +I++ +     ID   +   
Sbjct: 158 LICTNLAVALARQTGEKVGLVDLDLQFGDVAVMMNVYPKRTIAELMQEQYEIDAELLENY 217

Query: 237 PVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTL 296
            ++    + +L AP             +  VL    +    V++D P V+N  T   L  
Sbjct: 218 -LYERHGVKVLAAPNKPELAELVTPDGVARVLKAFVKNHDYVLVDTPPVFNDTTLVALDA 276

Query: 297 SDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLG 356
           SD++++  +LDL  ++N K  +D+LK L    K   LVLN+    +   I   D    L 
Sbjct: 277 SDRILLVATLDLPTVKNIKRSVDILKTLGLLPKVK-LVLNRASGAQS--IEPEDVERVLE 333

Query: 357 ITPSAIIPFDGAVFGMSANSGK 378
           I   A +P +G +   S N G+
Sbjct: 334 IKIEAYLPSEGKLALQSVNRGQ 355


>gi|239814534|ref|YP_002943444.1| response regulator receiver protein [Variovorax paradoxus S110]
 gi|239801111|gb|ACS18178.1| response regulator receiver protein [Variovorax paradoxus S110]
          Length = 383

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 111/245 (45%), Gaps = 5/245 (2%)

Query: 160 SGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTA-NINFDKDPINSI 218
           +G  ++F+ S+GG G++ +A N    ++       LL DL+L +G A +   D  P +++
Sbjct: 128 AGQVVAFMPSKGGSGATFLATNIGHQLS--MRRSVLLIDLNLQFGDALSYVSDLRPTSTL 185

Query: 219 SDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLV 278
           +D    +GR+D + ++   V  A   SIL AP  LSR  +   + I  +L +    +  V
Sbjct: 186 ADVARDIGRLDASLLAASTVKVAPGFSILAAPEDLSRALEVKAEHIDAILQVAAAQYDFV 245

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQV 338
           + D+    +     VL  +D++       L  +RN   L+ V K L        L++N  
Sbjct: 246 LFDLGLRIDPLAIRVLDRADRIFPVLQPSLPHIRNVTRLMQVFKSLGYPSGKVELLVN-- 303

Query: 339 KTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSR 398
           ++    EI +SD    LG      +P  G     S N G  + E+   SA+   LV+ + 
Sbjct: 304 RSAGGTEIGLSDMRRSLGGATLVSVPDGGKDVDASINRGVPLAEMSRGSALCKRLVEIAH 363

Query: 399 VLMGR 403
            L  R
Sbjct: 364 TLSPR 368


>gi|283779856|ref|YP_003370611.1| response regulator receiver protein [Pirellula staleyi DSM 6068]
 gi|283438309|gb|ADB16751.1| response regulator receiver protein [Pirellula staleyi DSM 6068]
          Length = 411

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 76/335 (22%), Positives = 148/335 (44%), Gaps = 8/335 (2%)

Query: 72  FSD---SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNH 128
           F+D    + PD+ ++    +  + L  +E +         ++V   ++  ++ RA+ +  
Sbjct: 42  FADVIGQTKPDIGVISIDSNPEKGLKLIEQIHISAPDCALLVVSSSSDGQTILRAMRAG- 100

Query: 129 VSEYLIEPLSVADIINSISAIFTPQ---EEGKGSSGCSISFIGSRGGVGSSTIAHNCAFS 185
             E+L +P+ V D+++++  I + +    EG+  S   I+  G+ GGVG++++A N    
Sbjct: 101 AKEFLTQPIRVEDLLHALDRIGSQKFGAGEGRTRSCHVIAVAGATGGVGTTSLAVNLGCV 160

Query: 186 IASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLS 245
           +A+      +L DLDL  G A++  D  P  ++ D    + R+D   + R    ++  L 
Sbjct: 161 LAAEPRNSVVLVDLDLSLGDADVFLDTIPDYTLVDVAQNISRLDFTLLKRSLTKHSSGLY 220

Query: 246 ILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTS 305
           +L  P  L  T       +  VL +L+  F  +ILD+   +       L  +  +++ T 
Sbjct: 221 LLPRPVQLQDTALITPDDLTRVLGLLKASFTHMILDLSKGYTPADFVALKSAKDILLVTQ 280

Query: 306 LDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPF 365
           LDL  LRN   L+    +         +V+N+V       IS+      +G      +P 
Sbjct: 281 LDLPCLRNVVRLMMSFGETEGLKDKVKIVVNRVGL-DTGSISVKKAQETMGREIYWQLPN 339

Query: 366 DGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
           D        N+G  + E  P+++I   +V  +  L
Sbjct: 340 DYRTMVEVRNNGVPLIEQAPRASITQAVVTLAEAL 374


>gi|156744074|ref|YP_001434203.1| response regulator receiver protein [Roseiflexus castenholzii DSM
           13941]
 gi|156235402|gb|ABU60185.1| response regulator receiver protein [Roseiflexus castenholzii DSM
           13941]
          Length = 419

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 80/361 (22%), Positives = 152/361 (42%), Gaps = 27/361 (7%)

Query: 59  RITRGSIAEAVSCFSDSSTPDLIIVQTKVDS-----REVLSALEPLAEVCDSGTKVIVIG 113
           R+ R +   A       + PDL+IV    D      R+V + L   A +C      I + 
Sbjct: 34  RVDRVAATTAGFELIQQTRPDLVIVDRDTDQAEQLIRQVFTTLP--ATIC------IAVT 85

Query: 114 DTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSS------------G 161
              D +  R L++    + L  P+  A++  SI  +   + + +  +            G
Sbjct: 86  ARVDTATLRRLVAVGARDVLGRPIQYAELSQSIRTLLDTETDRRARALVTLNGNRPQMRG 145

Query: 162 CSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDA 221
             +  I  +GG G++TIA N A  +  V A   LLAD  L +G A ++ +    +++ D 
Sbjct: 146 KLVVVISPKGGSGTTTIAANLAVGLRQVSASRVLLADCCLQFGDAGVHLNLWSKHTLVDF 205

Query: 222 IYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILD 281
           I  +  ID A +  +   +     +L AP       D   + I  ++D L + +  V+ D
Sbjct: 206 IDHLDDIDDAMIGSVVQQHESGTHVLLAPNTPDAAGDISGEQISRLIDALLERYSYVVAD 265

Query: 282 VPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTP 341
                +  T  +++ +++ ++ T+ ++  L+N K  ++ +++         LV+N  + P
Sbjct: 266 TWSFLDDITATLVSKANETLVVTTPEVPSLKNVKRFLEFIQREGLTHGRITLVIN--RFP 323

Query: 342 KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLM 401
               I++ D    L     A IP +G +   S N G  I    P+S +   L+  +  + 
Sbjct: 324 SVDGIALDDVKQHLRHPIGANIPSEGRLVTHSVNRGIPIVISHPESWVGQSLLKLAAHIA 383

Query: 402 G 402
           G
Sbjct: 384 G 384


>gi|260776713|ref|ZP_05885608.1| type II/IV secretion system ATPase TadZ/CpaE associated with Flp
           pilus assembly [Vibrio coralliilyticus ATCC BAA-450]
 gi|260607936|gb|EEX34201.1| type II/IV secretion system ATPase TadZ/CpaE associated with Flp
           pilus assembly [Vibrio coralliilyticus ATCC BAA-450]
          Length = 407

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 78/338 (23%), Positives = 153/338 (45%), Gaps = 8/338 (2%)

Query: 69  VSCFSDSSTPDLIIVQTKVDSREVLSALEPLA--EVCDSGTK--VIVIGDTNDVSLYRAL 124
           VS  S  S PDLI V+T  +  + +  L+     +  +SG +  +IV G+ ND    +  
Sbjct: 58  VSNLSHFSPPDLIFVETGPNWAQKIVELQQYEAPDSAESGHEASLIVFGNENDNGALKIA 117

Query: 125 ISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAF 184
           +    ++++ +   + +++  +  +   +   +   G  + F+ ++GG G+S IA N A 
Sbjct: 118 LRIGAADFISDKAMLDELVPLLKNVAEDKVANR-HLGELMVFMNTKGGAGASMIALNTAI 176

Query: 185 SIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENL 244
           +IA       LL DLD+ +G      +      ++DAI  V  +D   +  L   +   L
Sbjct: 177 TIAKQNPEHVLLLDLDMQFGVIEDYLNIHSTYGLADAIANVADLDDVSLGSLVTKHESGL 236

Query: 245 SILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITT 304
            ++      S         +  ++ +L + +P VI+D+    +     V++ + KV + T
Sbjct: 237 HVIGFKRESSHENFEKANQLNKLIPVLREQYPYVIVDLSRGLDRTFTSVISPATKVFMIT 296

Query: 305 SLDLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAII 363
             +L  ++N+  L+ +L  +L  + +   +V+N+ +  K+  I + D    +G  P   I
Sbjct: 297 QQNLVAIKNTTQLLKLLTFELGVSKEQMEVVVNRFE--KRQSIKLKDIQDTVGNIPIHTI 354

Query: 364 PFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLM 401
           P +  V   SAN G+   +    SAIA  +   +  LM
Sbjct: 355 PNEFKVAIESANLGRPYIQARKGSAIAKSVRKLAATLM 392


>gi|148259831|ref|YP_001233958.1| response regulator receiver protein [Acidiphilium cryptum JF-5]
 gi|326403241|ref|YP_004283322.1| hypothetical protein ACMV_10930 [Acidiphilium multivorum AIU301]
 gi|146401512|gb|ABQ30039.1| response regulator receiver protein [Acidiphilium cryptum JF-5]
 gi|325050102|dbj|BAJ80440.1| hypothetical protein ACMV_10930 [Acidiphilium multivorum AIU301]
          Length = 403

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 72/262 (27%), Positives = 119/262 (45%), Gaps = 4/262 (1%)

Query: 60  ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS 119
           I RG++  A++  +   TP +++V    D R + + LE L +V +    ++VIG+ +DV 
Sbjct: 56  IRRGNLKAAIAALAKVPTPQIVVVDIGKDERPMHALLE-LCDVIEPSVSLLVIGEVDDVD 114

Query: 120 LYRALISN-HVSEYLIEPLSVADIINSISAIFTPQE--EGKGSSGCSISFIGSRGGVGSS 176
           LYR +I      +YL +P++   +    +++ T           G  IS  G+RGGVG S
Sbjct: 115 LYRNIIRRVGAIDYLFKPITRELVARHFASLITRNSPVADLTRGGRVISVTGARGGVGGS 174

Query: 177 TIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRL 236
           TIA   A+ +       TLL D D   GTA   F  +   S    +   G    A V+  
Sbjct: 175 TIAAALAWYLGVESNRHTLLLDADPFIGTAQDWFGVEFKPSFQTLLQDAGDDPGAAVAGA 234

Query: 237 PVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTL 296
                  L +L +P  L+            ++D +   F  VI+D+P +     +E+L L
Sbjct: 235 VRPVRNRLHVLGSPPDLACQPAASAGAARRIIDAIRMRFNFVIVDLPFLPIQQHRELLEL 294

Query: 297 SDKVVITTSLDLAGLRNSKNLI 318
           +   +I     +A LR++  LI
Sbjct: 295 AHHRIIVLDPSIASLRDTVRLI 316


>gi|134299961|ref|YP_001113457.1| response regulator receiver protein [Desulfotomaculum reducens
           MI-1]
 gi|134052661|gb|ABO50632.1| response regulator receiver protein [Desulfotomaculum reducens
           MI-1]
          Length = 412

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 79/339 (23%), Positives = 143/339 (42%), Gaps = 18/339 (5%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPL 137
           PD+I++   +   + + + E +   C   + +IV        L RA+ +    EYL++P 
Sbjct: 50  PDVILMDINMPKLDGIQSTEKIVNSCPECSIIIVSIQGEQEYLRRAMAAG-AREYLVKPF 108

Query: 138 S---VADIINSISAIFTPQ-----------EEGKGSSGCSISFIGSRGGVGSSTIAHNCA 183
           S   +AD I  +  I T +              K   G  I+   S+GGVG +T+A N  
Sbjct: 109 SSNELADTIRKVYEINTKRLSLVGLHSQASPRIKTPKGRIITLFCSKGGVGKTTLAANLT 168

Query: 184 FSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAEN 243
            ++A     + +L DLDL  G   +  +     +I++        D + V    V +   
Sbjct: 169 IALAQTTKKKVILLDLDLHGGDVGVMLNVSARGTIAELAQESDPYDMSLVDSYLVPHLSG 228

Query: 244 LSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVIT 303
             IL AP    +      + +  +L++L++ F  +++D   V+N      L  + ++++ 
Sbjct: 229 AKILPAPTSPEQAELITLERVEELLNLLQENFDYIVIDTSPVFNDINLASLDAAHQILVL 288

Query: 304 TSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAII 363
            + DL  +++ K  ID+L  L  +DK   LV+N         I +SD    L  +  A I
Sbjct: 289 LTQDLPCVKHVKTNIDILSTLGHSDK-IRLVVNCAGVDGG--IKVSDLEKSLNHSAYATI 345

Query: 364 PFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMG 402
           P +  V   + N G         S +   ++D +  L G
Sbjct: 346 PLEEKVVRSAINKGLPFVMTQANSKVTEAILDLATKLSG 384


>gi|153834068|ref|ZP_01986735.1| Flp pilus assembly protein [Vibrio harveyi HY01]
 gi|148869623|gb|EDL68613.1| Flp pilus assembly protein [Vibrio harveyi HY01]
          Length = 402

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 83/348 (23%), Positives = 156/348 (44%), Gaps = 15/348 (4%)

Query: 78  PDLIIVQTKVDS--REVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIE 135
           PDLI ++T  DS  ++V       + +  + T +IV GD  D +  +  +    ++Y   
Sbjct: 65  PDLIYIETG-DSWAQKVAHVYSSDSNLQHNHTALIVFGDEADTASLKMALRLGATDYFSR 123

Query: 136 PLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETL 195
              + +I   + +I   +   K     ++ FI ++GG GS+T+A N A  ++S      L
Sbjct: 124 SADLEEIYPLLKSIAEEKIYNKKMGDLTL-FINTKGGSGSTTLALNTAIELSSYAKSNVL 182

Query: 196 LADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILT-APAMLS 254
           L DLD+ +  A    +  P  +I+D +  V  +D+  +  L   +   L+ L      L 
Sbjct: 183 LVDLDMQFSDAADYLNCKPKYNINDVVESVNDLDELSLEGLVHKHPSGLNYLCFEQGNLK 242

Query: 255 RTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNS 314
             Y +  + +  +L IL Q +  +I+D+ H      Q++++ +  V +    ++  ++++
Sbjct: 243 NNYKYANE-VSKLLPILRQFYSHIIVDMSHGIEHTFQQIVSPATHVFLVMQQNVTSVKHA 301

Query: 315 KNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMS 373
            N I  L+      +    L++N+ +  KK  IS+ D    +G     ++P + A+   S
Sbjct: 302 VNYIRALELDYGLNNHQVELIVNRFE--KKSTISLKDIENAVGGHSIHLVPNNFAIAIES 359

Query: 374 ANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIF 421
           AN G  I +    SAI   L + S +L        P     + IKK F
Sbjct: 360 ANLGNPIVQSTKNSAIKASLAEISHLL------ESPTKKDQSWIKKFF 401


>gi|254475484|ref|ZP_05088870.1| response regulator receiver protein [Ruegeria sp. R11]
 gi|214029727|gb|EEB70562.1| response regulator receiver protein [Ruegeria sp. R11]
          Length = 409

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 79/335 (23%), Positives = 144/335 (42%), Gaps = 29/335 (8%)

Query: 67  EAVSCFSDSSTPDLIIVQTKVDSRE-----VLSALEPLAEVCDSGTKVIVIGDTNDVSLY 121
           EA++ F+ S    L  V   +DS +     ++  +  + E      KVI+I +    +  
Sbjct: 47  EALAFFNQSEAEALEFVALALDSEDESNLALMGTI--ITEAKARNIKVILIAEDVTPTAL 104

Query: 122 RALISNHVSEYLIEPLSVADIINSISAIF--------TPQEEGKGSS---GCSISFIGSR 170
            +L+     E++  PL   ++ ++I  +          PQ + K  S   G  I   G  
Sbjct: 105 HSLLRQGADEFIPYPLPEQELQSAIERLRMAEAERHQEPQHQLKSGSKRDGAVIVCHGLA 164

Query: 171 GGVGSSTIAHNCAFSIASVFAMET---LLADLDLPYGTANINFDKDPINSISDAIYPVGR 227
           GG GS+T+A N A+ +A + + ET    L DLDL YG+     D      + + +     
Sbjct: 165 GGCGSTTMAVNLAWELAQLSSSETPSVCLLDLDLQYGSVATYLDLPRREVVMEMLSETET 224

Query: 228 IDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWN 287
           +D+    +  V + + L +LTAP  +        + I  V+++    F  V++D+PH   
Sbjct: 225 LDEDVFGQALVTFQDKLQVLTAPVDMIPLDFITPEDIERVIELARSHFDFVVIDMPHTLV 284

Query: 288 SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP-PYLVLNQVKTPKKPEI 346
            W++ VL ++        LD   +R+++N + + + L+  D P   L     + PK  ++
Sbjct: 285 QWSETVLNMAHVYFSMLELD---MRSAQNALRLKRALQSEDLPFEKLRFALNRAPKFTDL 341

Query: 347 S----ISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
           S    +      LGI+    +P  G     S + G
Sbjct: 342 SGKSRVKRMAESLGISIDLQLPDGGKQVAQSCDHG 376


>gi|197117445|ref|YP_002137872.1| Flp pilus assembly response receiver ATPase CpaE [Geobacter
           bemidjiensis Bem]
 gi|197086805|gb|ACH38076.1| Flp pilus assembly response receiver ATPase CpaE, FlhG
           domain-containing protein [Geobacter bemidjiensis Bem]
          Length = 373

 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 75/289 (25%), Positives = 133/289 (46%), Gaps = 12/289 (4%)

Query: 109 VIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAI------FTPQEEGKGSSGC 162
           VI      +V  + AL+     EYL+ P++  ++I S+  +       TP+E   G    
Sbjct: 80  VIACASEKNVEWFLALMRAGAVEYLLRPIAHEELIQSLQKVSRLLFAGTPEERPHGEI-- 137

Query: 163 SISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAI 222
            I+     GG+G++T+A N A ++AS    +  L DL+L  G  N   + +P  ++S   
Sbjct: 138 -IAVYNPIGGMGTTTVAVNLAAALAS-DDTKVALVDLNLDAGDVNTFLNVNPAYTLSSVT 195

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDV 282
             V R+D  F+  +   +A    ILT PA +        + +  V+++L  IF  V++D 
Sbjct: 196 TNVDRLDANFLMGVMTRHASGPFILTEPADVDEAVCITAEQVQRVMEMLRGIFRYVVVDC 255

Query: 283 PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPK 342
                     +   +  ++ TT+L L GL+N+K  +  L++     +   LV+N  +   
Sbjct: 256 VGQLAGCNMAIFQNASLILFTTTLSLPGLKNTKRYLSALERKGLGGERVKLVIN--RYLP 313

Query: 343 KPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIAN 391
           K +I + D    LG+     IP + A    S N G  + ++ PKS ++ 
Sbjct: 314 KSDIQLKDAEKVLGMPVFQAIPNEYADVVDSINKGMPVVKLQPKSPVSK 362


>gi|187919326|ref|YP_001888357.1| putative pilus assembly protein CpaE [Burkholderia phytofirmans
           PsJN]
 gi|187717764|gb|ACD18987.1| putative pilus assembly protein CpaE [Burkholderia phytofirmans
           PsJN]
          Length = 400

 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 132/299 (44%), Gaps = 22/299 (7%)

Query: 129 VSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIAS 188
           V   L  PL+ A+I ++++ +   +  G    G  +SF   +GG G++ IA N A+++A+
Sbjct: 100 VRHVLSWPLNDAEIADALAHVSAKKHGGTRRDGRVVSFTSCKGGSGTTLIAVNLAYALAA 159

Query: 189 VFAMETLLADLDLPYGTANINF-DKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSIL 247
           +     LL DL+  +  A++   DK P  +++D    + R+D AF     +    NL +L
Sbjct: 160 LRDKRVLLIDLNQQFADASLLVADKAPPATLADLCSQIDRLDAAFFESCVMHVHANLDVL 219

Query: 248 TAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLD 307
                  ++ +     +  +L ++ + +  V++DV    N      L  SD + +    +
Sbjct: 220 AGAGDPVKSGELRAAHLERILTLVREQYDAVLIDVGQNINPLAIHALDHSDSICMVVRQN 279

Query: 308 LAGLRNSKNLIDVLKKL-RPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFD 366
           +  L   + ++D+ K+L  PA K   +V NQ    K   I+++      G   +  +P D
Sbjct: 280 ILYLHAGRRMLDIFKELGYPASKVKVIV-NQYD--KNARINLATLEETFGAKVAHHLPRD 336

Query: 367 ----------GAVFGMSANSGKMIHEVDPKSAIANLL----VDFSRVLMGRVTVSKPQS 411
                     G      A  G +   +   S +A LL    V   R ++GR+  S+P S
Sbjct: 337 EKQATEALNHGVPLVTGAKGGALAQGI---SQLAALLWPLPVAERRSVLGRLFQSRPNS 392


>gi|89899608|ref|YP_522079.1| response regulator receiver domain-containing protein [Rhodoferax
           ferrireducens T118]
 gi|89344345|gb|ABD68548.1| response regulator receiver domain protein [Rhodoferax
           ferrireducens T118]
          Length = 391

 Score = 74.7 bits (182), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 81/335 (24%), Positives = 151/335 (45%), Gaps = 12/335 (3%)

Query: 69  VSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNH 128
           V    + S PDL++V+T   + +   ALE LA        V+V  + +   L RA+ +  
Sbjct: 38  VKVIFNGSRPDLVLVETA--TPQDFEALEALANAHPEIDYVLVGNELSPEFLLRAMRAG- 94

Query: 129 VSEYLIEPLSVADIINSISAIFTPQEEG----KGSSGCSISFIGSRGGVGSSTIAHNCAF 184
           V E L  P +   ++ ++      +              ++ +  +GG G++ IA N A 
Sbjct: 95  VREVLPSPAAPEAVLAALRRQLRKRAPATVLPATHHAEVLALVSCKGGSGATFIAANLAH 154

Query: 185 SIASVFAMETLLADLDLPYGTANINFD-KDPINSISDAIYPVGRIDKAFVSRLPVFYAEN 243
            +A+    +  L D++L +G A +    + P+++++D    + R+D   +       A  
Sbjct: 155 LLAAGGQRQVALIDMNLQFGDAALFVSSQTPVSNVADVARNINRLDADLLRSSMTEVAPG 214

Query: 244 LSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVIT 303
           L +L AP   ++  D   + +  ++++  ++F  VI+DV    +S T + L L+D+V   
Sbjct: 215 LWVLAAPDDPAQATDVTPQHVRQIVELAREMFDFVIIDVGRSLSSVTLQALDLADRVYAV 274

Query: 304 TSLDLAGLRNSKNLIDVLKKL-RPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAI 362
             L L  +R+ K L +V + L  PA K  ++V N+ +  K  + +I D    L I     
Sbjct: 275 LQLTLPFIRDGKRLRNVFRSLDYPAHKIQWIV-NRYQ--KGSQFTIDDLKKTLAINQVIT 331

Query: 363 IPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFS 397
           +P        S N G  +  + P S IA  L + +
Sbjct: 332 LPNHYEAVAASVNQGVPVERIAPNSTIARSLRELA 366


>gi|56697921|ref|YP_168292.1| ATPase, putative [Ruegeria pomeroyi DSS-3]
 gi|56679658|gb|AAV96324.1| ATPase, putative [Ruegeria pomeroyi DSS-3]
          Length = 442

 Score = 74.3 bits (181), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 84/370 (22%), Positives = 159/370 (42%), Gaps = 37/370 (10%)

Query: 64  SIAEAVSCFSDSSTPDLIIVQTKVDSRE----VLSALEPLAEVCDSGTKVIVIG-DTNDV 118
             AEA++ F    +  L  +   +D+ +    VL   E + +    G KVI+I  D    
Sbjct: 74  GFAEALAFFGQPESESLEFIALAIDTEDEDNLVLMG-EIITQAKSRGIKVILIAEDVTPA 132

Query: 119 SLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEE-------------GKGSSGCSIS 165
           SL++ L+     E++  PL   ++ ++I  +  P+ E             G    G  I 
Sbjct: 133 SLHQ-LLRKGADEFVPYPLPERELQSAIDRMSKPEPEQAQTHHNTAHLNKGAAREGALIV 191

Query: 166 FIGSRGGVGSSTIAHNCAFSIASVFAMET---LLADLDLPYGTANINFDKDPINSISDAI 222
             G  GG GS+T+A N A+ +A++   +     L DLDL +G+ +   D     ++ + +
Sbjct: 192 VHGLAGGTGSTTMAVNLAWELANIGGEDAPSVCLMDLDLQHGSVSTYLDLPRREAVFEML 251

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDV 282
                +D+    +  + + + L +LTAP+ +        + I  V+++    F  VI+D+
Sbjct: 252 SETQSMDEEVFGQALLSFEDKLQVLTAPSDMVPLDILSPEDIQRVIEMARAHFDYVIVDM 311

Query: 283 PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP---PYLVLNQVK 339
           P     W++ +L  +        LD   +R+++N + + + L+  D P       LN  K
Sbjct: 312 PKTLVQWSETILQAAHVYFAMIELD---MRSAQNALRMKRALQSEDLPFNKLRFALN--K 366

Query: 340 TPKKPEIS----ISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVD 395
            PK  ++S    +      LGI+    +P  G      A+ G  +    PK+ +   +  
Sbjct: 367 APKFTDLSGKSRVKRMGESLGISIDLQLPDGGKQVTQGADHGLPLATSAPKNPLRREIAK 426

Query: 396 FSRVL--MGR 403
            ++ L  +GR
Sbjct: 427 LAQSLHELGR 436


>gi|107028243|ref|YP_625338.1| response regulator receiver protein [Burkholderia cenocepacia AU
           1054]
 gi|116687154|ref|YP_840401.1| response regulator receiver protein [Burkholderia cenocepacia
           HI2424]
 gi|105897407|gb|ABF80365.1| response regulator receiver protein [Burkholderia cenocepacia AU
           1054]
 gi|116652869|gb|ABK13508.1| response regulator receiver protein [Burkholderia cenocepacia
           HI2424]
          Length = 402

 Score = 73.9 bits (180), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 79/349 (22%), Positives = 151/349 (43%), Gaps = 10/349 (2%)

Query: 80  LIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISN--HVSEYLIEPL 137
           L+I  T ++  E LSA+E +       T ++V  D +   L  A+ +    V ++ ++P 
Sbjct: 52  LLIDGTSLEPSE-LSAIERICRAHAGLTCILVTADASPHVLLDAMRAGARDVLQWPLDPQ 110

Query: 138 SVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLA 197
           ++ + +   +A  T ++         +SF+  +GGVG+S  A N AF IA  F    LL 
Sbjct: 111 ALGNALGRAAAQSTRRDTDDTRI---VSFMSCKGGVGTSFAAGNIAFEIAEGFKRRVLLI 167

Query: 198 DLDLPYGTAN-INFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRT 256
           DL+  +  A  +  D+ P +++      + R+D AF+        EN  +L       + 
Sbjct: 168 DLNQQFADAAFLVSDETPPSTLPQLCAQIERLDGAFLDASVAHVTENFHVLAGAGDPVKA 227

Query: 257 YDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKN 316
            +  E  +  +L +    +  VI DV    N  +   L  SD++ I     +  +R  + 
Sbjct: 228 AEMREDALEWILGVAAPRYDFVIFDVGVGINPLSMVALDRSDQIQIVLQPAMPHVRAGRR 287

Query: 317 LIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANS 376
           L+++L  L  +     L++N  +T +  E + +     LG+  +  IP D      + N 
Sbjct: 288 LLEILVSLGYSTDQLRLIVN--RTTRASERTRAALEEVLGLHAACTIPDDADTVLEAINQ 345

Query: 377 GKMIHEVDPKSAIANLLVDFSRVLM-GRVTVSKPQSAMYTKIKKIFNMK 424
           G  +  +   SA+   L   ++ L+ G V   +  +     + ++F  K
Sbjct: 346 GHPVSRLARGSAVVRALQGCAKQLVDGEVRAGRGATHSEPLMSRLFGRK 394


>gi|148976305|ref|ZP_01813029.1| probable CpaE2 pilus assembly protein [Vibrionales bacterium
           SWAT-3]
 gi|145964399|gb|EDK29654.1| probable CpaE2 pilus assembly protein [Vibrionales bacterium
           SWAT-3]
          Length = 386

 Score = 73.9 bits (180), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 80/317 (25%), Positives = 147/317 (46%), Gaps = 26/317 (8%)

Query: 105 SGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSI 164
           +G ++IVIG +N++ +YR ++++  S+YL+ P++  D +  +S        GK +    I
Sbjct: 79  TGCQIIVIGQSNEIFIYRGMLASGASDYLVPPVTTQD-LEHVSFTALQNSNGKRNEKV-I 136

Query: 165 SFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN--INFDKDPINSISDAI 222
           S + ++GG GSSTI    +  +A +   +    DLD   G  +  +N + +P   I    
Sbjct: 137 SVVSTKGGAGSSTITATLSQQLAEL-GKQVACLDLDFSMGDLDLLLNVEGNPA-LIELLQ 194

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI----FPLV 278
           YP  R++     R  +   E  ++ T    L     + +K     LD   Q        +
Sbjct: 195 YP-ERLEPLVFERCGISVDEKHTLFTGYQPLDAAPFWPQK---SALDQFTQFCIQKADYL 250

Query: 279 ILDVP--HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
           ++D+P   + +      L  +D  VI     L  +RN+  +I  L++  P+     ++LN
Sbjct: 251 VMDIPTYSLRDQVGFNALKSADIRVIVVEPTLGAIRNAGQIIKRLQE--PSSSQTIVILN 308

Query: 337 QVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIA-NLLVD 395
             K+     IS+ D    LG+    IIPF    F  +++ G   H+ + K+ +A N L++
Sbjct: 309 HCKSDSASMISVKDVQKSLGVKIDIIIPFLPNHFIGNSSLGHPAHKGNKKAKLAFNSLIE 368

Query: 396 FSRVLMGRVTVSKPQSA 412
              +++G V    PQS+
Sbjct: 369 ---LIIGEV----PQSS 378


>gi|197118218|ref|YP_002138645.1| Flp pilus assembly response receiver ATPase CpaE [Geobacter
           bemidjiensis Bem]
 gi|197087578|gb|ACH38849.1| Flp pilus assembly response receiver ATPase CpaE, FlhG
           domain-containing protein [Geobacter bemidjiensis Bem]
          Length = 376

 Score = 73.6 bits (179), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 62/255 (24%), Positives = 115/255 (45%), Gaps = 4/255 (1%)

Query: 124 LISNHVSEYLIEPLSVADIINSISAIFTPQEEGKG-SSGCSISFIGSRGGVGSSTIAHNC 182
           LI    SEYL  P+  A++I++++ +   +      ++G   S     GGVG++TIA N 
Sbjct: 96  LIRAGASEYLSRPILAAELIDAVNKVARRRTVKHAPNTGTVFSVYHPSGGVGTTTIAVNL 155

Query: 183 AFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAE 242
           A ++ S     T L DL+L  G  +   D  P  +++D +   G+ID +F+  +   +  
Sbjct: 156 A-AMLSAQGHSTALVDLNLYSGDVSAFLDLTPRYTLADVMPKAGQIDASFLKSVIAPHPS 214

Query: 243 NLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVI 302
            + +L  P  ++ T     +++  V+D+L  IF   ++D              LS++++ 
Sbjct: 215 GVHVLDCPGHVAETNRITTELLQEVIDVLRTIFEYTVIDTGGELFGCNLATFNLSNRILF 274

Query: 303 TTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAI 362
            T L +  LR +K  +  +  +        LV+N  +   + +I ISD    L      +
Sbjct: 275 ATVLTVPCLRTAKRYLTAMADVGLGPDRVKLVVN--RYLPRDDIRISDAEKVLRTKAYHM 332

Query: 363 IPFDGAVFGMSANSG 377
           +P +      S N G
Sbjct: 333 LPNNYTDHKTSVNKG 347


>gi|167815895|ref|ZP_02447575.1| putative CpaE protein [Burkholderia pseudomallei 91]
          Length = 183

 Score = 73.6 bits (179), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 78/148 (52%), Gaps = 5/148 (3%)

Query: 54  SQVNMRITRGSIAEAVSCFSD-SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVI 112
           +    ++ RG I +A++   D S  P  ++V     +   LS L  LA+VCD    VIVI
Sbjct: 40  AMTGAQVARGGIDDAIALMRDLSHGPQHLLVDVS-GAAMPLSDLARLADVCDPSVNVIVI 98

Query: 113 GDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGG 172
           G+ NDV L+R+++   V +YL++PL+V  +  ++SA           +G +I F+G+RGG
Sbjct: 99  GERNDVGLFRSMLRIGVRDYLVKPLTVELVHRALSAADPNAAA---RAGKAIGFVGARGG 155

Query: 173 VGSSTIAHNCAFSIASVFAMETLLADLD 200
           VG ++IA   A  +A          D D
Sbjct: 156 VGVTSIAVALARHLADRTRRRVAYVDFD 183


>gi|167842453|ref|ZP_02469137.1| flp pilus assembly protein, ATPase [Burkholderia thailandensis
           MSMB43]
          Length = 402

 Score = 73.2 bits (178), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 81/350 (23%), Positives = 158/350 (45%), Gaps = 14/350 (4%)

Query: 59  RITR--GSIAEAVSCFSDSSTPDLIIVQ-TKVDSREVLSALEPLAEVCDSGTKVIVIGDT 115
           RITR  G  A+ V         D++++    +D+ E L+A+E L+ +    T ++V  D 
Sbjct: 28  RITRTVGRAAQIVQRTDGLDAFDILMIDGVALDAAE-LAAIEKLSRLHPGLTCMLVTTDA 86

Query: 116 NDVSLYRALIS--NHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGV 173
           +  +L  A+ +    V  + +EP ++ D     +A  T +          +SF+  +GG 
Sbjct: 87  SSQTLLDAMRAGVRDVLHWPVEPRALDDAFKRAAAQCTQRNTPDTRI---VSFMSCKGGA 143

Query: 174 GSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSISDAIYPVGRIDKAF 232
           G+S IA N A+ IA      TLL DL+  +  A  +  D+ P +SI+     + R+D AF
Sbjct: 144 GTSFIAGNVAYEIAECSKRRTLLIDLNQQFADAAFLVSDQTPPSSIAQLCGQLERMDGAF 203

Query: 233 VSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQE 292
           +    V   ++  +L       +  D  E  +  +L +    +  VI ++    N+ +  
Sbjct: 204 LDASVVRVTDSFHVLAGAGDPVKAADIREDALEWILGVALPRYDFVIFELGVSLNAVSMV 263

Query: 293 VLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR-PADKPPYLVLNQVKTPKKPEISISDF 351
            L  SD + +     +  +R ++ L ++L  L  P D+   ++  Q +T ++   ++ + 
Sbjct: 264 ALDRSDHIEVVLQPSMPHVRAARRLQELLVSLGCPLDRIQLVLNRQTRTSERARAALEEV 323

Query: 352 CAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLM 401
              L +  + +IP D A  G + + G  +  +     +A  L  F++ L+
Sbjct: 324 ---LSMRAAHVIPDDPAAVGEAVDQGVPLSRLARGCGVARSLQAFAKQLV 370


>gi|323493501|ref|ZP_08098623.1| hypothetical protein VIBR0546_14310 [Vibrio brasiliensis LMG 20546]
 gi|323312324|gb|EGA65466.1| hypothetical protein VIBR0546_14310 [Vibrio brasiliensis LMG 20546]
          Length = 386

 Score = 73.2 bits (178), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 129/290 (44%), Gaps = 24/290 (8%)

Query: 89  SREVLSALEPLAE--VCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSI 146
           SR  L+  E L       +G +++ IGD  +++ YR++++    EY++ P+      N+ 
Sbjct: 60  SRLSLAQAESLLHTVAVKTGAQIVAIGDNPEIAFYRSMVAAGACEYVLNPIDS----NAF 115

Query: 147 SAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTA 206
           +       +   S G  IS +G++GG G+STIA N A  + +       + D+D   G  
Sbjct: 116 ATTEFAVSKADASQGKVISVVGAKGGAGASTIAANLARELVT-RGESVTVTDMDFATGDL 174

Query: 207 NINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVP 266
           ++ FD     ++ + +    R++     R  +  A+NL + T    L     + EK    
Sbjct: 175 DLQFDVQGNTALVEMLQYPERLEPVVYERSGIKVADNLMLFTGYLPLDSAPFWPEK---S 231

Query: 267 VLDILEQIFPL-----VILDVPHVWNSWTQEV----LTLSDKVVITTSLDLAGLRNSKNL 317
            LD   + F L     ++LD+P    S   ++    L  +D  ++     LA +RN+  +
Sbjct: 232 ALDHFRR-FTLKHSDTLVLDLPSF--SMRDQIGFSSLAQADVRILVVEPTLASIRNTGQI 288

Query: 318 IDVLKKLRPA--DKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPF 365
           +  L+        K   +V+N  K+ K   I+ +D    LG+T    IP+
Sbjct: 289 LAALESTATVRDGKLNLIVVNHTKSDKASLINCNDVQRALGVTVDVAIPY 338


>gi|126737252|ref|ZP_01752987.1| ATPase, putative [Roseobacter sp. SK209-2-6]
 gi|126721837|gb|EBA18540.1| ATPase, putative [Roseobacter sp. SK209-2-6]
          Length = 412

 Score = 73.2 bits (178), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 80/357 (22%), Positives = 155/357 (43%), Gaps = 26/357 (7%)

Query: 67  EAVSCF--SDSSTPDLIIVQTKVDSREVLSAL-EPLAEVCDSGTKVIVIGDTNDVSLYRA 123
           EA++ F  S++   + I +    D  E L  + E + +    G KVI+I +    +    
Sbjct: 47  EALAFFGQSEAEALEFIAMALDADDEENLGLMGEIITQAKSRGIKVILIAEEVSPASLHT 106

Query: 124 LISNHVSEYLIEPLSVADIINSISAIFTPQ------------EEGKGSSGCSISFIGSRG 171
           L+     E++  PL   ++  +I+ + TP+            +      G  I   G  G
Sbjct: 107 LLRQGADEFIPYPLPEQELQAAITRLSTPEPEPAPAEATHQLQADNRREGAVIVCHGLAG 166

Query: 172 GVGSSTIAHNCAFSIASVFAMET---LLADLDLPYGTANINFDKDPINSISDAIYPVGRI 228
           G GS+T+A N A+ +A + + +T    L DLDL  G+ +   D     ++ + +     +
Sbjct: 167 GTGSTTLAVNLAWELAELSSAKTPSVCLLDLDLQQGSVSTYLDLPRREAVMEMLGETESM 226

Query: 229 DKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNS 288
           D     +  + + + L +LTAP+ +        + I  V+++    F  VI+D+PH    
Sbjct: 227 DADLFGQALLSFQDKLQVLTAPSDMIPLDFLTVEDIERVVEMARSHFDFVIIDMPHTLVQ 286

Query: 289 WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP-PYLVLNQVKTPKKPEIS 347
           W++ VL ++     T  LD   +R+++N + + + L+    P   L     + PK  ++S
Sbjct: 287 WSETVLQMAHVYFSTIELD---MRSAQNALRLKRALQSEGLPFEKLRFALNRAPKFTDLS 343

Query: 348 ----ISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
               +      LGI+    +P  G     S + G+ +   +PK+ +   +   +R L
Sbjct: 344 GKSRVKRMAESLGISIDLQLPDGGKPITQSCDHGQPLAVSNPKNPLRKEIAKLARSL 400


>gi|308126257|ref|ZP_05908797.2| Flp pilus assembly protein [Vibrio parahaemolyticus AQ4037]
 gi|308109128|gb|EFO46668.1| Flp pilus assembly protein [Vibrio parahaemolyticus AQ4037]
          Length = 369

 Score = 73.2 bits (178), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 76/348 (21%), Positives = 157/348 (45%), Gaps = 11/348 (3%)

Query: 76  STPDLIIVQTKVD-SREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLI 134
           S PDLI ++T  + +++V         +  + T +IV GD +D +  +  +    ++Y  
Sbjct: 30  SIPDLIYIETGENWAQKVAHVYSGDGNLQHNHTALIVFGDESDTASLKMALRLGATDYFS 89

Query: 135 EPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMET 194
             + + ++   + +    +   K     ++ FI ++GG G++T+A N A  ++S    + 
Sbjct: 90  RSVDLGELYPLLKSTAEEKISNKKMGDLTL-FINTKGGSGATTLAINTAIELSSYAKSKV 148

Query: 195 LLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLS 254
           LL DLD+ +  A    +  P  +I+D I  V  +D+  +  L   +   L+ L       
Sbjct: 149 LLIDLDMQFSDAADYLNCKPKYNINDVIDSVNDLDELSLEGLVYQHPSGLNYLCFNQNDP 208

Query: 255 RTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNS 314
           R        +  +L IL Q +  +I+D+ H  +   Q++++ +  + +    ++  ++++
Sbjct: 209 RNNHKHAIHVSKLLPILRQFYSHIIVDLSHGVDHVYQQIVSPATHIFLIMQQNVTSVKHA 268

Query: 315 KNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMS 373
            + I  L+     ++    L++N+ +  KK  IS+ D    +G     ++P + A+   S
Sbjct: 269 VSYIRSLELDYGLSNHQVELIVNRFE--KKSTISLKDIENAVGGHAIHLVPNNFAIAIES 326

Query: 374 ANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIF 421
           AN G  I +    SA+   L + S +L        P     + IKK F
Sbjct: 327 ANLGNPIVQSKKNSALKASLAEISHLL------ESPTQEHQSWIKKFF 368


>gi|91778911|ref|YP_554119.1| putative pilus assembly protein CpaE [Burkholderia xenovorans
           LB400]
 gi|91691571|gb|ABE34769.1| putative pilus assembly protein CpaE [Burkholderia xenovorans
           LB400]
          Length = 400

 Score = 73.2 bits (178), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 129/293 (44%), Gaps = 7/293 (2%)

Query: 76  STPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIE 135
           ST  LI+    + +R++    E LA  C      ++       +L  A +   V   L  
Sbjct: 49  STELLIVDDVDLSARDLDGIEEALA--CTPALHCVLTTPAPSTALLGAAMRVGVRHVLSW 106

Query: 136 PLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETL 195
           PL   +I   +    T +      +G  +S   S+GG G++ IA N A+S+A++     L
Sbjct: 107 PLDADEITTILIQAETRKNASGRRAGRVVSLASSKGGSGTTLIAVNLAYSLAALSNRRVL 166

Query: 196 LADLDLPYGTANINF-DKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLS 254
           L DL   +G A++   DK P  +++D    V R+D A +    +    NL +L       
Sbjct: 167 LIDLSQQFGDASLLMADKPPPTTLADLCSQVERLDAALLESCVMHVHANLDVLAGAGDPL 226

Query: 255 RTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNS 314
           +  +     +  +L ++ + +  V++D+    N  T   L  SD + +    +L  L   
Sbjct: 227 KAAELLPAQLERILALVRERYDAVLIDIGQSLNPLTIHALDRSDVICMVVRQNLLYLHGG 286

Query: 315 KNLIDVLKKL-RPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFD 366
           + ++D+ ++L  PA K   +V+NQ    K  +I++      LG+  +  +P D
Sbjct: 287 RRMLDIFRELGYPASK-VRVVVNQYD--KNAQINLPKLEQTLGVKVAHQLPRD 336


>gi|170734863|ref|YP_001773977.1| response regulator receiver protein [Burkholderia cenocepacia
           MC0-3]
 gi|169820901|gb|ACA95482.1| response regulator receiver protein [Burkholderia cenocepacia
           MC0-3]
          Length = 402

 Score = 72.8 bits (177), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 78/349 (22%), Positives = 151/349 (43%), Gaps = 10/349 (2%)

Query: 80  LIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISN--HVSEYLIEPL 137
           L+I  T ++  E LSA+E +       T ++V  D +   L  A+ +    V ++ ++P 
Sbjct: 52  LLIDGTSLEPSE-LSAIERICRAHAGLTCILVTSDASPHVLLDAMRAGARDVLQWPLDPQ 110

Query: 138 SVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLA 197
           ++ + +   +A  T ++         +SF+  +GGVG+S  A N AF IA  F    LL 
Sbjct: 111 ALGNALGRAAAQSTRRDTDDTRI---VSFMSCKGGVGTSFAAGNIAFEIAEGFKRRVLLI 167

Query: 198 DLDLPYGTAN-INFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRT 256
           DL+  +  A  +  D+ P +++      + R+D AF+        EN  +L       + 
Sbjct: 168 DLNQQFADAAFLVSDETPPSTLPQLCAQIERLDGAFLDASVAHVTENFHVLAGAGDPVKA 227

Query: 257 YDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKN 316
            +  E  +  +L +    +  VI D+    N  +   L  SD++ I     +  +R  + 
Sbjct: 228 AEMREDALEWILGVAAPRYDFVIFDIGVGINPLSMVALDRSDQIQIVLQPAMPHVRAGRR 287

Query: 317 LIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANS 376
           L+++L  L  +     L++N  +T +  E + +     LG+  +  IP D      + N 
Sbjct: 288 LLEILVSLGYSTDQLRLIVN--RTTRASERTRAALEEVLGLHAACTIPDDADTVLEAINQ 345

Query: 377 GKMIHEVDPKSAIANLLVDFSRVLM-GRVTVSKPQSAMYTKIKKIFNMK 424
           G  +  +   SA+   L   ++ L+ G V   +  +     + ++F  K
Sbjct: 346 GHPVSRLARGSAVVRALQGCAKQLVDGEVRAGRGATHSEPLMSRLFGRK 394


>gi|224824217|ref|ZP_03697325.1| response regulator receiver protein [Lutiella nitroferrum 2002]
 gi|224603636|gb|EEG09811.1| response regulator receiver protein [Lutiella nitroferrum 2002]
          Length = 415

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 75/342 (21%), Positives = 154/342 (45%), Gaps = 6/342 (1%)

Query: 67  EAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALIS 126
           E ++  +D   PD++I +         SAL  L  +      VI++ +        + + 
Sbjct: 40  EMLAPVADQFHPDILIFECDEQDLTDFSALSRL-NLRHPDITVILLSNIQASETLLSAMR 98

Query: 127 NHVSEYLIEPLSVADIINSISAIFTPQ--EEGKGSSGCSISFIGSRGGVGSSTIAHNCAF 184
             V E L  P +   +  +IS +   +  +      G   +FI  +GG GS+ ++ N A+
Sbjct: 99  AGVREVLPSPANREALNLAISRVEEKRMLQNSARPKGKVFAFIPCKGGSGSTFLSTNLAY 158

Query: 185 SIASVFAMETLLADLDLPYGTANINF-DKDPINSISDAIYPVGRIDKAFVSRLPVFYAEN 243
           ++A+      +L DL+L +G A +   D  P  ++++    + R+D +F++   +    N
Sbjct: 159 NLATQEDKNVILIDLNLQFGDAALFVTDHKPSVNLAEVARQIHRMDASFLASSLITVLPN 218

Query: 244 LSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVIT 303
           L IL AP    +  +     I  ++++    + ++ILD+    +  + + L  +D V   
Sbjct: 219 LGILAAPDDPVQAMEVTPAHIDTLVNLARNHYDVIILDIGRALDPVSIKALDHADIVFPV 278

Query: 304 TSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAII 363
             + L  +R+++ L+DVL+ L  +     L++N+ +  K  EI++ D    LG+     I
Sbjct: 279 LQITLPFVRDARRLLDVLRSLGYSRDKIKLLVNRYE--KGGEINLEDVEKTLGLPVFKTI 336

Query: 364 PFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVT 405
           P        S N G  I ++ P + +   + + S+ L+   +
Sbjct: 337 PNSFRAVAASVNQGIPIAKLSPNNPVTRTIQELSKSLVSEAS 378


>gi|32477850|ref|NP_870844.1| chromosome partitioning ATPase [Rhodopirellula baltica SH 1]
 gi|32448407|emb|CAD77922.1| probable chromosome partitioning ATPase [Rhodopirellula baltica SH
           1]
          Length = 402

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 76/305 (24%), Positives = 134/305 (43%), Gaps = 9/305 (2%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVI----GDTNDVSLYRALISNHVSEYL 133
           PDL++V+    SRE L   +   EV      +I I     D +D  L  A +     ++L
Sbjct: 48  PDLLLVELS-GSRESLDVWQHAIEVHQITCPIIGILDDDADPSDGLLVEA-VRIGFRDFL 105

Query: 134 IEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAME 193
             P S  ++   I  +   + E  G  G  ++   ++GGVG STIA N A   A+     
Sbjct: 106 RRPASAGELAGVIRRVARSRPE-SGRRGRLLAVASTKGGVGKSTIAINTAVHWAASTNQR 164

Query: 194 TLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAML 253
            LL D  L  G A    D  P  +I+D      R+D   +  +   +   L +L+AP   
Sbjct: 165 VLLVDASLQLGVAASLLDLTPEMTIADVAAMRDRLDATMLREVTTRHESGLHVLSAPPTP 224

Query: 254 SRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRN 313
           +   + D+  +  +L + +  F LVI+D   + ++ T  +   ++ V + T   +  L  
Sbjct: 225 ADASEVDDTCMSIILGVAKSAFDLVIVDSFPLLDATTLAIFDRAEHVAVVTENVVPTLTG 284

Query: 314 SKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMS 373
           +  ++  L +L        L+LN+ ++     +S ++    LG   +A+I +D  V   +
Sbjct: 285 TAAMLKTLDQLDVRRDRRSLILNRFQSCAG-SLSAAEVAEQLGEPVTAVIKYDRRVL-EA 342

Query: 374 ANSGK 378
           AN G+
Sbjct: 343 ANLGR 347


>gi|221633003|ref|YP_002522228.1| putative two-component response regulator [Thermomicrobium roseum
           DSM 5159]
 gi|221155361|gb|ACM04488.1| putative two-component response regulator [Thermomicrobium roseum
           DSM 5159]
          Length = 419

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 78/367 (21%), Positives = 145/367 (39%), Gaps = 38/367 (10%)

Query: 74  DSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYL 133
           D + PDL       D  EV SA+   A     G  VI++G   D  + R  +     EYL
Sbjct: 53  DQTLPDL-------DGIEVASAITARA----PGIGVILLGVEQDPEILRRAMLAGAREYL 101

Query: 134 IEPLSVADIINSI---SAIFTPQ------------------EEGKGSSGCSISFIGSRGG 172
            +P S  D+I ++     +  PQ                  E      G  +  +GS+GG
Sbjct: 102 SKPFSYDDLIEAVRRVGHVANPQSMMPAPATVFAAPLAPVHEPVTRREGQVVVVLGSKGG 161

Query: 173 VGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAF 232
           VG + IA N A  +      E +L D DL  G   +  +     S +D     G +D   
Sbjct: 162 VGRTFIATNLAICLQRALQREVVLVDADLMRGDVAVLLNLPAHRSWTDLARLAGPLDGEL 221

Query: 233 VSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQE 292
           +      +   + ++ APA L        + I  VL  L +    VI+D    ++  T  
Sbjct: 222 IHEFVTRHVSQVGVVLAPAQLEDAERIGAERIQEVLTELRRRADFVIVDTRGGYDDITLA 281

Query: 293 VLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFC 352
              ++  ++   +L++  ++ +K  ++++++L    K    VLNQ ++     +++ +  
Sbjct: 282 CADVASTLIWILTLEMTAIKETKRFLELVERLGFQQKRIMFVLNQQRSGSG--LTVEEVE 339

Query: 353 APLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSA 412
           A L ++    I  D      S N G  +     +  I   L+  + +L         ++ 
Sbjct: 340 ASLRLSIPIRISSDPQAVIASINEGTPLAWQHRQHRITAELIQLAELLAN----ESREAV 395

Query: 413 MYTKIKK 419
           ++ +++K
Sbjct: 396 LHARVRK 402


>gi|21673272|ref|NP_661337.1| ParaA family ATPase [Chlorobium tepidum TLS]
 gi|21646361|gb|AAM71679.1| ATPase, ParA family [Chlorobium tepidum TLS]
          Length = 292

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 127/262 (48%), Gaps = 21/262 (8%)

Query: 166 FIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI----NFDKDPINSISDA 221
           F+ ++GG G S IA N AF+++    +  L  D+ LP+G  ++    N     +  IS+A
Sbjct: 41  FVSAKGGDGGSCIAANFAFALSQEPDIHVLAVDISLPFGDLDMYLSGNTHSQDLADISNA 100

Query: 222 IYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILD 281
                R+DK+ +  +    + +L ++ +PA   +  + + + +  ++ I    +  +I+D
Sbjct: 101 ---SDRLDKSLLDTMVQHISPSLDLIPSPATFEKIVNIEPERVSDLIHIAASFYDYIIVD 157

Query: 282 ----VPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQ 337
               + HV   W  E L   D++ I T+  L  LR +  L+ + K+         ++LN+
Sbjct: 158 FGASIDHV-GVWVLEHL---DELCIVTTPSLQSLRRAGQLLKLCKEFEKPISRIEIILNR 213

Query: 338 VKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFS 397
             T  +  I+  +    +G   S  IP D      S  SG+ + +V PKS ++  +VD++
Sbjct: 214 ADTNSR--ITSDEIEKVIGRPISKRIPQDEDAMQESLLSGQSVLKVAPKSQLSKTIVDWA 271

Query: 398 RVLMGRVTVSKP-QSAMYTKIK 418
             L G   VS+P + +++ ++K
Sbjct: 272 LHLNG---VSRPNKRSIWERLK 290


>gi|50119736|ref|YP_048903.1| hypothetical protein ECA0791 [Pectobacterium atrosepticum SCRI1043]
 gi|49610262|emb|CAG73705.1| conserved hypothetical protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 399

 Score = 72.4 bits (176), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 79/335 (23%), Positives = 143/335 (42%), Gaps = 16/335 (4%)

Query: 52  RMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIV 111
           R+ Q ++ +  G IA A      +  P +++V  +  +   L ALE L  VC   ++VI 
Sbjct: 35  RLKQPDVPVMSGGIAAARQWCELNVPPRILLVDLE-GAHWPLPALEELLSVCGPTSQVIA 93

Query: 112 IGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGK--GSSGCSISFIGS 169
            G   DV LYRAL+   V +YL++PL++  +  +++     Q+ G      G +I+ + +
Sbjct: 94  TGKEQDVGLYRALLQAGVVDYLVKPLTLDLLATTLAKC-EGQQAGPEYARMGRTIAVVSA 152

Query: 170 RGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISD-----AIYP 224
            GG G+ST+A   +  ++    +   L D D        N D+  +   +D     A+  
Sbjct: 153 SGGSGASTVAMGLSRLLSGERHLPVALVDFD------RRNGDQLLLQGQTDDAGLAAVLG 206

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH 284
              +D   + R  +     L +L     L      +   ++ +   L ++F  VI D+P 
Sbjct: 207 TQELDTRLLQRAMLRVDTRLHLLAQKPELGELSPVEVDNVLNLGGALCRMFNQVIWDLPS 266

Query: 285 VWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKP 344
            + +   +VLT +D  +I T L L   RN + +++ +       +   LV NQ +     
Sbjct: 267 SYPTGALDVLTYADLRIIVTELTLQDARNVRRVLNEIGDESEGQR-LLLVHNQSRFATTA 325

Query: 345 EISISDFCAPLGITPSAIIPFDGAVFGMSANSGKM 379
            +S   F    G     ++P  G     S   G +
Sbjct: 326 PLSRDQFEQFTGRKIDVVLPNAGHALAQSLTLGAL 360


>gi|28899187|ref|NP_798792.1| putative pilus assembly protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153836801|ref|ZP_01989468.1| Flp pilus assembly protein [Vibrio parahaemolyticus AQ3810]
 gi|260361574|ref|ZP_05774601.1| Flp pilus assembly protein [Vibrio parahaemolyticus K5030]
 gi|260876731|ref|ZP_05889086.1| Flp pilus assembly protein [Vibrio parahaemolyticus AN-5034]
 gi|260898191|ref|ZP_05906687.1| Flp pilus assembly protein [Vibrio parahaemolyticus Peru-466]
 gi|28807411|dbj|BAC60676.1| putative pilus assembly protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149749947|gb|EDM60692.1| Flp pilus assembly protein [Vibrio parahaemolyticus AQ3810]
 gi|308089041|gb|EFO38736.1| Flp pilus assembly protein [Vibrio parahaemolyticus Peru-466]
 gi|308091418|gb|EFO41113.1| Flp pilus assembly protein [Vibrio parahaemolyticus AN-5034]
 gi|308113988|gb|EFO51528.1| Flp pilus assembly protein [Vibrio parahaemolyticus K5030]
          Length = 402

 Score = 72.4 bits (176), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 76/348 (21%), Positives = 157/348 (45%), Gaps = 11/348 (3%)

Query: 76  STPDLIIVQTKVD-SREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLI 134
           S PDLI ++T  + +++V         +  + T +IV GD +D +  +  +    ++Y  
Sbjct: 63  SIPDLIYIETGENWAQKVAHVYSGDGNLQHNHTALIVFGDESDTASLKMALRLGATDYFS 122

Query: 135 EPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMET 194
             + + ++   + +    +   K     ++ FI ++GG G++T+A N A  ++S    + 
Sbjct: 123 RSVDLGELYPLLKSTAEEKISNKKMGDLTL-FINTKGGSGATTLAINTAIELSSYAKSKV 181

Query: 195 LLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLS 254
           LL DLD+ +  A    +  P  +I+D I  V  +D+  +  L   +   L+ L       
Sbjct: 182 LLIDLDMQFSDAADYLNCKPKYNINDVIDSVNDLDELSLEGLVYQHPSGLNYLCFNQNDP 241

Query: 255 RTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNS 314
           R        +  +L IL Q +  +I+D+ H  +   Q++++ +  + +    ++  ++++
Sbjct: 242 RNNHKHAIHVSKLLPILRQFYSHIIVDLSHGVDHVYQQIVSPATHIFLIMQQNVTSVKHA 301

Query: 315 KNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMS 373
            + I  L+     ++    L++N+ +  KK  IS+ D    +G     ++P + A+   S
Sbjct: 302 VSYIRSLELDYGLSNHQVELIVNRFE--KKSTISLKDIENAVGGHAIHLVPNNFAIAIES 359

Query: 374 ANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIF 421
           AN G  I +    SA+   L + S +L        P     + IKK F
Sbjct: 360 ANLGNPIVQSKKNSALKASLAEISHLL------ESPTQEHQSWIKKFF 401


>gi|322419942|ref|YP_004199165.1| response regulator receiver protein [Geobacter sp. M18]
 gi|320126329|gb|ADW13889.1| response regulator receiver protein [Geobacter sp. M18]
          Length = 375

 Score = 72.4 bits (176), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/306 (23%), Positives = 134/306 (43%), Gaps = 12/306 (3%)

Query: 107 TKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAI---FTPQEEGKGSSGCS 163
           T VIV           +L+ +   EY++ P++  ++  S+  +      +   +   G  
Sbjct: 79  TSVIVSSSEKSSDWILSLMRSGAVEYMLRPITQEELKQSLQKVGRFMFAKPAAEAPKGKI 138

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           IS     GG+G++T+A N A S+AS    +  L DL+L  G  +   D +P  ++S    
Sbjct: 139 ISVYYPTGGMGTTTVAVNLAASLASE-GTKVALVDLNLYSGDISTFLDVNPTYTLSSVTS 197

Query: 224 PVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVP 283
            + R+D  F+  +   ++    +LT P  +        + +  +L+ L  +F  V++D  
Sbjct: 198 NIDRLDANFLMTVMTRHSSGPFVLTEPNEVDDAISITPEQVHRILEFLRGVFTYVVVDCG 257

Query: 284 HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKK 343
                    +   SD ++ TT+L L  L+N+K  +  +++         LV+N+     K
Sbjct: 258 GPLAGCNMTIFESSDLILFTTALSLPALKNTKRYLSAMERKGLRKDRLKLVVNRYL--PK 315

Query: 344 PEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGR 403
            +I  +D    LG T    IP D      S N G  + ++ P S ++  +++ + +    
Sbjct: 316 ADIQTADAEKVLGHTVFQTIPNDYVDVVSSINKGLPVVKMSPGSPVSKAILNLAAL---- 371

Query: 404 VTVSKP 409
             VSKP
Sbjct: 372 --VSKP 375


>gi|254463509|ref|ZP_05076925.1| response regulator receiver protein [Rhodobacterales bacterium
           HTCC2083]
 gi|206680098|gb|EDZ44585.1| response regulator receiver protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 415

 Score = 72.0 bits (175), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 79/329 (24%), Positives = 148/329 (44%), Gaps = 33/329 (10%)

Query: 88  DSREVLSALEPLAEVCDSGT-KVIVIG-DTNDVSLYRALISNHVSEYLIEPLSVADIINS 145
           +  E L  LE + +V  S   KVI+I  D    SL++ L+     E++  PL   ++ N+
Sbjct: 71  EDEEDLGLLERVIQVAKSREIKVILIAEDVTPASLHQ-LLRGGADEFIPYPLPENELRNA 129

Query: 146 ISAIFTPQ---------------EEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVF 190
           +  +  P                  G+  +G  I+  G  GG G++T+A N A+ +A++ 
Sbjct: 130 VERLRKPAPIATIAAQAHPASAPHSGESRNGRVIAVHGLAGGTGATTLAVNLAWELATLS 189

Query: 191 ---AMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSIL 247
              A +  + DLDL +G+ +   D    +++ + +     +D     +  + + E L  L
Sbjct: 190 KDSAPKVCILDLDLQFGSVSTFLDLQRRDAVFELLTDTEHMDDESFYQALLVHEEELHAL 249

Query: 248 TAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLD 307
           T+PA +        + I  +LD+ +  F  VI+D+P     WT+ VL  S     T  +D
Sbjct: 250 TSPADVIPLDMIRPEDISVILDLAKSRFDYVIVDMPTTLVQWTETVLNASQIYFATLEMD 309

Query: 308 LAGLRNSKNLIDVLKKLRPADKP---PYLVLNQVKTPKKPEIS----ISDFCAPLGITPS 360
              +R+++N + + + L+  + P      VLN  + PK  +++    +      LGIT  
Sbjct: 310 ---MRSAQNALRMKRALQSENLPFEKLRFVLN--RAPKFTDLNGKTRVKRLEESLGITIE 364

Query: 361 AIIPFDGAVFGMSANSGKMIHEVDPKSAI 389
             +P  G      A+ G+ + +  PK+ +
Sbjct: 365 VQLPDGGKPVVNGADHGQTLAKTAPKNPL 393


>gi|219883047|ref|YP_002478211.1| Cobyrinic acid ac-diamide synthase [Arthrobacter chlorophenolicus
           A6]
 gi|219862053|gb|ACL42394.1| Cobyrinic acid ac-diamide synthase [Arthrobacter chlorophenolicus
           A6]
          Length = 391

 Score = 72.0 bits (175), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 102/223 (45%), Gaps = 4/223 (1%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISD 220
           G  I+   ++GGVG +T+A N A  +  +  M T+L DLD  +G  +      P +++ D
Sbjct: 138 GRIIAVAAAKGGVGKTTVATNIAVGLGRIAPMSTVLVDLDTQFGDVDTVLRIVPEHTLKD 197

Query: 221 AIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVIL 280
           A+      D   +  L   +  ++  L AP+  + +     + I  +L  L   F  V++
Sbjct: 198 AVTGAAAQDTMVLKTLLSVHPASIYALCAPSDPADSNRISGEEITHMLRQLASEFRYVVV 257

Query: 281 DVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKT 340
           D        T   L  +  +V+   +D+  +R ++  +DVL KL+   +  +LV+N    
Sbjct: 258 DTAPGLGEHTLAALEAATDLVLLCGMDVPSVRGARKELDVLDKLQMTSQKRHLVVNNAT- 316

Query: 341 PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK-MIHE 382
            +   +SI D  A LG   +  IP   A    S N G+ ++H+
Sbjct: 317 -RDSGLSIQDIEATLGAPVNLAIPRSKA-LAYSTNQGEPLLHQ 357


>gi|317122046|ref|YP_004102049.1| response regulator receiver protein [Thermaerobacter marianensis
           DSM 12885]
 gi|315592026|gb|ADU51322.1| response regulator receiver protein [Thermaerobacter marianensis
           DSM 12885]
          Length = 446

 Score = 72.0 bits (175), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 73/311 (23%), Positives = 134/311 (43%), Gaps = 21/311 (6%)

Query: 42  SVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAE 101
           S+VE  +++P    V       +  EA    +    PD++++   +   + L+A E +  
Sbjct: 60  SLVEMLEMEPDFHVVG----EAADGEAAVALAADLRPDVVLMDINLPRLDGLAAAEQILR 115

Query: 102 VCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEE-----G 156
             +  T++I++   N    +R  +     ++L++P S   +  ++       +E      
Sbjct: 116 QVE--TRIIMVSVENGPEYFRRAMQAGACDFLVKPFSPDVLAEAVRRAAPAADEPALPAA 173

Query: 157 KGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPIN 216
            G  G  I+   ++GGVG +T+A N A  +A      T+L DLDL  G+A +     P  
Sbjct: 174 AGRRGRLITVFSAKGGVGKTTVAVNLAVVLAKRPDRRTVLVDLDLELGSAAMLLGIRPRA 233

Query: 217 SISDAIYPVGRID-KAFVSRLPVFYAENLSILTAPAMLSRTYDFD--------EKMIVPV 267
           +++D     G +D +A    L    +  LS+L AP       + +              V
Sbjct: 234 TLADLCRREGALDPQAVAPALHPVASFRLSLLPAPLFPHEAAEIEGEGRRDPSRNYTAEV 293

Query: 268 LDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL-KKLRP 326
           L+ L      V++D    +         LSD +VI T+ DL  + N+   +D+L +KL  
Sbjct: 294 LEALRATHDYVVVDTAANYRDSNLTAFDLSDLLVIVTTADLPAVANTAKCLDLLIQKLEY 353

Query: 327 ADKPPYLVLNQ 337
            ++   +VLNQ
Sbjct: 354 PEEKVRVVLNQ 364


>gi|302037435|ref|YP_003797757.1| putative pilus assembly ATPase CpaE [Candidatus Nitrospira
           defluvii]
 gi|300605499|emb|CBK41832.1| putative Pilus assembly ATPase CpaE [Candidatus Nitrospira
           defluvii]
          Length = 289

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 105/225 (46%), Gaps = 19/225 (8%)

Query: 153 QEEGKGSS----GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETL-LADLDLPYGTAN 207
           Q E  G +    G  I+  G++GGVG+ST+A N         A E++ L DL+L  G  +
Sbjct: 9   QNERTGQAAEPRGRLIALFGAKGGVGTSTVAVNLGLCAQQRRAKESVVLVDLNLQAGNLH 68

Query: 208 INFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYD------FDE 261
           +    +P +   + +    R+D   +  L   +   L +L +       YD       + 
Sbjct: 69  LLLGLEPTHRWREIMREASRLDSTLLMSLLAKHESGLHLLASD------YDGLGDTLLNP 122

Query: 262 KMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL 321
           +++   L IL  +F +V+ D  HV +  T++VL  +  V++ T+LD+  +R +  +++VL
Sbjct: 123 ELVSRALLILRSLFDVVVTDCGHVLHPATRKVLEQASAVLVVTALDIPAMRRTTRVLEVL 182

Query: 322 KKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFD 366
             L    +   ++LN +    +  ++ ++     G+T    IP D
Sbjct: 183 NPLLGGGRRAQVLLNGLDRNDQGLVTEAEKVLRHGVTWH--IPAD 225


>gi|269960461|ref|ZP_06174833.1| hypothetical protein VME_12170 [Vibrio harveyi 1DA3]
 gi|269834538|gb|EEZ88625.1| hypothetical protein VME_12170 [Vibrio harveyi 1DA3]
          Length = 402

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 77/356 (21%), Positives = 159/356 (44%), Gaps = 13/356 (3%)

Query: 69  VSCFSDSSTPDLIIVQTKVD-SREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISN 127
           V    +   PDLI ++T  + +++V       + +  + T +IV GD  D +  +  +  
Sbjct: 56  VDLVRNKQIPDLIYIETGDNWAQKVAHVYSSDSNLQHNHTALIVFGDETDTASLKMALRL 115

Query: 128 HVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIA 187
             +++      + ++   + +    +   K     ++ FI ++GG G++T+A N A  ++
Sbjct: 116 GATDHFSRSADLGELYPLLKSTAEEKVYNKKMGDLTL-FINTKGGSGATTLALNTAIELS 174

Query: 188 SVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSIL 247
           S      LL DLD+ +  A    +  P  +I+D I  V  +D+  +  L   +   L+ L
Sbjct: 175 SYAKSNVLLIDLDMQFSDAADYLNCKPKYNINDVIDSVNDLDELSLEGLVYKHPSGLNYL 234

Query: 248 T-APAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSL 306
                 L   Y++  + +  +L IL Q +  +I+D+ H      Q++++ +  + +    
Sbjct: 235 CFDQGNLQGNYNYANE-VSKLLPILRQFYSHIIVDMSHGIEHVFQKIVSPATHIFLVMQQ 293

Query: 307 DLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPF 365
           ++  ++++ N +  L+      +    L++N+ +  KK  IS+ D  + +G     ++P 
Sbjct: 294 NVTSVKHAVNYVRTLELDYGLNNHQVELIVNRFE--KKSTISLKDIESAVGGHSIHLVPN 351

Query: 366 DGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIF 421
           + A+   SAN G  I +    SAI   L + S +L        P     + IKK F
Sbjct: 352 NFAIAIESANLGNPIVQSKKNSAIKASLAEISHLL------ESPTKENQSWIKKFF 401


>gi|119717339|ref|YP_924304.1| Flp pilus assembly protein ATPase CpaE-like [Nocardioides sp.
           JS614]
 gi|119538000|gb|ABL82617.1| Flp pilus assembly protein ATPase CpaE-like protein [Nocardioides
           sp. JS614]
          Length = 395

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 87/183 (47%)

Query: 155 EGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDP 214
           +G    G  ++    +GGVG +T+A N A +++   A +  L DLDL +G   I     P
Sbjct: 126 DGVSHQGRIVTVFSPKGGVGKTTMAVNLALALSDGGARQVCLVDLDLAFGDVAITLQLFP 185

Query: 215 INSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI 274
            +++  AI     +D A +  L   +   + +L AP+           ++  VL  L + 
Sbjct: 186 SHTVEHAIGSEDTLDAAMLGALLTRHQGAVMVLAAPSQPDVRERITPALVTRVLTTLRET 245

Query: 275 FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLV 334
           F  V++D    ++  T   L  +D+ V+  +LD+  L+N +  ++ L+ L  A    +L+
Sbjct: 246 FDFVVVDTAPAFDETTLAALDETDECVVVATLDVPTLKNVRVGLETLEMLGIARGHRHLL 305

Query: 335 LNQ 337
           LN+
Sbjct: 306 LNR 308


>gi|84498178|ref|ZP_00996975.1| probable chromosome partitioning ATPase [Janibacter sp. HTCC2649]
 gi|84381678|gb|EAP97561.1| probable chromosome partitioning ATPase [Janibacter sp. HTCC2649]
          Length = 388

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 102/205 (49%), Gaps = 10/205 (4%)

Query: 160 SGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSIS 219
            G  ++   ++GGVG +T++ N A  +A +  + TLL DLDL +G   I+    P +S+ 
Sbjct: 128 QGRIVTVFSAKGGVGKTTMSTNLATHLA-LCGLRTLLVDLDLSFGDVAISMQLIPTSSVH 186

Query: 220 DAIYPVGRIDKAFVSRLPVFY-AENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLV 278
           DA+   G +D   +++L   + A  L ++ AP   S        ++  +L +    +  V
Sbjct: 187 DAVAMHGHLDAEGLAQLVTHHQASGLDVVAAPTDPSLADRISAPVVTELLRVAAGAYDYV 246

Query: 279 ILDVPHVWNSWTQEVLT---LSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVL 335
           I+D P    S+T+ VL    +S  +V+  +LD+  ++N K  ++ L  L        +VL
Sbjct: 247 IVDTP---PSFTEHVLAACDVSSLLVLIATLDIPAVKNLKLALETLDALGSPRDSRVIVL 303

Query: 336 NQ--VKTPKKPEISISDFCAPLGIT 358
           N+  VK   +PE  +    AP+ ++
Sbjct: 304 NRADVKVGLRPEDVVQAIGAPIAVS 328


>gi|327538079|gb|EGF24769.1| response regulator receiver protein [Rhodopirellula baltica WH47]
          Length = 402

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 134/305 (43%), Gaps = 9/305 (2%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVS----EYL 133
           PDL++V+    SR+ L   +   EV      +I I D +D      L+   V     ++L
Sbjct: 48  PDLLLVELS-GSRDSLDVWQHAIEVHQITCPIIGILD-DDADPSDGLLVEAVRIGFRDFL 105

Query: 134 IEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAME 193
             P S  ++   I  +   + E  G  G  ++   ++GGVG STIA N A   A+     
Sbjct: 106 RRPASAGELAGVIRRVARSRPE-SGRRGRLLAVASTKGGVGKSTIAINTAVHWAASTNQR 164

Query: 194 TLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAML 253
            LL D  L  G A    D  P  +I+D      R+D   +  +   +   L +L+AP   
Sbjct: 165 VLLVDASLQLGVAASLLDLTPEMTIADVAAMRDRLDATMLREVTTRHESGLHVLSAPPTP 224

Query: 254 SRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRN 313
           +   + D+  +  +L + +  F LVI+D   + ++ T  +   ++ V + T   +  L  
Sbjct: 225 ADASEVDDTCMSIILGVAKSAFDLVIVDSFPLLDATTLAIFDRAEHVAVVTENVVPTLTG 284

Query: 314 SKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMS 373
           +  ++  L +L        L+LN+ +      +S ++    LG   +A+I +D +V   +
Sbjct: 285 TAAMLKTLDQLDVRRDRRSLILNRFQNCAG-SLSAAEVAEQLGEPVTAVIKYDRSVL-EA 342

Query: 374 ANSGK 378
           AN G+
Sbjct: 343 ANLGR 347


>gi|326797329|ref|YP_004315149.1| response regulator receiver protein [Marinomonas mediterranea
           MMB-1]
 gi|326548093|gb|ADZ93313.1| response regulator receiver protein [Marinomonas mediterranea
           MMB-1]
          Length = 414

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 81/326 (24%), Positives = 140/326 (42%), Gaps = 7/326 (2%)

Query: 63  GSIAEAVSCFSDSSTPDLIIVQT-KVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLY 121
           G I+ A      ++ P LI     KV++   L A+  L E     +K+IV+G    +  Y
Sbjct: 44  GGISAANEWCKHNAIPHLIFADIDKVNT--PLLAVAELIERTSPTSKLIVVGSDQSIDQY 101

Query: 122 RALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHN 181
           RAL+S  V +YL++P  +  +   I       E     +G +IS  GS GG+G+S +A+ 
Sbjct: 102 RALLSIGVFDYLVKPAPLDMMAKMIQKARRGDESESFGTGRTISVTGSSGGIGTSLVAYA 161

Query: 182 CAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYA 241
               +++    ++ L D D   G  ++       + + D++    +ID   + R      
Sbjct: 162 LGRLLSNQRYFKSALVDFDRKNGCLDLMLGAQGESGL-DSVLQTDKIDSRLLERSMTEID 220

Query: 242 ENLSILT-APAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKV 300
             LS+L   P   ++  D D   ++ +   L +IF  VI D+P      + EVL  S   
Sbjct: 221 GRLSLLAQQPNYQAKDID-DTDQLLLLGAGLCRIFNQVIWDLPSSQPYGSLEVLKHSQAR 279

Query: 301 VITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPS 360
           +I   L +A  RN+  L++ +       +   LV N  +      I+ + F   +G    
Sbjct: 280 IILVDLTVADARNTLRLLNEIGDESNGQR-ILLVRNTCRQQNVDVITQTAFEEFVGRKID 338

Query: 361 AIIPFDGAVFGMSANSGKMIHEVDPK 386
             +PF G     S   GK+  +  P+
Sbjct: 339 MQLPFVGGGLSKSLLQGKLSFDAFPE 364


>gi|296155912|ref|ZP_06838751.1| putative pilus assembly protein CpaE [Burkholderia sp. Ch1-1]
 gi|295893418|gb|EFG73197.1| putative pilus assembly protein CpaE [Burkholderia sp. Ch1-1]
          Length = 400

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 71/313 (22%), Positives = 134/313 (42%), Gaps = 6/313 (1%)

Query: 47  SKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSG 106
           +++D       +R   G+  +  S      + +L+IV     S   L  +E  A  C   
Sbjct: 19  ARLDASGVAYRLRTAHGTARQLRSHTRAIRSTELLIVDAADLSARDLDGIEE-ALACTPA 77

Query: 107 TKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISF 166
              +++      +L    +   V   L  PL   +I   +  I T +      +G  +S 
Sbjct: 78  LHCVLMTPAPSTALLGVAMRVGVRHVLSWPLDADEITTILIQIETRKHANGRRAGRVVSL 137

Query: 167 IGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF-DKDPINSISDAIYPV 225
             S+GG G++ IA N A+S+A++     LL DL   +G A++   DK P  +++D    V
Sbjct: 138 ASSKGGSGTTLIAVNLAYSLAALSNRRVLLIDLSQQFGDASLLMADKPPPTTLADLCSQV 197

Query: 226 GRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHV 285
            R+D A +    +    NL +L       +  +     +  +L ++ + +  V++DV   
Sbjct: 198 ERLDAALLESCVMHVHANLDVLAGAGDPLKAAELLPAQLERILALVRERYDAVLIDVGQS 257

Query: 286 WNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL-RPADKPPYLVLNQVKTPKKP 344
            N  T   L  SD + +    +L  L   + ++++ ++L  PA K   +V+NQ    K  
Sbjct: 258 LNPLTIHALDHSDVICMVVRQNLLYLHGGRRMLEIFRELGYPASK-VRVVVNQYD--KNA 314

Query: 345 EISISDFCAPLGI 357
           +I++      LG+
Sbjct: 315 QINLPKLEQTLGV 327


>gi|167579121|ref|ZP_02371995.1| putative pilus assembly protein CpaE [Burkholderia thailandensis
           TXDOH]
          Length = 402

 Score = 70.9 bits (172), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 75/335 (22%), Positives = 147/335 (43%), Gaps = 29/335 (8%)

Query: 80  LIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISN--HVSEYLIEPL 137
           L+I    +D+ E L+A+E L+ +    T ++V  D +  +L  A+ +    V  + +EP 
Sbjct: 52  LMIDGVALDTAE-LAAIEKLSRLHPGLTCMLVSADASSQTLLEAMRAGVRDVLRWPLEPR 110

Query: 138 SVADIINSISAIFTPQEEGKGSSGCS---------ISFIGSRGGVGSSTIAHNCAFSIAS 188
           ++ D +             + +S C+         +SF+  +GG G+S IA N A+ IA 
Sbjct: 111 ALDDALK------------RAASQCAQRDTPDTRIVSFMSCKGGAGTSFIAGNVAYEIAE 158

Query: 189 VFAMETLLADLDLPYGTAN-INFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSIL 247
                TLL DL+  +  A  +  D+ P ++I+     + R+D AF+    V   E   +L
Sbjct: 159 GSKRRTLLIDLNQQFADAAFLVSDQSPPSTIAQLCGQLERMDGAFLDASVVRVTETFHVL 218

Query: 248 TAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLD 307
                  +  D  E  +  +L +    +  VI D+    N+ +   L  SD+V +     
Sbjct: 219 AGAGDPIKAADLREDALEWILGVAAPRYDFVIFDLGVSLNAVSMVALDRSDRVEVVLQPS 278

Query: 308 LAGLRNSKNLIDVLKKLR-PADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFD 366
           +  +R ++ L ++L  L  P D+   ++  Q +   +   ++ +    L +  + +I  D
Sbjct: 279 MPHVRAARRLQELLVSLGCPLDRLQLVLNRQTRASDRARAALEEV---LSMHAAHVIADD 335

Query: 367 GAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLM 401
            A  G + + G  +  +     +A  L  F++ L+
Sbjct: 336 PATVGEAVDQGVPLSRLSRNCGVARSLQAFAKQLV 370


>gi|163742215|ref|ZP_02149603.1| ATPase, putative [Phaeobacter gallaeciensis 2.10]
 gi|161384545|gb|EDQ08926.1| ATPase, putative [Phaeobacter gallaeciensis 2.10]
          Length = 410

 Score = 70.9 bits (172), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 76/335 (22%), Positives = 138/335 (41%), Gaps = 29/335 (8%)

Query: 67  EAVSCFSDSSTPDLIIVQTKVDSRE-----VLSALEPLAEVCDSGTKVIVIGDTNDVSLY 121
           EA++ F+ S    L  V   +DS +     ++  +  + E      KVI+I +    +  
Sbjct: 47  EALAFFNQSEAEALEFVALALDSGDEDNLPLMGTI--ITEAKTRNIKVILIAEDVTPAAL 104

Query: 122 RALISNHVSEYLIEPLSVADIINSISAIFTPQEE-----------GKGSSGCSISFIGSR 170
             L+     E++  PL   ++  +I  +   + E           G    G  I   G  
Sbjct: 105 HNLLRQGADEFIPYPLPEGELQAAIERLRLAEAERTAEPQHVLKTGSQRDGAVIVCHGLA 164

Query: 171 GGVGSSTIAHNCAFSIASVFAMET---LLADLDLPYGTANINFDKDPINSISDAIYPVGR 227
           GG GS+T+A N A+ +A +   ET    L D DL YG+     D      + + +     
Sbjct: 165 GGSGSTTLAVNLAWELAQLSTSETPRVCLLDFDLQYGSVATYLDLPRREVVMEMLSDTEN 224

Query: 228 IDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWN 287
           +D+    +  V Y + L +LTAP  +        + I  V+ +    F  V++D+PH   
Sbjct: 225 LDEDVFGQALVTYEDKLQVLTAPVDMIPLEFITPEDIERVVTLARSHFDFVVIDMPHTLV 284

Query: 288 SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP-PYLVLNQVKTPKKPEI 346
            W++ +L ++        LD   +R+++N + + + L+  D P   L     + PK  ++
Sbjct: 285 QWSETILNMAHVYFSMVELD---MRSAQNALRLKRALQSEDLPFEKLRFALNRAPKFTDL 341

Query: 347 S----ISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
           S    +      LGI+    +P  G     S++ G
Sbjct: 342 SGKSRVKRMAESLGISIDLQLPDGGKQVAQSSDHG 376


>gi|163738368|ref|ZP_02145783.1| response regulator receiver protein [Phaeobacter gallaeciensis
           BS107]
 gi|161388289|gb|EDQ12643.1| response regulator receiver protein [Phaeobacter gallaeciensis
           BS107]
          Length = 410

 Score = 70.9 bits (172), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 76/335 (22%), Positives = 138/335 (41%), Gaps = 29/335 (8%)

Query: 67  EAVSCFSDSSTPDLIIVQTKVDSRE-----VLSALEPLAEVCDSGTKVIVIGDTNDVSLY 121
           EA++ F+ S    L  V   +DS +     ++  +  + E      KVI+I +    +  
Sbjct: 47  EALAFFNQSEAEALEFVALALDSGDEDNLPLMGTI--ITEAKTRNIKVILIAEDVTPAAL 104

Query: 122 RALISNHVSEYLIEPLSVADIINSISAIFTPQEE-----------GKGSSGCSISFIGSR 170
             L+     E++  PL   ++  +I  +   + E           G    G  I   G  
Sbjct: 105 HNLLRQGADEFIPYPLPEGELQAAIERLRLAEAERTAEPQHVLKTGSQRDGAVIVCHGLA 164

Query: 171 GGVGSSTIAHNCAFSIASVFAMET---LLADLDLPYGTANINFDKDPINSISDAIYPVGR 227
           GG GS+T+A N A+ +A +   ET    L D DL YG+     D      + + +     
Sbjct: 165 GGSGSTTLAVNLAWELAQLSTSETPRVCLLDFDLQYGSVATYLDLPRREVVMEMLSDTEN 224

Query: 228 IDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWN 287
           +D+    +  V Y + L +LTAP  +        + I  V+ +    F  V++D+PH   
Sbjct: 225 LDEDVFGQALVTYEDKLQVLTAPVDMIPLEFITPEDIERVVTLARSHFDFVVIDMPHTLV 284

Query: 288 SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP-PYLVLNQVKTPKKPEI 346
            W++ +L ++        LD   +R+++N + + + L+  D P   L     + PK  ++
Sbjct: 285 QWSETILNMAHVYFSMVELD---MRSAQNALRLKRALQSEDLPFEKLRFALNRAPKFTDL 341

Query: 347 S----ISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
           S    +      LGI+    +P  G     S++ G
Sbjct: 342 SGKSRVKRMAESLGISIDLQLPDGGKQVAQSSDHG 376


>gi|148657459|ref|YP_001277664.1| response regulator receiver protein [Roseiflexus sp. RS-1]
 gi|148569569|gb|ABQ91714.1| response regulator receiver protein [Roseiflexus sp. RS-1]
          Length = 419

 Score = 70.9 bits (172), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 93/400 (23%), Positives = 168/400 (42%), Gaps = 36/400 (9%)

Query: 23  MCSLPRISVHVFCVTDTL-YSVVERSKIDPRMSQVNMRITRGSIAEAVSCFS--DSSTPD 79
           M +  RI+V V  V + L    + R   +P++++V+       +A   + F     + PD
Sbjct: 1   MANNVRINVIVVTVPERLDQEWIGRLAAEPQIARVD------RVAATTAGFELIRQTRPD 54

Query: 80  LIIVQTKVDS-----REVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLI 134
           L+IV   +D      R V + L     +C      I +    D +  R L++    + L 
Sbjct: 55  LVIVDRDLDQAEQLVRHVFTTLP--TTIC------IAVVARVDTATLRRLVAVGARDVLG 106

Query: 135 EPLSVADIINSISAIFTPQEEGKGS------------SGCSISFIGSRGGVGSSTIAHNC 182
            PL  A++I SI A+   + + +               G  +  I  +GG G++ IA N 
Sbjct: 107 RPLQYAELIQSIRALLETEADRRTRVLATLDSNRPQVRGKLVVVISPKGGSGTTMIAANL 166

Query: 183 AFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAE 242
           A  +  V A   LLAD  L +G A ++ +    +++ D I  +  ID A +  +   +  
Sbjct: 167 AVGLRQVSAGRVLLADCCLQFGDAGVHLNLWSRHTLVDLIDHLDDIDDAMIGSVVQQHTS 226

Query: 243 NLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVI 302
              +L AP       D     I  ++D L   +  V+ D     +  T  ++  +D+ ++
Sbjct: 227 GTHVLLAPNTPDAAGDIGGGQIGRLIDALLDRYEYVVADTWSFLDDVTATLVGKADETLV 286

Query: 303 TTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAI 362
            T+ ++  L+N K  ++ +++         LV+N  + P    I++ D    L    SA 
Sbjct: 287 VTTPEVPSLKNVKRFLEFIQREGLTRGKITLVIN--RFPSVDGIALDDVKQHLRYPISAN 344

Query: 363 IPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMG 402
           IP +G +   S N G  I    P+S I   L+  +  + G
Sbjct: 345 IPSEGRLVTHSVNRGIPIVLSHPESWIGQSLLKLAAHVAG 384


>gi|113866739|ref|YP_725228.1| flp pilus assembly ATPase [Ralstonia eutropha H16]
 gi|113525515|emb|CAJ91860.1| flp pilus assembly ATPase [Ralstonia eutropha H16]
          Length = 397

 Score = 70.9 bits (172), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 77/348 (22%), Positives = 152/348 (43%), Gaps = 10/348 (2%)

Query: 52  RMSQVNMRITRGSIAEAVSCF----SDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGT 107
           R+S V       ++ E +S F    S     DL+I++    +   + A+E L +      
Sbjct: 19  RLSTVVGNFQAMTLQEGLSRFPFHASRLRMADLLILELPAINASQMHAIETLRQQHPELP 78

Query: 108 KVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFI 167
            +++    +   L +A+ +  + + L  PL    +  ++  +          +G  IS I
Sbjct: 79  CILITQAPSSEVLIKAMRAG-IRDVLSWPLDKGQLAEALKRVEVGHVPRAQETGQVISVI 137

Query: 168 GSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSISDAIYPVG 226
             +GG G+S +A N   ++A       L+ DL+  +G    I  DK P +++ D    + 
Sbjct: 138 SCKGGAGTSFVAANLGDALARHLDKRVLVVDLNRHFGDLTYIVSDKTPPSTLPDICSQID 197

Query: 227 RIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVW 286
           R+D AF+    V       +L   A   +     +  +  +L +++  +  VI D+    
Sbjct: 198 RMDAAFLEACLVHVDNGFDVLAGAADPIKASQIQKDKLEWILSVVQPAYDFVIFDLGQSI 257

Query: 287 NSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR-PADKPPYLVLNQVKTPKKPE 345
           +  +  +L  SD++ +     L+  R  + L+D+L+ L  P DK   LVLN  +T +K E
Sbjct: 258 DPLSIGMLDHSDRICVVAEPALSFGRPGRRLLDILRALHYPTDK-VRLVLN--RTGRKNE 314

Query: 346 ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
           +  +      G+  +  +P D A    + + G+ + ++  +SA+A  L
Sbjct: 315 MPRATMEEIFGMKAAFTLPDDPAAVDEAVSHGEPVAKLSRRSAMARAL 362


>gi|254464255|ref|ZP_05077666.1| response regulator receiver protein [Rhodobacterales bacterium Y4I]
 gi|206685163|gb|EDZ45645.1| response regulator receiver protein [Rhodobacterales bacterium Y4I]
          Length = 412

 Score = 70.5 bits (171), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 67/281 (23%), Positives = 122/281 (43%), Gaps = 21/281 (7%)

Query: 67  EAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDS----GTKVIVIGDTNDVSLYR 122
           EA++ F  +    L  V   +DS +    L  + E+       G KVI+I +    +   
Sbjct: 50  EALAFFGQTEAEPLQFVALAIDSADE-GDLPLMGEIITQAKARGIKVILIAEDVTPAALH 108

Query: 123 ALISNHVSEYLIEPLSVADIINSISAIFT--------PQEEGKGSS--GCSISFIGSRGG 172
            L+     E++  PL   ++  +I  +          P +   GS   G  I   G  GG
Sbjct: 109 TLLRQGADEFVPYPLPEQELQAAIERLQAPPPPAAQKPHQLQSGSQREGAVIVCHGLAGG 168

Query: 173 VGSSTIAHNCAFSIASVFAME---TLLADLDLPYGTANINFDKDPINSISDAIYPVGRID 229
            GS+T+A N A+ +A++   E     L DLDL +G+ +   D      + + +     +D
Sbjct: 169 TGSTTMAVNLAWELAALSEQEEPSVCLLDLDLQHGSVSTYLDLPRREVVMEMLSESESMD 228

Query: 230 KAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSW 289
           +    +  + + E L +LTAP  +        + I  V+++    F  V++D+PH    W
Sbjct: 229 EELFGQSLLPFQEKLQVLTAPLEMVPLDLLSPEDITRVIEMARSHFDFVVIDMPHTLVQW 288

Query: 290 TQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP 330
           ++ VLT +        LD   +R+++N + + + L+  D P
Sbjct: 289 SETVLTTAHVYFALIELD---MRSAQNALRMKRALQSEDLP 326


>gi|83717074|ref|YP_440461.1| putative pilus assembly protein CpaE [Burkholderia thailandensis
           E264]
 gi|167617236|ref|ZP_02385867.1| putative pilus assembly protein CpaE [Burkholderia thailandensis
           Bt4]
 gi|83650899|gb|ABC34963.1| putative pilus assembly protein CpaE [Burkholderia thailandensis
           E264]
          Length = 402

 Score = 70.1 bits (170), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 79/359 (22%), Positives = 157/359 (43%), Gaps = 32/359 (8%)

Query: 59  RITR--GSIAEAVSCFSDSSTPDLIIVQ-TKVDSREVLSALEPLAEVCDSGTKVIVIGDT 115
           R+TR  G  A+ V         D++++    +D+ E L+A+E L+ +    T ++V  D 
Sbjct: 28  RVTRTVGRAAQIVQRTDGLDAFDILMIDGVALDTAE-LAAIEKLSRLHPGLTCMLVSADA 86

Query: 116 NDVSLYRALIS--NHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCS---------I 164
           +  +L  A+ +    V  + +EP ++ D +             + +S C+         +
Sbjct: 87  SSQTLLEAMRAGVRDVLRWPLEPRALDDALK------------RAASQCAQRDTPDTRIV 134

Query: 165 SFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSISDAIY 223
           SF+  +GG G+S IA N A+ IA      TLL DL+  +  A  +  D+ P ++++    
Sbjct: 135 SFMSCKGGAGTSFIAGNVAYEIAEGSKRRTLLIDLNQQFADAAFLVSDQSPPSTVAQLCG 194

Query: 224 PVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVP 283
            + R+D AF+    V   E   +L       +  D  E  +  +L +    +  VI D+ 
Sbjct: 195 QLERMDGAFLDASVVRVTETFHVLAGAGDPIKAADLREDALEWILGVAAPRYDFVIFDLG 254

Query: 284 HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR-PADKPPYLVLNQVKTPK 342
              N+ +   L  SD+V +     +  +R ++ L ++L  L  P D+   ++  Q +   
Sbjct: 255 VSLNAVSMVALDRSDRVEVVLQPSMPHVRAARRLQELLVSLGCPLDRLQLVLNRQTRASD 314

Query: 343 KPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLM 401
           +   ++ +    L +  + +I  D A  G + + G  +  +     +A  L  F++ L+
Sbjct: 315 RARAALEEV---LSMHAAHVIADDPATVGEAVDQGVPLSRLSRNCGVARSLQAFAKQLV 370


>gi|254255258|ref|ZP_04948574.1| Flp pilus assembly protein ATPase CpaE [Burkholderia dolosa AUO158]
 gi|124900995|gb|EAY71745.1| Flp pilus assembly protein ATPase CpaE [Burkholderia dolosa AUO158]
          Length = 402

 Score = 70.1 bits (170), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 71/317 (22%), Positives = 137/317 (43%), Gaps = 9/317 (2%)

Query: 80  LIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISN--HVSEYLIEPL 137
           L++  T  D+ E L+A+E +  +    T ++V  DT+   L  A+ +    V ++ ++P 
Sbjct: 52  LLVDGTSADAAE-LAAIERICRLHTGLTCILVTADTSPHVLLDAMRAGARDVLQWPLDPQ 110

Query: 138 SVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLA 197
           ++   +   +A  T ++         +SF+  +GG G+S  A N A+ IA  F    LL 
Sbjct: 111 ALGHALERAAAQSTRRDRDDTRI---VSFMSCKGGAGTSFAAGNVAYEIAEGFKRRVLLI 167

Query: 198 DLDLPYGTAN-INFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRT 256
           DL+  +  A  +  D+ P +++      + R+D AF+        E+  +L       R 
Sbjct: 168 DLNQQFADAAFLVSDETPPSTLPQLCAQIERLDGAFLDASVAHVTEHFHVLAGAGDPVRA 227

Query: 257 YDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKN 316
            +  E  +  +L +    +  VI DV    N  +   L  SD++ I     +  +R  + 
Sbjct: 228 AEMREDALEWILGVASSRYDFVIFDVGVGINPLSMVALDRSDRIHIVLQPAMPHVRAGRR 287

Query: 317 LIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANS 376
           L+++L  L  +     L++N  +  +  E + +     LG+  +  IP D      + N 
Sbjct: 288 LLEMLVSLGYSTDQLRLIVN--RATRASERTRTALEEVLGLRAACTIPDDADTVLEAINQ 345

Query: 377 GKMIHEVDPKSAIANLL 393
           G  +  +    A+A  L
Sbjct: 346 GHPVSRLARGGAVARAL 362


>gi|197106490|ref|YP_002131867.1| Flp pilus assembly protein, ATPase [Phenylobacterium zucineum HLK1]
 gi|196479910|gb|ACG79438.1| Flp pilus assembly protein, ATPase [Phenylobacterium zucineum HLK1]
          Length = 388

 Score = 70.1 bits (170), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 127/292 (43%), Gaps = 15/292 (5%)

Query: 109 VIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFT-----PQEEGKGSSGCS 163
           V+++G++    L R L+    S+ L  P +   +  ++  +       PQ    G S C 
Sbjct: 78  VLLVGESLPAGLVRNLLRLGDSDVLEAPFTGEQLTAAVLGLLAASTPAPQASAGGESRC- 136

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAME--TLLADLDLPYGTANINFDKDPINSISDA 221
            +  G+ GG G++T+A   A ++A+    +    L DL+L  G A       P   ++D 
Sbjct: 137 WAVSGAVGGAGATTLAIEIATALAARSKKDRSVCLIDLNLADGAAAAYLGAQPAMRLADF 196

Query: 222 IYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFD---EKMIVPVLDILEQIFPLV 278
                R+D A +       ++ L +L   A +     FD    + ++ VL++  + +  V
Sbjct: 197 GQAAERLDAAMLQAFITPVSKQLDLL---AGVRDPGGFDAVSREAVLRVLEVACECYDWV 253

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQV 338
           ILDVP     WT E L   D+V++ + L +  L  ++   D ++        P +VLN++
Sbjct: 254 ILDVPRHRRPWTLEALAGCDEVLVISELTVPALLAARAYSDEIEHALGKGLKPRIVLNRL 313

Query: 339 KTPK-KPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAI 389
            +    P  S+++    L     A +  D      SAN G  I +  PKS I
Sbjct: 314 ASRMFGPAPSMAEAERALQRKAEAGVSSDWEAAAASANLGGPIAQHRPKSKI 365


>gi|309792342|ref|ZP_07686812.1| response regulator receiver protein [Oscillochloris trichoides DG6]
 gi|308225657|gb|EFO79415.1| response regulator receiver protein [Oscillochloris trichoides DG6]
          Length = 423

 Score = 70.1 bits (170), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 133/298 (44%), Gaps = 24/298 (8%)

Query: 60  ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVI---GDTN 116
           I + S        +    PD++++   +   + ++A E +    D   +VI++   G+T+
Sbjct: 35  IAKASNGREAVAMAKQLHPDVVLMDINMPDMDGIAATEAIM-TQDPTIQVIIMSVQGETD 93

Query: 117 DVSLYRALISNHVSEYLIEPLSVADIINSISAIF---------TPQEEGKGSSGCS---- 163
              L RA+++    E+L +P+S  D+  SI  +          T Q    G  G      
Sbjct: 94  --YLRRAMLAG-AREFLTKPISADDLYKSIRHVHRLAATRPKVTMQAADTGGGGAKSSGI 150

Query: 164 ----ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSIS 219
               I+    +GGVGSS+IA N A ++  +   +  L D ++ +G  ++  +     +I 
Sbjct: 151 QGQIIAVFSPKGGVGSSSIAANLAVALRQLTNKKVALLDGNVIFGDLSVILNLRSDKTII 210

Query: 220 DAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVI 279
           D    +  +D   ++ +   +   + +L AP    R        I  +LD++ Q F  V+
Sbjct: 211 DIATRIDDMDGELLNDVMATHTSQVKVLLAPPDPQRGELVTSDHIRAILDLMRQEFDYVV 270

Query: 280 LDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQ 337
           +D P  +   +  VL +++++V   +L++  +RN +  ++V   L    +   LVLN+
Sbjct: 271 VDTPASFQDRSLAVLDMANRIVALMTLEMHCIRNIRLFLEVADLLEYPHEKVMLVLNK 328


>gi|56477523|ref|YP_159112.1| flp pilus assembly protein, ATPase [Aromatoleum aromaticum EbN1]
 gi|56313566|emb|CAI08211.1| flp pilus assembly protein, ATPase [Aromatoleum aromaticum EbN1]
          Length = 384

 Score = 70.1 bits (170), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 76/350 (21%), Positives = 154/350 (44%), Gaps = 14/350 (4%)

Query: 74  DSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYL 133
           + + PD++++     +   L ALE L         +++  DT+   L +A  +  V E L
Sbjct: 44  NGTVPDVVVLDAFRPAN--LGALEQLTLRYPQIEPIVITADTSSDFLLQAFRAG-VREVL 100

Query: 134 IEPLSVA-DIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAM 192
             P+S + + +++  A  T +  G  ++G  ++    +GG G++ +A N A+ +A+    
Sbjct: 101 --PISPSPEALHAALARITRKRGGSATNGKILALTSCKGGSGATFLATNLAWVLAAAHGK 158

Query: 193 ETLLADLDLPYGTANINF-DKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPA 251
              L DL+L +G A +   D+ P ++++     + R+D AF+    +  A    +L AP 
Sbjct: 159 RVALIDLNLQFGDAAMYVTDQKPASNLALVCQQIHRLDAAFLQSAMIEVAPGFHLLAAPD 218

Query: 252 MLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGL 311
             + + D   + +  +L +    +  VI+DV    ++ + +   ++D +     L L  +
Sbjct: 219 DPAHSTDVRPEHVEAILKVARTNYDFVIVDVGRSLDAVSLKPFDMADMIFPVVQLTLPFI 278

Query: 312 RNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFG 371
           R +K L++V   L        LV+N  +  K  +IS+ D    +       +P       
Sbjct: 279 REAKRLVEVFVSLGYPMSKVGLVVN--RQHKNSDISLQDVERTVKAKLFKTVPNSYDTVA 336

Query: 372 MSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIF 421
            S N G+ I  +   S +   L + +  L     V  P+ A    + ++F
Sbjct: 337 ASVNQGEPIARLAKNSPVTKALREIAESL-----VDDPEKASKGWLSRLF 381


>gi|313902403|ref|ZP_07835806.1| response regulator receiver protein [Thermaerobacter subterraneus
           DSM 13965]
 gi|313467334|gb|EFR62845.1| response regulator receiver protein [Thermaerobacter subterraneus
           DSM 13965]
          Length = 468

 Score = 69.7 bits (169), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 65/274 (23%), Positives = 120/274 (43%), Gaps = 17/274 (6%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPL 137
           P +I++   +   + L+A E +    D  T++I++   N    +R  +     ++L++P 
Sbjct: 115 PHVILMDINLPRLDGLAAAERILRQLD--TRIIMVSVENGPEYFRRAMQAGACDFLVKPF 172

Query: 138 SVADIINSISAIFTPQEEG-----KGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAM 192
           S   +  ++     P  E      +G  G  I+   ++GGVG ST+A N A ++A     
Sbjct: 173 SPDALAEAVRRAVPPAGEPALVTPQGGRGRLITVFSAKGGVGKSTLAVNLAVALAKRPDR 232

Query: 193 ETLLADLDLPYGTANINFDKDPINSISDAIYPVGRID-KAFVSRLPVFYAENLSILTAPA 251
            T+L DLDL  G+A +     P  +++D     G +D +A    L       LS+L AP 
Sbjct: 233 RTVLVDLDLELGSAAMLLGIRPRATLADLCRREGALDPQAVAPALHPVSGFRLSLLPAPL 292

Query: 252 MLSRTYDFD--------EKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVIT 303
                 + +              VL+ L      V++D    +         +SD +V+ 
Sbjct: 293 FPHEAAEIEGEGRRDPARNYTAEVLEALRSTHDFVVVDTAANYRDSNLTAFDMSDLLVVV 352

Query: 304 TSLDLAGLRNSKNLIDVL-KKLRPADKPPYLVLN 336
           T+ D+  + N+   +D+L +KL   ++   +VLN
Sbjct: 353 TTSDIPAVANTAKCLDLLIQKLEYPEEKVRVVLN 386


>gi|300856048|ref|YP_003781032.1| putative response regulator receiver protein [Clostridium
           ljungdahlii DSM 13528]
 gi|300436163|gb|ADK15930.1| putative response regulator receiver protein [Clostridium
           ljungdahlii DSM 13528]
          Length = 385

 Score = 69.7 bits (169), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 126/259 (48%), Gaps = 15/259 (5%)

Query: 92  VLSALEPLAEVCDS--GTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAI 149
           VL+ LE   ++        VI++    +    +  + +   EY+I+P +   +I +I+  
Sbjct: 62  VLNGLEATEKITTEYPSVMVIIMSVQAESEYLKKAMFHGAKEYIIKPFNYNTLIETITTT 121

Query: 150 FTPQEEGK----GSS-----GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLD 200
           +    E +    GS+       +I+F  S+GGVG S +A N A  ++     + LL D+D
Sbjct: 122 YEKCRERQVKLTGSAEKVKDAKTIAFFSSKGGVGKSVLAVNTAIVLSKESDKKVLLMDMD 181

Query: 201 LPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYA--ENLSILTAPAMLSRTYD 258
           L +G  ++  +K    +I DA+   G+ID ++ +  P  Y    NL I  AP        
Sbjct: 182 LQFGDISMLVNKYNEKTILDAVED-GQID-SYENIKPYLYKYNNNLDIFFAPQKPEAAEY 239

Query: 259 FDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLI 318
             ++ I  ++  + + + ++++D    +N  T  +L ++ K+++ +++++  L+N+K  +
Sbjct: 240 ITKETIEKIMKDVRKEYDVIVVDTGINFNDSTLYILDMAQKILMVSTMEIMALKNTKLGL 299

Query: 319 DVLKKLRPADKPPYLVLNQ 337
            V++ +        LV+N+
Sbjct: 300 KVMESVGYDKDKVKLVINR 318


>gi|167584963|ref|ZP_02377351.1| response regulator receiver protein [Burkholderia ubonensis Bu]
          Length = 402

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 74/327 (22%), Positives = 145/327 (44%), Gaps = 13/327 (3%)

Query: 80  LIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSV 139
           L++    +D+ E L+A+E +  +  S T ++V  D +  +L  A+ +  V + L  PL V
Sbjct: 52  LMVDCASLDAAE-LAAIERMCRLHMSLTCMLVTADASQHTLLDAMRAG-VRDVLAWPLEV 109

Query: 140 ---ADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLL 196
               D +   +A  T ++ G       +SF+  +GG G++ +A N A+ IA  F    LL
Sbjct: 110 HALTDALQRAAAQSTRRDSGDTRI---VSFMSCKGGSGTTFVASNVAYEIAETFKRRVLL 166

Query: 197 ADLDLPYGTAN-INFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSR 255
            DL+  +G A  +  D+ P +++      + R+D AF+       ++   +L       +
Sbjct: 167 IDLNQQFGDAAFLVSDETPPSTLPQLCTQLERLDGAFLDASVARVSDTFHVLAGAGDPVK 226

Query: 256 TYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSK 315
             +  +  +  +L +    +  VI DV    N  +   L  SD++ +     +  +R  +
Sbjct: 227 AAEMRDDALEWILGVAAPRYDFVIFDVGLSLNPVSMVALDRSDRIGLVLLPTMPHVRAGR 286

Query: 316 NLIDVLKKL-RPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSA 374
            L ++L  L  P D+   +V    +  ++   ++ +    LG+  + +IP D A    S 
Sbjct: 287 RLQEILMSLGYPLDRLRLIVNRNARASERTRAALEEV---LGMHATDVIPDDPATVLESI 343

Query: 375 NSGKMIHEVDPKSAIANLLVDFSRVLM 401
           N G  I  +    A+   L   ++ L+
Sbjct: 344 NQGHPISRLARNCAVTRALQGCAKQLV 370


>gi|323499919|ref|ZP_08104878.1| Flp pilus assembly protein [Vibrio sinaloensis DSM 21326]
 gi|323315160|gb|EGA68212.1| Flp pilus assembly protein [Vibrio sinaloensis DSM 21326]
          Length = 408

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 74/341 (21%), Positives = 148/341 (43%), Gaps = 14/341 (4%)

Query: 69  VSCFSDSSTPDLIIVQTKVDSREVLSALE----PLAEVCDSGTKVIVIGDTNDVSLYRAL 124
           V+  +  S PDLI V+T  +  + +  L+    P     +   ++IV G+ +D    +  
Sbjct: 59  VANLAHFSPPDLIFVETGPNWAQKIVELQQFESPAENSSNHEAQLIVFGNEHDSGALKIA 118

Query: 125 ISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSS---GCSISFIGSRGGVGSSTIAHN 181
           +    ++++ +       I  ++ +     E K +S   G  + F+ S+GG G+S +A N
Sbjct: 119 LRIGAADFVSDKAE----IQELTPLLNNVAEDKVASRNLGELMVFMNSKGGCGASMLALN 174

Query: 182 CAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYA 241
            A  +A     + +L DLD+ +G  N   +  P  S+ DA+  V  +D+  +  L   + 
Sbjct: 175 TAIKMAQQHPEQVMLLDLDIQFGVVNDYLNIQPTYSLIDALANVSDLDEVSLGSLVTKHD 234

Query: 242 ENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVV 301
             L IL      S         +  +L  L + +P V++D+    +     V++ + K+ 
Sbjct: 235 SGLHILAFKRENSHENYEKAHHLNKLLPFLREQYPYVVVDLSRGLDRLFAPVISPATKLF 294

Query: 302 ITTSLDLAGLRNSKNLIDVLKKLRPADKPPY-LVLNQVKTPKKPEISISDFCAPLGITPS 360
           + T  +L  +++   +I  L      ++    +++N+ +  K+  I + D    +G    
Sbjct: 295 MVTQQNLVAIKSCNQIIKTLSFEFGINRDQVEIIVNRYE--KRQTIKLKDIKEAVGDVSV 352

Query: 361 AIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLM 401
             IP D  V   SAN G+   E    S ++  +  F  +L+
Sbjct: 353 HTIPNDFKVALESANLGRPFIEAKKGSTLSKSVSKFVSLLL 393


>gi|254229334|ref|ZP_04922751.1| hypothetical protein VEx25_1584 [Vibrio sp. Ex25]
 gi|262393421|ref|YP_003285275.1| type II/IV secretion system ATPase TadZ/CpaE associated with Flp
           pilus assembly [Vibrio sp. Ex25]
 gi|151938142|gb|EDN56983.1| hypothetical protein VEx25_1584 [Vibrio sp. Ex25]
 gi|262337015|gb|ACY50810.1| type II/IV secretion system ATPase TadZ/CpaE associated with Flp
           pilus assembly [Vibrio sp. Ex25]
          Length = 402

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 75/346 (21%), Positives = 157/346 (45%), Gaps = 11/346 (3%)

Query: 78  PDLIIVQT-KVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEP 136
           PDLI ++T +  +++V       + +  + T +IV GD ND +  +  +    ++YL   
Sbjct: 65  PDLIYIETGESWAQKVAHVYSSDSSLQHNHTALIVFGDENDTASLKMALRLGATDYLSRS 124

Query: 137 LSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLL 196
           + + ++   + +    +   K     ++ FI ++GG G++T+A N A  ++S    + LL
Sbjct: 125 VDLGELYPLLKSTADEKIANKQMGDLTL-FINTKGGSGATTLAINTAIELSSYAKSKVLL 183

Query: 197 ADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRT 256
            DLD+ +  A    +  P  +I+D I  V  +D+  +  L   +   L+ L      ++ 
Sbjct: 184 IDLDMQFSDAADYLNCKPKYNINDVIDSVNDLDELSLEGLVYQHPSGLNYLCFNQNDTKD 243

Query: 257 YDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKN 316
                  +  +L IL Q +  +I+D+ H      Q++++ +  + +    ++  ++++ +
Sbjct: 244 NHKHAVQVSKLLPILRQFYSHIIVDLSHGVEHVYQQIVSPATHIFLIMQQNVTSVKHAVS 303

Query: 317 LIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSAN 375
            I  L+     +     L++N+ +  KK  IS+ D    +      ++P + A+   SAN
Sbjct: 304 YIRSLELDYGLSSHQVELIVNRFE--KKSTISLKDIENAVSGHAIHLVPNNFAIAIESAN 361

Query: 376 SGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIF 421
            G  I +    SA+   L + S +L        P     + IKK+F
Sbjct: 362 LGNPIVQSKKNSALKASLAEISHLL------ESPTKENQSWIKKLF 401


>gi|260431086|ref|ZP_05785057.1| response regulator receiver protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260414914|gb|EEX08173.1| response regulator receiver protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 411

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 79/340 (23%), Positives = 144/340 (42%), Gaps = 32/340 (9%)

Query: 64  SIAEAVSCFSDSSTPDLIIVQTKVDSREV--LSAL-EPLAEVCDSGTKVIVIGDTNDVSL 120
             AEA++ FS      L  V   +D  +   L+ + E + +  +   KV++I +    + 
Sbjct: 44  GFAEALAFFSQPEAESLQFVALAIDGEDEDNLTLMGEIITQAKEKNIKVVLIAEDVTPAA 103

Query: 121 YRALISNHVSEYLIEPL------SVADIINSISAIFTPQ------EEGKGSSGCSISFIG 168
              L+     E++  PL         D +N    +  PQ        G    G      G
Sbjct: 104 LHQLLRKGADEFVPYPLPENELQEAIDRMNKPEPVIEPQPVAAPLSNGAPKEGALFVVHG 163

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMET---LLADLDLPYGTANINFDKDPINSISDAIYPV 225
             GGVG++T+A N A+ +A+V A +     L DLDL YGT +   D     ++ + +   
Sbjct: 164 LAGGVGATTLAVNLAWELATVSAKDAPKVCLIDLDLQYGTVSTYLDLPRRETVFEMLSDT 223

Query: 226 GRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHV 285
             +D    ++    Y + + +LTAP+ +        + I  V+D+  + +  V++D+P  
Sbjct: 224 AAMDDDVFAQALQRYDDKMDVLTAPSDMVPLDLLTPEDIQRVIDMARKHYDYVLIDMPKT 283

Query: 286 WNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY----LVLNQVKTP 341
              W++ VL  +        LD   +R+++N +  LK+   A++ P+      LN  + P
Sbjct: 284 LVHWSETVLQAAHVYFALIELD---MRSAQNALR-LKRALQAEELPFNKLRFALN--RAP 337

Query: 342 KKPEIS----ISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
           K  ++S    +      LGI+    +P  G     S + G
Sbjct: 338 KFTDLSGKSRVKRMGESLGISIDLQLPDGGKPVMQSGDHG 377


>gi|254510478|ref|ZP_05122545.1| response regulator receiver protein [Rhodobacteraceae bacterium
           KLH11]
 gi|221534189|gb|EEE37177.1| response regulator receiver protein [Rhodobacteraceae bacterium
           KLH11]
          Length = 410

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 86/340 (25%), Positives = 151/340 (44%), Gaps = 33/340 (9%)

Query: 64  SIAEAVSCFS--DSSTPDLIIVQTKVDSREVLSAL-EPLAEVCDSGTKVIVIG-DTNDVS 119
             AEA++ FS  +S++   + +    D  E L+ + E +    + G KV++I  D    S
Sbjct: 44  GFAEALAFFSQPESNSLQFVALALDGDDEENLTMMGEIITRAKEKGIKVVLIAEDVTPAS 103

Query: 120 LYRALISNHVSEYLIEPLSVADIINSISAI--------FTPQEEGKGSS---GCSISFIG 168
           L+R L+     E++  PL   ++  +I  +                GS+   G      G
Sbjct: 104 LHR-LLRKGADEFVPYPLPENELQEAIDRMNRPDPVAAPQAAAPAAGSTSKEGALFVVQG 162

Query: 169 SRGGVGSSTIAHNCAFSIASVF---AMETLLADLDLPYGTANINFDKDPINSISDAIYPV 225
             GGVG++T+A N A+ +A+V    A +  L DLDL YGT +   D     ++ + +   
Sbjct: 163 LAGGVGATTMAVNLAWELATVSDKDAPKVCLIDLDLQYGTISTYLDLPRHEAVFEMLSDT 222

Query: 226 GRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHV 285
             +D+   S+    + + L +LTAP+ +          I  V+DI    F  VI+D+P  
Sbjct: 223 DSMDEDSFSQALQTFEDKLQVLTAPSDMVPLDIITPDDIQRVIDIARSQFDYVIVDMPKT 282

Query: 286 WNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY----LVLNQVKTP 341
              W++ VL  +        LD   +R+++N +  LK+   A++ P+      LN  K P
Sbjct: 283 LVHWSETVLQAAHVYFALIELD---MRSAQNAL-RLKRALQAEELPFNKLRFALN--KAP 336

Query: 342 KKPEIS----ISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
           K  +++    +      LGI+   ++P  G     S + G
Sbjct: 337 KFTDLNGKSRVKRMGESLGISIDLLLPDGGKPVMQSGDHG 376


>gi|254506723|ref|ZP_05118863.1| Flp pilus assembly protein [Vibrio parahaemolyticus 16]
 gi|219550304|gb|EED27289.1| Flp pilus assembly protein [Vibrio parahaemolyticus 16]
          Length = 408

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 74/343 (21%), Positives = 155/343 (45%), Gaps = 18/343 (5%)

Query: 69  VSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSG----TKVIVIGDTNDVSLYRAL 124
           ++  +  + PDLI V+T  +  + +  L+      ++       +IV G+ +D    +  
Sbjct: 59  IANLAQFTPPDLIFVETGPNWAQKIVELQQFESPHETNDGHEASLIVFGNEHDSGALKIA 118

Query: 125 ISNHVSEYL---IEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHN 181
           +    ++++    E   +A ++N+++     ++    + G  + F+ S+GG G+S +A N
Sbjct: 119 LRIGAADFVSDKAEIQELAPLLNNMAE----EKVANRNLGELLVFMNSKGGCGASMLALN 174

Query: 182 CAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYA 241
            A  +A     + +L DLD+ +G  N   +  P  S+ DA+  V  +D+  +  L   +A
Sbjct: 175 TAIKMAQSHPDQVMLLDLDIQFGVINDYLNIQPTYSLVDALANVSDLDEVSLGSLVTKHA 234

Query: 242 ENLSILTAPAMLSRTYDFDEKMIV--PVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDK 299
             L IL        +++  EK I    +L  L + +P VI+D+    +     V++ + K
Sbjct: 235 SGLHILAFKR--ENSHENHEKAIYLNKLLPFLREQYPYVIVDLSRGLDRMFAPVISPATK 292

Query: 300 VVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY-LVLNQVKTPKKPEISISDFCAPLGIT 358
           + + T   L  +++   +I  L      ++    +++N+ +  K+  I + D    +G  
Sbjct: 293 LYMVTQQSLVSIKSCNQIIKTLSFEFGINRDQVEIIVNRYE--KRQSIKLKDIKEAVGDV 350

Query: 359 PSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLM 401
               +P D  V   SAN G+   E    SA++  +  F+  L+
Sbjct: 351 AVHTVPNDFKVALESANLGRPFVESRKGSALSKSVGKFATALL 393


>gi|302343417|ref|YP_003807946.1| Flp pilus assembly protein ATPase CpaE [Desulfarculus baarsii DSM
           2075]
 gi|301640030|gb|ADK85352.1| Flp pilus assembly protein ATPase CpaE [Desulfarculus baarsii DSM
           2075]
          Length = 381

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/277 (24%), Positives = 124/277 (44%), Gaps = 8/277 (2%)

Query: 129 VSEYLIEPLSVADIINSISAIF----TPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAF 184
           + EYL++   + D      A+F      Q  G  + G  I  +G++GGVG S +A N A+
Sbjct: 102 LREYLVDERRLGDSFKE--AMFRLRAAGQNLGPDAKGRIIGVMGAKGGVGVSHLAINLAW 159

Query: 185 SIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENL 244
           +I+    +   L DLDL  G      D++   + SDA     R+D A +  L    A  L
Sbjct: 160 AISQEQGLRVALVDLDLFGGNEAFMLDQEVKRNFSDAAAMQERLDAAAMEGLLHEVAPGL 219

Query: 245 SILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITT 304
            +L AP   +     + + +  VLD+L + + +V++D+       T   L  ++  ++  
Sbjct: 220 RLLAAPDDPADAEMINAEHVSSVLDVLARGYAVVVVDLGDSLAETTLTALDQAEMALLLL 279

Query: 305 SLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIP 364
              L GL+++  +  + ++L   D     V+N  +   +  I+  +  A L     A +P
Sbjct: 280 EPSLVGLKSAARVCWLSRRLGHGDGKLRPVVN--RHDARRAIAGREIEAVLNRKVLAWLP 337

Query: 365 FDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLM 401
            +  V   +AN+G+    + PK+     +   +R L+
Sbjct: 338 NEHDVITQAANAGQPALSLRPKAKWCKAVAFLARQLL 374


>gi|197295158|ref|YP_002153699.1| flp pilus type assembly-related protein [Burkholderia cenocepacia
           J2315]
 gi|195944637|emb|CAR57241.1| flp pilus type assembly-related protein [Burkholderia cenocepacia
           J2315]
          Length = 402

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/263 (22%), Positives = 112/263 (42%), Gaps = 4/263 (1%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSISDAI 222
           +SF+  +GG G+S  A N AF IA  F    LL D++  +  A  +  D+ P +++    
Sbjct: 134 VSFMSCKGGAGTSFAAGNVAFEIAEGFKRRVLLIDVNQQFADAAFLVSDETPPSTLPQLC 193

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDV 282
             + R+D AF+        EN  +L       +  +  E  +  +L +    +  VI DV
Sbjct: 194 AQIERLDSAFLDASVAHVTENFHVLAGAGDPVKAAEMREDALEWILGVAAPRYDFVIFDV 253

Query: 283 PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPK 342
               N  +   L  SD++ I     +  +R  + L+++L  L  +     L++N  +  +
Sbjct: 254 GVGINPLSMVALDRSDQIQIVLQPAMPHVRAGRRLLEILVSLGYSTDQLRLIVN--RATR 311

Query: 343 KPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLM- 401
             E + +     LG+  +  IP D      + N G  +  +   SA+A  L   ++ L+ 
Sbjct: 312 ASERTRTALEEVLGLQAACTIPDDAETVLEAINQGHPVSRLARGSAVARALQGCAKQLVD 371

Query: 402 GRVTVSKPQSAMYTKIKKIFNMK 424
           G V   +  +     + ++F  K
Sbjct: 372 GDVRAGRSATHSEPLMSRLFGRK 394


>gi|296156491|ref|ZP_06839329.1| response regulator receiver protein [Burkholderia sp. Ch1-1]
 gi|295893090|gb|EFG72870.1| response regulator receiver protein [Burkholderia sp. Ch1-1]
          Length = 400

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 71/323 (21%), Positives = 137/323 (42%), Gaps = 6/323 (1%)

Query: 57  NMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTN 116
            +R   G+  +     S     DL+IV     +   LS +E L     +    +++  T 
Sbjct: 29  RLRTLHGTAKQLRVHASAIKGADLLIVDDAELTPRDLSGVEELLSHLPN-LHCMLVTPTP 87

Query: 117 DVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSS 176
             +L  A +   V   L  PL   +I ++++ +   +  G    G  +SF   +GG G++
Sbjct: 88  STTLLMAAMRVGVRHVLSWPLDDGEIADALAHVSAKKHAGVRRDGRVVSFTSCKGGSGTT 147

Query: 177 TIAHNCAFSIASVFAMETLLADLDLPYGTANINF-DKDPINSISDAIYPVGRIDKAFVSR 235
            IA N A+++A++     LL DL+  +  A++   DK P  +++D    + R+D AF   
Sbjct: 148 LIAVNLAYALAALRDKRVLLIDLNQQFADASLLVADKAPPATLADLCSQIDRLDAAFFEA 207

Query: 236 LPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLT 295
             +    NL +L       ++ +     +  +L ++ + +  V++DV    N      L 
Sbjct: 208 CVMHVHANLDVLAGAGDPVKSGELRAAHLERILTLVREQYDAVLIDVGQNINPLAIHALD 267

Query: 296 LSDKVVITTSLDLAGLRNSKNLIDVLKKL-RPADKPPYLVLNQVKTPKKPEISISDFCAP 354
            SD + +    ++  L   + ++D+ ++L  PA K   +V NQ    K   I ++     
Sbjct: 268 HSDSICMVVRQNILYLHAGRRMLDIFRELGYPASKVKVIV-NQYD--KNARIDLATLEET 324

Query: 355 LGITPSAIIPFDGAVFGMSANSG 377
            G   +  +P D      + N G
Sbjct: 325 FGAKVAHHLPRDEKQATEALNHG 347


>gi|225174959|ref|ZP_03728956.1| response regulator receiver protein [Dethiobacter alkaliphilus AHT
           1]
 gi|225169599|gb|EEG78396.1| response regulator receiver protein [Dethiobacter alkaliphilus AHT
           1]
          Length = 392

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/294 (21%), Positives = 128/294 (43%), Gaps = 15/294 (5%)

Query: 122 RALISNHVSEYLIEPLSVADIINSISAIFT------------PQEEG-KGSSGCSISFIG 168
           R  I     + L+ P + A +++++   F             PQ +  K   G  ++   
Sbjct: 94  RKAIFAGAKDVLVYPFTPAKLVDAVYRSFQLEQKKQDIQRSKPQRKRRKTGKGQVVTVFS 153

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRI 228
           ++GGVG + ++ N A ++A     + +L DLDL +G A +  +  P  +ISD I  +  +
Sbjct: 154 TKGGVGRTFVSANLAVALAEQTKGKVVLVDLDLDFGNAALALNIVPRYTISDIIDEIRNL 213

Query: 229 DKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNS 288
           D+  +    + +   + +L A A            I  +L +L+  F  V++D+P  +  
Sbjct: 214 DQDMIESYLIPHRSGIKLLPANAQPQMAEFISSDHIEIILKVLQNAFDYVVVDMPGRFYE 273

Query: 289 WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISI 348
                   +D +++ T+ ++A +RN K  +  L +L        +VLN  ++ ++ EI  
Sbjct: 274 PVDPAFQAADMLLMVTTPEVATVRNVKAALIALDELNYPKSKIKVVLN--RSDRRDEIKP 331

Query: 349 SDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMG 402
            D    +     +I+P D      S N G  +  +   S I+    D ++ ++G
Sbjct: 332 KDVETTMNHNLFSILPADYKTVPSSLNQGIPVVLLHNMSKISRSFHDLTQKVVG 385


>gi|220918105|ref|YP_002493409.1| Flp pilus assembly protein ATPase CpaE-like protein
           [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219955959|gb|ACL66343.1| Flp pilus assembly protein ATPase CpaE-like protein
           [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 389

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/298 (21%), Positives = 134/298 (44%), Gaps = 11/298 (3%)

Query: 105 SGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSI 164
           +G +V VIG   D  L    +     E+++     A    ++  +   Q     ++G   
Sbjct: 70  AGIRVTVIGPRKDADLILRAMREGAKEFVL-----AGDDETLKQVLRTQARPSRTAGVGT 124

Query: 165 SF--IGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAI 222
            +    ++GGVG++T+A N A ++ +     T L DL+L  G      D     SI+D I
Sbjct: 125 VYAVFPAKGGVGATTVATNLAGALQA-SGERTCLVDLNLNMGDVLAFLDLAGGYSIADVI 183

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDV 282
             +GR+D+  +    + +A  + +L     +  +   D + +  +L  L   F  ++LD 
Sbjct: 184 GNMGRLDRGLLDATLLRHASGVQVLAQSHRIEDSDRVDAESVAQLLQFLRLHFGAIVLDG 243

Query: 283 PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPK 342
              ++  +   +  SD++V+    ++  +R+++  + + K+L  ++    LV+N  +  K
Sbjct: 244 LRSFDDVSVAAVDASDRIVLLVEQEVPAVRDARRCVALFKRL-GSEAKLKLVVN--RYGK 300

Query: 343 KPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
             +I +      +G+  +A I  D      + N G ++ +   +SA+A  + D  +V+
Sbjct: 301 ANDIGVDVIAETVGLPVAATIANDYPAVIRAVNKGVLVRDEAGRSAVARDIDDLLKVV 358


>gi|269836550|ref|YP_003318778.1| response regulator receiver protein [Sphaerobacter thermophilus DSM
           20745]
 gi|269785813|gb|ACZ37956.1| response regulator receiver protein [Sphaerobacter thermophilus DSM
           20745]
          Length = 421

 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 129/295 (43%), Gaps = 11/295 (3%)

Query: 124 LISNHVSEYLIEPLSVADIINSISAIFTPQ-EEGKGSSGCSISFIGSRGGVGSSTIAHNC 182
           L   HVS     P+ V   + + +A  +P    G+ S G  IS + S+GGVG +T+A N 
Sbjct: 117 LAVRHVSRLAPRPVQV---VTTAAATGSPNGRPGEVSKGRIISVVSSKGGVGRTTLATNL 173

Query: 183 AFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAE 242
           A +I      + +L D  L +G   +  +     +I+D    V  +D+  +  + V +  
Sbjct: 174 AVAIRRATQKQVVLVDAALHFGDVGVMMNIADGKTIADIAPQVHSLDRDLMDDVLVTHGS 233

Query: 243 NLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVI 302
            + +L AP           + +   L +L ++   V++D    ++     V+  SD++++
Sbjct: 234 GVRLLLAPPTPQEAETVTAEHLRASLSLLTKMADYVVVDTRPGFDDAMLSVMDASDRILL 293

Query: 303 TTSLDLAGLRNSKNLIDVLKKLR-PADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSA 361
             ++++  +++++  +++ + L  P DK   LVLN+  T     I   D    L     A
Sbjct: 294 VLTMEMTAIKDARQFLEITELLGYPMDK-VLLVLNRQNTFSG--IPAQDIAENLKRELVA 350

Query: 362 IIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTK 416
            IP + A    S N G  + E  P   ++   V+  R+    V     + A+  K
Sbjct: 351 KIPDEPAALLRSVNEGAPLVETQPDHRVS---VEIKRLATSLVAEDAAEEAVVAK 402


>gi|170701753|ref|ZP_02892689.1| response regulator receiver protein [Burkholderia ambifaria
           IOP40-10]
 gi|170133336|gb|EDT01728.1| response regulator receiver protein [Burkholderia ambifaria
           IOP40-10]
          Length = 424

 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 121/275 (44%), Gaps = 18/275 (6%)

Query: 161 GCSISFIGSRGGVGSSTIAHN---------CAFSIASVFAMETLLADLDLPYGTANINFD 211
           G  ++ +G+R G+G ST+A N          AF +A+  A +T L DL LP G + +  +
Sbjct: 149 GKLVALLGARAGMGVSTLASNLAVWLHKRGAAFGVATPHARQTALVDLGLPAGDSALFLN 208

Query: 212 KDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDIL 271
                   +A+  + RID+ FV+     +A  +++ T P  L+   D      V +L+ L
Sbjct: 209 TRCEFHFVEAVRNLRRIDRTFVNTALARHASGVALTTLPPNLADLRDVSYAACVGLLNRL 268

Query: 272 EQIFPLVILDVPHVWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPAD-- 328
              F   I+D+    N  +  ++  ++D+  +     +A + ++   +D+L+ LR A   
Sbjct: 269 RAFFDQQIVDLGGFTNLEFVAQIAAVADEAWLVCDQGVASIVSA---VDLLEGLRDAGMD 325

Query: 329 -KPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS 387
                LV+NQ        ++ +     LGI     +P      G +AN G++I +   + 
Sbjct: 326 LGKMRLVVNQYDAALS--LTPAQIADRLGIALLTTLPARRVSIGQAANQGRLIVDTAERD 383

Query: 388 AIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFN 422
                L   +  L G V  +K  ++  + +K+   
Sbjct: 384 PYVRALEPLAERLAGTVAPAKSAASGLSVLKRFIQ 418


>gi|85859135|ref|YP_461337.1| flp pilus assembly protein, ATPase [Syntrophus aciditrophicus SB]
 gi|85722226|gb|ABC77169.1| flp pilus assembly protein, ATPase [Syntrophus aciditrophicus SB]
          Length = 403

 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/268 (23%), Positives = 119/268 (44%), Gaps = 4/268 (1%)

Query: 154 EEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAM-ETLLADLDLPYGTANINFDK 212
           EE +   G  ++F GS+GGVG++T+A N A S+A+        L D++  +G  ++    
Sbjct: 125 EEPEVELGQIVNFFGSKGGVGTTTLAVNLAVSLAARKEKPRVALLDMNSSFGEVSMFLGI 184

Query: 213 DPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILE 272
           +      D    + R+D  ++      +   + +L +P  L+  Y  +  +I  +L +++
Sbjct: 185 ESAFDWVDVAKNIDRLDATYMMSTLTRHETGVHVLPSPIRLTEGYRTNPHVIETMLRLMQ 244

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL-RPADKPP 331
            +F  VILD     +  T+ ++ +SD  ++     L  + N K +++    L  P+D   
Sbjct: 245 SMFDYVILDSGQSLDDNTKAIMKISDLTLLVFIASLPCIINLKRILETFHGLGYPSDDSV 304

Query: 332 YLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIAN 391
            +V N  ++ K  EIS  +  + L  T     P D      + N GK I  +D KS I  
Sbjct: 305 EIVAN--RSLKSAEISQKEIESSLRKTVYFTFPNDYRNTMSAINQGKPIAAIDNKSEICQ 362

Query: 392 LLVDFSRVLMGRVTVSKPQSAMYTKIKK 419
              + + ++  R         +   IKK
Sbjct: 363 KFNELAALVAEREKRESKSKELSAPIKK 390


>gi|78060309|ref|YP_366884.1| response regulator receiver protein [Burkholderia sp. 383]
 gi|77964859|gb|ABB06240.1| response regulator receiver protein [Burkholderia sp. 383]
          Length = 402

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 73/348 (20%), Positives = 143/348 (41%), Gaps = 8/348 (2%)

Query: 80  LIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSV 139
           L++  T +D  E L+A+E +       T ++V  D +   L  A+ +    + L  PL  
Sbjct: 52  LLVDGTSLDPSE-LAAIERICRAHAGLTCILVTADPSPHVLLDAMRAG-ARDVLQWPLDT 109

Query: 140 ADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADL 199
             + N++                 +SF+  +GG G+S  A N AF IA  F    LL DL
Sbjct: 110 QALGNALERAAAQSTRRDTDDTRIVSFMSCKGGAGTSFAASNIAFEIAEGFKRRVLLIDL 169

Query: 200 DLPYGTAN-INFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYD 258
           +  +  A  +  D+ P +++      + R+D AF+        EN  +L       +  +
Sbjct: 170 NQQFADAAFLVSDETPPSTLPQLCAQIERLDSAFLDASVAHVTENFHVLAGAGDPVKAAE 229

Query: 259 FDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLI 318
             E  +  +L +    +  VI DV    N  +   L  SD++ +     +  +R  + L+
Sbjct: 230 MREDALEWILGVAAPRYDFVIFDVGVCINPLSMVALDRSDQIQLVLQPAMPHVRAGRRLL 289

Query: 319 DVLKKLRPADKPPYLVLNQV-KTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
           ++L  L  +     L++N+  +   +   ++ +    LG+  +  IP D      + N G
Sbjct: 290 EILVSLGYSTDQMRLIVNRATRASDRTRTALEEV---LGLQAACTIPEDADTVLEAINQG 346

Query: 378 KMIHEVDPKSAIANLLVDFSRVLM-GRVTVSKPQSAMYTKIKKIFNMK 424
             +  +   +A+   L   ++ L+ G V      ++    + ++F  K
Sbjct: 347 HPVSRLARGTAVVRALQGCAKQLVDGEVRAGHSAASSEPLMSRLFGRK 394


>gi|84687275|ref|ZP_01015155.1| Putative Flp pilus assembly protein ATPase CpaE [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84664708|gb|EAQ11192.1| Putative Flp pilus assembly protein ATPase CpaE [Rhodobacterales
           bacterium HTCC2654]
          Length = 420

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 79/303 (26%), Positives = 140/303 (46%), Gaps = 30/303 (9%)

Query: 64  SIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGT----KVIVIGD-TNDV 118
           SI++A++ F    +  L  +   +D  +  + L  +AEV         K IV+ +  + +
Sbjct: 40  SISDALAFFEQPDSDSLEFIAIAMDDEDE-ANLAQIAEVIRQAAARNIKAIVVAEEVSPI 98

Query: 119 SLYRALISNHVSEYLIEPL---SVADIINSI-----------SAIFTPQEEGKGSSGCSI 164
           +L++ L+     E++  PL   ++ D I  +           +A  TPQ  G    G  I
Sbjct: 99  ALHQ-LLKVGAEEFIPYPLPDGALKDAIERLRAPDPAPVLQAAAPNTPQPSGTNREGVLI 157

Query: 165 SFIGSRGGVGSSTIAHNCAFSIASVFAMET---LLADLDLPYGTANINFDKDPINSISDA 221
           +  G  GG G++T+A N A+ +A++   ++    L DLDL +G+ +   D      I + 
Sbjct: 158 AVHGMAGGTGATTVAVNLAWELATIAKADSPRVCLIDLDLQFGSVSTYLDLPRREVIYEF 217

Query: 222 IYPVGRID-KAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVIL 280
           +  +   D ++F++ L  F  E+L + TAPA +          +  ++D     F  VI+
Sbjct: 218 LSDMETADDESFMAALLTFN-EHLHVFTAPAEMLPLDLISSSDVQALIDKARSNFDYVIV 276

Query: 281 DVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQVK 339
           D+P     WT+ VL  +     T  LD+   +N+  +I  LK +  P DK  Y +LN  +
Sbjct: 277 DMPTAVVQWTETVLQAAHIYFATVELDMRSAQNTLRMIRALKSEDLPVDKLRY-ILN--R 333

Query: 340 TPK 342
            PK
Sbjct: 334 APK 336


>gi|220913392|ref|YP_002488701.1| Flp pilus assembly protein ATPase CpaE-like protein [Arthrobacter
           chlorophenolicus A6]
 gi|219860270|gb|ACL40612.1| Flp pilus assembly protein ATPase CpaE-like protein [Arthrobacter
           chlorophenolicus A6]
          Length = 398

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 96/225 (42%), Gaps = 3/225 (1%)

Query: 153 QEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDK 212
           Q+   G  G  I     +GGVG +T+A N A  +  +  M  ++ DLDL +G        
Sbjct: 136 QQTENGGQGLVIGVFSPKGGVGKTTLATNIAIGLGQIAPMSVVIVDLDLQFGDVASGLYL 195

Query: 213 DPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILE 272
           +P ++++DA+ P    D   +      +   +  L AP           + +  +L+ L 
Sbjct: 196 NPEHTVTDAVTPAAAQDSLVLKAFLTVHPAGIYALCAPPNPVDADHITPEHVSRLLEQLA 255

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY 332
           Q F  VILD            +     VV   ++D+  LR  ++ ++VL++L    +  +
Sbjct: 256 QEFQYVILDTAPGLPEIGLAAMEQCTDVVWVGAMDIPSLRGLRSGLEVLRQLEIMPESRH 315

Query: 333 LVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
           +VLN      K  +++ D  + +G      +P   A+  +S N G
Sbjct: 316 VVLNMADA--KAGLNVRDVESTIGAPVDVSVPRSRAI-ALSTNRG 357


>gi|260462602|ref|ZP_05810808.1| response regulator receiver protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259031508|gb|EEW32778.1| response regulator receiver protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 387

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 115/238 (48%), Gaps = 14/238 (5%)

Query: 109 VIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEG-KGSSGCSISFI 167
           +I + D       R L+  + S++L +PL   +++N++    T  + G +G+    I+FI
Sbjct: 89  LIAVSDELTSEQTRVLVRMNASDWLHKPLDGKELLNAV----TFHDTGNQGTKSRIITFI 144

Query: 168 GSRGGVGSSTIAHNCAFSIASV---FAMETLLADLDLPYGTANINFDKDPINSISDAIYP 224
            + GG G++T+A + A  +AS     A  T L DLD  + +AN     +  N   D    
Sbjct: 145 SASGGAGATTLALSAAEFLASKSAERAASTCLVDLD--FQSANCGAYINQFNQF-DLTGI 201

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEK---MIVPVLDILEQIFPLVILD 281
           +G+ ++  V  + V      S LT  A       F+ +    +  +LD++   F  +++D
Sbjct: 202 IGQPERLDVELMDVIKLSRPSGLTLYAFERPQLPFEPRGSDFVFRLLDLVAYRFDDIVID 261

Query: 282 VPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVK 339
           +P++   W   VL+ SD++ I   L++A LR  K L   +++LR       LV N+ K
Sbjct: 262 LPNLDTPWHNSVLSTSDEIFIVFELNVASLRQGKRLYSKIRELRGNAVNITLVANKHK 319


>gi|167725253|ref|ZP_02408489.1| response regulator [Burkholderia pseudomallei DM98]
          Length = 477

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 74/326 (22%), Positives = 144/326 (44%), Gaps = 11/326 (3%)

Query: 80  LIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALIS--NHVSEYLIEPL 137
           L+I    +D+ E L+A+E L+ +    T ++V  D +  +L  A+ +    V  + +EP 
Sbjct: 52  LMIDGAALDTAE-LAAIEKLSRLHPGLTCLLVTTDASSQTLLDAMRAGVRDVLRWPLEPR 110

Query: 138 SVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLA 197
           ++ D +   +A    ++         +SF+  +GG G+S IA N A+ IA      TLL 
Sbjct: 111 ALDDALKRAAAQCAQRDTPDTRI---VSFMSCKGGAGTSFIAGNIAYEIAEGSKRRTLLI 167

Query: 198 DLDLPYGTAN-INFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRT 256
           DL+  +  A  +  D+ P +S++     + R+D AF+    V   +   +L       + 
Sbjct: 168 DLNQQFADAAFLVSDQTPPSSVAQLCGQLERLDGAFLDASVVRVTDTFHVLAGAGDPIKA 227

Query: 257 YDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKN 316
            D  E  +  +L +    +  VI D+    N+ +   L  SD + +     +  +R ++ 
Sbjct: 228 ADIREDALEWILGVAAPRYDFVIFDLGVSLNAVSMVALDRSDHIEVVLQPSMPHVRAARR 287

Query: 317 LIDVLKKLRPADKPPYLVLN-QVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSAN 375
           L ++L  L    +   LVLN Q +  ++   ++ +    L    + +I  D A    + +
Sbjct: 288 LQELLVSLGCPPERIQLVLNRQTRASERARAALEEV---LSTRAAHVIADDPATVNEAVD 344

Query: 376 SGKMIHEVDPKSAIANLLVDFSRVLM 401
            G  +  +     +A  L  F+R L+
Sbjct: 345 QGVPLSRLSRNCGVARSLQAFARQLV 370


>gi|153006804|ref|YP_001381129.1| Flp pilus assembly protein ATPase CpaE-like protein
           [Anaeromyxobacter sp. Fw109-5]
 gi|152030377|gb|ABS28145.1| Flp pilus assembly protein ATPase CpaE-like protein
           [Anaeromyxobacter sp. Fw109-5]
          Length = 382

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 75/324 (23%), Positives = 147/324 (45%), Gaps = 19/324 (5%)

Query: 71  CFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVS 130
             ++   P + +V    D      ++  LA     G +V V+GD+ D  L    + +   
Sbjct: 37  ALAEPGKPAIAVVGLNGDPEAAFRSVTGLAA---GGVRVAVVGDSKDADLILRAMRSGAR 93

Query: 131 EYLI----EPLSVADIINSISAIFTPQEEGKGSSGCSI-SFIGSRGGVGSSTIAHNCAFS 185
           E+++    E L VA     + A+  P   G   +  ++ +F  ++GG+G++TIA N A +
Sbjct: 94  EFVVAGEPERLEVA-----VRALVRP---GMARTTSTVTAFFPAKGGMGATTIAANAAAA 145

Query: 186 IASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLS 245
            A+  A   L+ DL+L  G A    D     ++SD +  + R+D+  +      +   +S
Sbjct: 146 AAARGARACLV-DLELQLGDALSLLDLQSAYTVSDVLANLRRLDRELLDSSVAKHRAGMS 204

Query: 246 ILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTS 305
           +L     L      D   I  ++  L Q +  V+LD  H ++  +   L  +D+VV+  +
Sbjct: 205 VLAQGERLDEADKIDAAAIGQLVGFLRQHYGHVLLDGLHGFDELSLAALDAADRVVLLVT 264

Query: 306 LDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPF 365
            ++  +RN++  + + +KL   D    LVLN+ +   +  ++       +G+  +A +  
Sbjct: 265 QEVPAVRNAQRAVGIFRKLGYEDSKLLLVLNRYQ--PRSNVTREVITETVGLPVAATVAN 322

Query: 366 DGAVFGMSANSGKMIHEVDPKSAI 389
           D  +   +   G  + EV P++AI
Sbjct: 323 DFPLLANAVGRGATLAEVGPRAAI 346


>gi|291575286|gb|ADE10211.1| response regulator [Actinoplanes liguriensis]
          Length = 389

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 62/267 (23%), Positives = 113/267 (42%), Gaps = 30/267 (11%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           ++    +GG G S +A N A ++A       LL DLDL +G   I     P  +I+  + 
Sbjct: 138 VTVFAGKGGCGRSVVAVNLAVALAGA-GRRVLLMDLDLQFGDVAIMMKLSPERNIAGGLQ 196

Query: 224 PVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVP 283
             GR+D+  +  +   Y ++L  L APA  +       + +V +LD+   ++  +++D P
Sbjct: 197 MAGRLDEPGLRSIVTTYRQSLDALLAPASPAEGEQVRREFVVELLDVARPLYDFIVVDTP 256

Query: 284 HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSK---NLIDVLKKLRPADKPPYLVLNQVKT 340
            V        L +SD  +   + DL  L++ +    + D+L    P DK   LV N+   
Sbjct: 257 SVVTDQVLAALDMSDWFIPIVTPDLPALKSVRLTAEMFDLLDY--PKDK-RLLVFNRA-- 311

Query: 341 PKKPEISISDFCAPLGITPSAI-----IPFDGAV-----FGMSANSGKMIHEVDPKSAIA 390
                       A +G++PS +     +PF   V       +S N G+ I   DP   ++
Sbjct: 312 -----------GAQVGLSPSEVEVAAGMPFAVQVPASRDVTVSVNHGEPIAVTDPLHPVS 360

Query: 391 NLLVDFSRVLMGRVTVSKPQSAMYTKI 417
             + +    + G  T  + +     ++
Sbjct: 361 RAIRELGDRIAGVGTTPQRRRGFLGRL 387


>gi|148655422|ref|YP_001275627.1| response regulator receiver protein [Roseiflexus sp. RS-1]
 gi|148567532|gb|ABQ89677.1| response regulator receiver protein [Roseiflexus sp. RS-1]
          Length = 430

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/296 (19%), Positives = 135/296 (45%), Gaps = 20/296 (6%)

Query: 60  ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPL-AEVCDSGTKVIVIGDTNDV 118
           + + +        +    PD++++   +   + ++A E L ++V ++   ++ +    D 
Sbjct: 44  VAKATTGREALALAKQHRPDVVLMDINMPDMDGIAATEALLSQVPEAQVIMMSVQGEQDY 103

Query: 119 SLYRALISNHVSEYLIEPLSVADIINSISAIFT------------PQEEG-----KGSSG 161
            L RA+++    E+L +P+   ++ ++I  ++             PQ  G     +G+ G
Sbjct: 104 -LRRAMLAG-AREFLPKPIGAEELYSAIRHVYRLATTQRRYVTTPPQGPGGSGDDQGAQG 161

Query: 162 CSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDA 221
             I+    +GG G+S+IA N A ++  +   +  L D +L +G   +  +     +I+D 
Sbjct: 162 QIIAVFSPKGGTGTSSIACNLAVAMRLLTGKKVALVDGNLTFGDVGVIMNLVSSKTIADL 221

Query: 222 IYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILD 281
           +  +  +D+  ++ +   +A  + +L AP             +  +L+ +++ F  VI+D
Sbjct: 222 VNRISELDRDLLNDVMATHATQVKVLLAPPNPQTGELVTSDHLRTILETMKKEFEYVIVD 281

Query: 282 VPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQ 337
               +       L L+D++V   +L+L  ++N K  ++V + L    +   LVLN+
Sbjct: 282 TQASFQDRALAALDLADRIVALMTLELPCIKNIKLFLEVAELLEYPKEKTVLVLNK 337


>gi|259417305|ref|ZP_05741224.1| response regulator receiver protein [Silicibacter sp. TrichCH4B]
 gi|259346211|gb|EEW58025.1| response regulator receiver protein [Silicibacter sp. TrichCH4B]
          Length = 414

 Score = 67.8 bits (164), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 115/256 (44%), Gaps = 17/256 (6%)

Query: 160 SGCSISFIGSRGGVGSSTIAHNCAFSIASVFAME---TLLADLDLPYGTANINFDKDPIN 216
            G  I   G  GG G+ST A N A+ +A +   E     L DLDL  G+ +   D     
Sbjct: 158 EGAVIVTQGLAGGTGASTFAVNLAWELAELNTTERPSVCLLDLDLQTGSVSTYLDLPRRE 217

Query: 217 SISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFP 276
           ++ + +     +D+    +  + + + L +LT+PA +        + I+ V+++    F 
Sbjct: 218 AVMEMLSETEAMDEDIFGQSLMSFQDKLQVLTSPADMVPLEFITPEDILRVVEMARSHFD 277

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP---PYL 333
            V++D+PH    WT+ VL L+        LD   +R+++N + V + L+  D P      
Sbjct: 278 FVVIDMPHTMVQWTETVLNLAHVYFAMIELD---MRSAQNALRVKRALQSEDLPFEKLRF 334

Query: 334 VLNQVKTPKKPEIS----ISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAI 389
           +LN  + PK  +++    +      LGI+    +P  G     S + G+ +    PK+ +
Sbjct: 335 LLN--RAPKFTDLNGKSRVKRLAESLGISIDVQLPDGGKTILHSCDHGQPLAISAPKNPL 392

Query: 390 ANLLVDFSRVL--MGR 403
              +   ++ L  +GR
Sbjct: 393 RKEIAKLAKNLHELGR 408


>gi|323491537|ref|ZP_08096716.1| Flp pilus assembly protein [Vibrio brasiliensis LMG 20546]
 gi|323314113|gb|EGA67198.1| Flp pilus assembly protein [Vibrio brasiliensis LMG 20546]
          Length = 407

 Score = 67.8 bits (164), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/315 (21%), Positives = 144/315 (45%), Gaps = 8/315 (2%)

Query: 69  VSCFSDSSTPDLIIVQTKVDSREVLSALEPLA--EVCDSGTK--VIVIGDTNDVSLYRAL 124
           V   +  S PDLI V+T  +  + +  L+     +  DSG +  +IV G+ ND    +  
Sbjct: 58  VGNLAHFSPPDLIFVETGPNWAQKIVELQQYENPDHSDSGHEASLIVFGNENDNGALKIA 117

Query: 125 ISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAF 184
           +    ++++ +  +++++I  +  +   ++    + G  + F+ ++GG G+S +A N A 
Sbjct: 118 LRIGAADFISDKATLSELIPMLRNV-AEEKVASRNLGELLVFMNTKGGAGASMLALNTAI 176

Query: 185 SIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENL 244
           +IA     E L  DLD+ +G      +      ++DAI  +  +D+  +  L   +   L
Sbjct: 177 TIAKQKPDEVLFVDLDIQFGVIEDYLNVTCTYGLTDAIANISDLDEVSLGGLVTKHESGL 236

Query: 245 SILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITT 304
             +      S         +  ++ IL + +P +++D+    +     V++ + K+ + T
Sbjct: 237 HTIGFKRENSHENFEKASQLNKLIPILRERYPYIVIDLSRGLDRMFGSVISPATKLFLVT 296

Query: 305 SLDLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAII 363
             +L  ++N+  +I VL  +   + +   +V+N+ +  K+  I + D    +G      I
Sbjct: 297 QQNLVAIKNTTQIIKVLTFEFGVSREQMEIVVNRYE--KRQSIKLKDIQETIGGMKIHTI 354

Query: 364 PFDGAVFGMSANSGK 378
           P +  V   SAN G+
Sbjct: 355 PNEFKVAIESANLGR 369


>gi|319782168|ref|YP_004141644.1| pilus assembly protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317168056|gb|ADV11594.1| pilus assembly protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 387

 Score = 67.8 bits (164), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 114/238 (47%), Gaps = 14/238 (5%)

Query: 109 VIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEG-KGSSGCSISFI 167
           +I + D       R L+  + S++L +PL   +++N++    T  + G +G+    I+FI
Sbjct: 89  LIAVSDELSSEQTRVLVRMNASDWLHKPLDGKELLNAV----TFHDTGNQGTKSRIITFI 144

Query: 168 GSRGGVGSSTIAHNCAFSIASV---FAMETLLADLDLPYGTANINFDKDPINSISDAIYP 224
            + GG G++T+A + A  +AS     A  T L DLD  + +AN     +  N   D    
Sbjct: 145 SASGGAGATTLALSAAEFLASKSGERAASTCLVDLD--FQSANCGAYLNLFNQF-DLAGI 201

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFD---EKMIVPVLDILEQIFPLVILD 281
           +G+ ++  V  + V      S LT  A       F+      +  +LD++   F  +++D
Sbjct: 202 IGQPERLDVELMDVIKLSRPSGLTLYAFERPQLPFEPHGSDFVFRLLDLVAYRFDDIVID 261

Query: 282 VPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVK 339
           +P++   W   VL+ SD++ I   L++A LR  K L   +++LR       LV N+ K
Sbjct: 262 LPNLETPWHNSVLSTSDEIFIVFELNVASLRQGKRLYKKIRELRGNAVSITLVANKHK 319


>gi|110679394|ref|YP_682401.1| hypothetical protein RD1_2117 [Roseobacter denitrificans OCh 114]
 gi|109455510|gb|ABG31715.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 411

 Score = 67.8 bits (164), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 76/339 (22%), Positives = 139/339 (41%), Gaps = 30/339 (8%)

Query: 64  SIAEAVSCFSDSSTPDLIIVQTKVDS--REVLSAL-EPLAEVCDSGTKVIVIGDTNDVSL 120
              EA++ F+      L  +   +D    E L+ + + +AE    G KVI+I +    + 
Sbjct: 44  GFGEALAFFAQPEAQALGFIALAIDETDEENLTHIGDIIAEAKIRGIKVILIAEDVTPAA 103

Query: 121 YRALISNHVSEYLIEPLSVADIINSISAIFTPQE------------EGKGSSGCSISFIG 168
              L+     E++  PL   ++  +I  +    +             G    G  I   G
Sbjct: 104 LHTLLRKGADEFVPYPLPENELAEAIERVRAADQTVQASANTPALHAGAQKEGAVIVVHG 163

Query: 169 SRGGVGSSTIAHNCAFSIAS---VFAMETLLADLDLPYGTANINFDKDPINSISDAIYPV 225
             GG G++T+A N A+ +A+     A    L D DL YG      D     ++ D +   
Sbjct: 164 LAGGTGATTLAVNLAWELANHDKTDAPRVCLIDFDLQYGAVATYLDLPRREAVYDMLADT 223

Query: 226 GRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHV 285
             +D     +  + + + L +LTAPA +        + +  +LD+  + F  V++D+P  
Sbjct: 224 ENMDDEIFGQCLMTFQDRLEVLTAPADMLPLDLMSAQDVSRILDMARRHFDYVVVDMPST 283

Query: 286 WNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPP---YLVLNQVKTPK 342
             +W++ VL+ +     T  +D   +R+++N +   + L+  D P      V+N  K PK
Sbjct: 284 LVTWSETVLSAAHVYFATLDMD---MRSAQNALRFKRALQSEDLPVEKLRYVMN--KAPK 338

Query: 343 KPEIS----ISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
             ++S    I      L I+    +P  G      A+ G
Sbjct: 339 FTDLSGKSRIKRMAESLDISIDLQMPDGGKPITQGADHG 377


>gi|269966897|ref|ZP_06180970.1| putative pilus assembly protein [Vibrio alginolyticus 40B]
 gi|269828564|gb|EEZ82825.1| putative pilus assembly protein [Vibrio alginolyticus 40B]
          Length = 402

 Score = 67.4 bits (163), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 76/350 (21%), Positives = 156/350 (44%), Gaps = 11/350 (3%)

Query: 74  DSSTPDLIIVQT-KVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEY 132
           +   PDLI ++T +  +++V       + +  + T +IV GD ND +  +  +    ++Y
Sbjct: 61  NKQVPDLIYIETGESWAQKVAHVYSSDSSLQHNHTALIVFGDENDTASLKMALRLGATDY 120

Query: 133 LIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAM 192
           L   +   ++   + +    +   K     ++ FI ++GG G++T+A N A  ++S    
Sbjct: 121 LSRSVDFGELYPLLKSTADEKIANKKMGDLTL-FINTKGGSGATTLAINTAIELSSYAKS 179

Query: 193 ETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAM 252
           + LL DLD+ +  A    +  P  +I+D I  V  +D+  +  L   +   L+ L     
Sbjct: 180 KVLLVDLDMQFSDAADYLNCKPKYNINDVIDSVNDLDELSLEGLVYQHPSGLNYLCFNQN 239

Query: 253 LSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLR 312
             +        +  +L IL Q +  +I+D+ H      Q++++ +  V +    ++  ++
Sbjct: 240 DPKGNYKHAVQVSKLLPILRQFYSHIIVDLSHGVEHVYQQIVSPATHVFLILQQNVTSVK 299

Query: 313 NSKNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFG 371
           ++ + I  L+     +     L++N+ +  KK  IS+ D    +      ++P + A+  
Sbjct: 300 HAVSYIRSLELDYGLSSHQVELIVNRFE--KKSTISLKDIENAVSGHAIHLVPNNFAIAI 357

Query: 372 MSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIF 421
            SAN G  I +    SA+   L + S +L        P     + IKK+F
Sbjct: 358 ESANLGNPIVQSKKNSALKASLAEISHLL------ESPTKENQSWIKKLF 401


>gi|126457732|ref|YP_001076994.1| response regulator [Burkholderia pseudomallei 1106a]
 gi|167851188|ref|ZP_02476696.1| response regulator [Burkholderia pseudomallei B7210]
 gi|242311699|ref|ZP_04810716.1| response regulator [Burkholderia pseudomallei 1106b]
 gi|254192380|ref|ZP_04898819.1| response regulator [Burkholderia pseudomallei S13]
 gi|126231500|gb|ABN94913.1| response regulator [Burkholderia pseudomallei 1106a]
 gi|169649138|gb|EDS81831.1| response regulator [Burkholderia pseudomallei S13]
 gi|242134938|gb|EES21341.1| response regulator [Burkholderia pseudomallei 1106b]
          Length = 402

 Score = 67.4 bits (163), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 78/348 (22%), Positives = 150/348 (43%), Gaps = 12/348 (3%)

Query: 59  RITR--GSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTN 116
           R+TR  G  A+ V         D++++         L+A+E L+ +    T ++V  D +
Sbjct: 28  RVTRTVGRAAQIVQRTDGLDAFDILMIDGAALDTAELAAIEKLSRLHPGLTCLLVTTDAS 87

Query: 117 DVSLYRALIS--NHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVG 174
             +L  A+ +    V  + +EP ++ D +   +A    ++         +SF+  +GG G
Sbjct: 88  SQTLLDAMRAGVRDVLRWPLEPRALDDALKRAAAQCAQRDTPDTRI---VSFMSCKGGAG 144

Query: 175 SSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSISDAIYPVGRIDKAFV 233
           +S IA N A+ IA      TLL DL+  +  A  +  D+ P +S++     + R+D AF+
Sbjct: 145 TSFIAGNIAYEIAEGSKRRTLLIDLNQQFADAAFLVSDQTPPSSVAQLCGQLERLDGAFL 204

Query: 234 SRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEV 293
               V   +   +L       +  D  E  +  +L +    +  VI D+    N+ +   
Sbjct: 205 DASVVRVTDTFHVLAGAGDPIKAADIREDALEWILGVAAPRYDFVIFDLGVSLNAVSMVA 264

Query: 294 LTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN-QVKTPKKPEISISDFC 352
           L  SD + +     +  +R ++ L ++L  L    +   LVLN Q +  ++   ++ +  
Sbjct: 265 LDRSDHIEVVLQPSMPHVRAARRLQELLASLGCPPERIQLVLNRQTRASERARAALEEV- 323

Query: 353 APLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
             L    + +I  D A    + + G  +  +     IA+ L  F+R L
Sbjct: 324 --LSTRAAHVIADDPATVNEAVDQGVPLSRLSRNCGIAHSLQAFARQL 369


>gi|323700362|ref|ZP_08112274.1| response regulator receiver protein [Desulfovibrio sp. ND132]
 gi|323460294|gb|EGB16159.1| response regulator receiver protein [Desulfovibrio desulfuricans
           ND132]
          Length = 397

 Score = 67.4 bits (163), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 122/286 (42%), Gaps = 8/286 (2%)

Query: 109 VIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSI--SAIFTPQEEGKGSSGCSISF 166
           V + GD  D  +    + + + EYL  P+   D+  ++  +A+           G  ++ 
Sbjct: 71  VYLAGDVADPEILIRAMRSGIREYLKFPVEENDLRAAVMRTAMRLSLTVDDTDKGRILTV 130

Query: 167 IGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVG 226
           +G + GVG++T+A N A ++       T+L DL  P G      D     +  D +  + 
Sbjct: 131 LGCKSGVGTTTLAVNLACALNEREPGRTVLLDLHAPMGEIPYFLDLKYDYTWGDLVADIS 190

Query: 227 RIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVW 286
           R+D  ++  +   +   L +L AP    R    D+  +V +L+ L Q +  V++D     
Sbjct: 191 RLDATYLRSVIAEHESGLHVLPAPGAGERP---DDHTLVLILEQLRQSYDFVVVDAATPD 247

Query: 287 NSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRP-ADKPPYLVLNQVKTPKKPE 345
                + + L+D +++   L L  L     L + L    P AD+   LV N+V   +   
Sbjct: 248 EDELPKEVELADSILMAMQLSLPCLARVTRLTESLAGQDPDADRRLRLVANRVV--RNGS 305

Query: 346 ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIAN 391
           I + +    LG   +  +P DG     + N G  + +  PKSA A 
Sbjct: 306 IGVPEAAEVLGREIAWTLPEDGETVLSALNQGTPVVQAFPKSAAAK 351


>gi|194288831|ref|YP_002004738.1| flp pilus assembly protein, atpase [Cupriavidus taiwanensis LMG
           19424]
 gi|193222666|emb|CAQ68669.1| Flp pilus assembly protein, ATPase [Cupriavidus taiwanensis LMG
           19424]
          Length = 397

 Score = 67.0 bits (162), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 70/319 (21%), Positives = 140/319 (43%), Gaps = 10/319 (3%)

Query: 79  DLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLS 138
           DL+I++    S + + A+E L +       ++V        L +A+ +  + + L  PL 
Sbjct: 50  DLLILELPAISAQQMQAVELLRQQHPGLPCILVTPAPGSEVLIKAMRAG-IRDVLPWPLD 108

Query: 139 VADI---INSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETL 195
            A +   +  + A   P+ +    +   IS I  +GG G+S IA N   ++A       L
Sbjct: 109 KAQLSEALRRVEATHVPRAQ---DTAQVISMISCKGGAGTSFIAANLGDALARHLGKRVL 165

Query: 196 LADLDLPYGTAN-INFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLS 254
           + DL+  +G    I  DK P +++ +    + R+D AF+    V       +L   A   
Sbjct: 166 VVDLNRHFGDLTYIVSDKIPPSTLPEICSQIDRMDSAFLEACLVHVDNGFDMLAGAADPV 225

Query: 255 RTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNS 314
           +     +  +  +L +++  +  VI D+    +  +  VL  SD++ +     ++  R  
Sbjct: 226 KASQIQKDKLEWILSVVQPAYDFVIFDLGQTIDPLSIGVLDHSDRICVVAEPAISFGRPG 285

Query: 315 KNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSA 374
           + L+D+L  L  +     LVLN  +T +K E+  +      G+  +  +P D A    + 
Sbjct: 286 RRLLDILSALHYSADKVRLVLN--RTGRKHEMPRATMEEIFGVKAAFTLPDDPAAVDEAI 343

Query: 375 NSGKMIHEVDPKSAIANLL 393
           + G+ + ++  +SA+   L
Sbjct: 344 SHGEPVAKLSRRSAMTRAL 362


>gi|206582087|pdb|3EA0|A Chain A, Crystal Structure Of Para Family Atpase From Chlorobium
           Tepidum Tls
 gi|206582088|pdb|3EA0|B Chain B, Crystal Structure Of Para Family Atpase From Chlorobium
           Tepidum Tls
          Length = 245

 Score = 67.0 bits (162), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 114/245 (46%), Gaps = 17/245 (6%)

Query: 166 FIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI----NFDKDPINSISDA 221
           F+ ++GG G S IA N AF+++    +  L  D+ LP+G  +     N     +  IS+A
Sbjct: 9   FVSAKGGDGGSCIAANFAFALSQEPDIHVLAVDISLPFGDLDXYLSGNTHSQDLADISNA 68

Query: 222 IYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILD 281
                R+DK+ +       + +L ++ +PA   +  + + + +  ++ I    +  +I+D
Sbjct: 69  ---SDRLDKSLLDTXVQHISPSLDLIPSPATFEKIVNIEPERVSDLIHIAASFYDYIIVD 125

Query: 282 ----VPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQ 337
               + HV   W  E L   D++ I T+  L  LR +  L+ + K+         ++LN+
Sbjct: 126 FGASIDHV-GVWVLEHL---DELCIVTTPSLQSLRRAGQLLKLCKEFEKPISRIEIILNR 181

Query: 338 VKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFS 397
             T  +  I+  +    +G   S  IP D      S  SG+ + +V PKS ++  +VD++
Sbjct: 182 ADTNSR--ITSDEIEKVIGRPISKRIPQDEDAXQESLLSGQSVLKVAPKSQLSKTIVDWA 239

Query: 398 RVLMG 402
             L G
Sbjct: 240 LHLNG 244


>gi|134281771|ref|ZP_01768478.1| response regulator [Burkholderia pseudomallei 305]
 gi|167908135|ref|ZP_02495340.1| response regulator [Burkholderia pseudomallei NCTC 13177]
 gi|134246833|gb|EBA46920.1| response regulator [Burkholderia pseudomallei 305]
          Length = 402

 Score = 67.0 bits (162), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 78/348 (22%), Positives = 151/348 (43%), Gaps = 12/348 (3%)

Query: 59  RITR--GSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTN 116
           R+TR  G  A+ V         D++++         L+A+E L+ +    T ++V  D +
Sbjct: 28  RVTRTVGRAAQIVQRTDGLDAFDILMIDGAALDTAELAAIEKLSRLHPGLTCLLVTTDAS 87

Query: 117 DVSLYRALIS--NHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVG 174
             +L  A+ +    V  + +EP ++ D +   +A    ++  +      +SF+  +GG G
Sbjct: 88  SQTLLDAMRAGVRDVLRWPLEPRALDDALKRAAAQCAQRDTPETRI---VSFMSCKGGAG 144

Query: 175 SSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSISDAIYPVGRIDKAFV 233
           +S IA N A+ IA      TLL DL+  +  A  +  D+ P +S++     + R+D AF+
Sbjct: 145 TSFIAGNIAYEIAEGSKRRTLLIDLNQQFADAAFLVSDQTPPSSVAQLCGQLERLDGAFL 204

Query: 234 SRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEV 293
               V   +   +L       +  D  E  +  +L +    +  VI D+    N+ +   
Sbjct: 205 DASVVRVTDTFHVLAGAGDPIKAADIREDALEWILGVAAPRYDFVIFDLGVSLNAVSMVA 264

Query: 294 LTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN-QVKTPKKPEISISDFC 352
           L  SD + +     +  +R ++ L ++L  L    +   LVLN Q +  ++   ++ +  
Sbjct: 265 LDRSDHIEVVLQPSMPHVRAARRLQELLVSLGCPPERIQLVLNRQTRASERARAALEEV- 323

Query: 353 APLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
             L    + +I  D A    + + G  +  +     IA+ L  F+R L
Sbjct: 324 --LSTRAAHVIADDPATVNEAVDQGVPLSRLSRNCGIAHSLQAFARQL 369


>gi|73542331|ref|YP_296851.1| response regulator receiver protein [Ralstonia eutropha JMP134]
 gi|72119744|gb|AAZ62007.1| response regulator receiver protein [Ralstonia eutropha JMP134]
          Length = 397

 Score = 67.0 bits (162), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 60/277 (21%), Positives = 125/277 (45%), Gaps = 7/277 (2%)

Query: 118 VSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSST 177
           +   RA I + +S + ++   +AD +  + A   P+      +   IS I  +GGVG+S 
Sbjct: 92  IKAMRAGIRDVLS-WPLDKAQLADALKRVEATHVPRAH---EAAQVISVISCKGGVGTSF 147

Query: 178 IAHNCAFSIASVFAMETLLADLDLPYG-TANINFDKDPINSISDAIYPVGRIDKAFVSRL 236
           +  N   +IA       L+ DL+  +G   +I  DK P +++ D      R+D A +   
Sbjct: 148 VTANLGDTIARQHGKRVLVVDLNRHFGDLTHIVTDKTPPSTLPDICSQADRMDAALLDAS 207

Query: 237 PVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTL 296
            V       +L   A   +     ++ +  +L + +  +  +++D+    +  +  VL  
Sbjct: 208 LVHVENGFDLLAGAADPVQATHIQKEKLEWILSVAQPNYDFILVDMGQNIDPLSISVLDQ 267

Query: 297 SDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLG 356
           S+++ + T   +A  R  + ++D+L+ L        LVLN  +T +K E+  +      G
Sbjct: 268 SERIYVVTEPAVACGRPGRRMLDILRALHYPPSKIQLVLN--RTGRKSEVPRATMEEIFG 325

Query: 357 ITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
           +  + ++P D +    + + G+ + ++  +SAI   L
Sbjct: 326 MKVAVVLPDDPSAVDEAVSHGEPVGKLSRRSAITRAL 362


>gi|163733540|ref|ZP_02140983.1| hypothetical protein RLO149_17853 [Roseobacter litoralis Och 149]
 gi|161393328|gb|EDQ17654.1| hypothetical protein RLO149_17853 [Roseobacter litoralis Och 149]
          Length = 411

 Score = 67.0 bits (162), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 75/339 (22%), Positives = 138/339 (40%), Gaps = 30/339 (8%)

Query: 64  SIAEAVSCFSDSSTPDLIIVQTKVDS--REVLSAL-EPLAEVCDSGTKVIVIGDTNDVSL 120
             AEA++ F       L  +   +D    E L+ + E + +    G KVI+I +    + 
Sbjct: 44  GFAEALAFFGQPEAQALEFIALAIDETDEENLNHMGEIIGQAKARGIKVILIAEDVTPAA 103

Query: 121 YRALISNHVSEYLIEPLSVADIINSISAIFTPQE------------EGKGSSGCSISFIG 168
             +L+     E++  PL   ++  +I  +   ++             G    G  I   G
Sbjct: 104 LHSLLRQGADEFVPYPLPENELSEAIERVRAAEQALQASANTPALHSGAQKEGAVIVVHG 163

Query: 169 SRGGVGSSTIAHNCAFSIASVFAME---TLLADLDLPYGTANINFDKDPINSISDAIYPV 225
             GG G++T+A N A+ +A+    E     L D DL YG      D     ++ D +   
Sbjct: 164 LAGGTGATTLAVNLAWELATHEKKEGPRVCLIDFDLQYGAVATYLDLPRREAVYDMLADT 223

Query: 226 GRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHV 285
             +D     +  + + + L +LTAPA +        + +  +L +  + F  V++D+P  
Sbjct: 224 ENMDDEIFGQCLLTFEDRLEVLTAPADMLPLDLMSAQDVSRILAMARRHFDYVVIDMPST 283

Query: 286 WNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPP---YLVLNQVKTPK 342
             +W++ VL  +     T  +D   +R+++N +   + L+  D P      V+N  K PK
Sbjct: 284 LVTWSETVLNAAHVYFATMEMD---MRSAQNALRFKRALQSEDLPVEKLRYVMN--KAPK 338

Query: 343 KPEIS----ISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
             ++S    I      L I+    +P  G      A+ G
Sbjct: 339 FTDLSGKSRIKRMAESLDISIDLQMPDGGKPITQGADHG 377


>gi|320160319|ref|YP_004173543.1| response regulator receiver protein [Anaerolinea thermophila UNI-1]
 gi|319994172|dbj|BAJ62943.1| response regulator receiver protein [Anaerolinea thermophila UNI-1]
          Length = 407

 Score = 67.0 bits (162), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 77/153 (50%), Gaps = 1/153 (0%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISD 220
           G  I+F   RGG+G++T+A N A ++  ++   T L DL L  G   +  +  P NS +D
Sbjct: 138 GKVIAFFSLRGGIGTTTLATNTAIALTRLWGTPTALVDLVLACGQCALMMNIPPRNSWAD 197

Query: 221 -AIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVI 279
            A  P   ID   +  +   +   + +L AP         D   +  VLD+L++ +P +I
Sbjct: 198 LARIPNEEIDIEVLRNVLRPHESGVLVLVAPNHPEEGEMIDGPKVSHVLDLLKKEYPYII 257

Query: 280 LDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLR 312
           LD+PH +   T   L  +D++ +  + +LA +R
Sbjct: 258 LDLPHEFCEKTLAGLDTADEIWLLLAPELASVR 290


>gi|168699468|ref|ZP_02731745.1| probable pilus assembly protein CpaE [Gemmata obscuriglobus UQM
           2246]
          Length = 430

 Score = 67.0 bits (162), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 61/268 (22%), Positives = 114/268 (42%), Gaps = 6/268 (2%)

Query: 110 IVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGS 169
           +V+G   D  L  +++      +L +     D+  S+ A  TPQ   K      I+ + +
Sbjct: 78  LVVGPATDPKLILSVLQEGAERFLDQQELEPDLA-SVLARLTPQL--KAEPRHLIAVLSA 134

Query: 170 RGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRID 229
            GG G+ST+A N A  +A       L+ DL+          D  P  +++D      R+D
Sbjct: 135 SGGCGASTVAVNAAVLLAQRHGRCNLV-DLNPVKADLAPLLDLKPQYTLADLCVNETRLD 193

Query: 230 KAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSW 289
           +    +L   +A  +++L  P             +   +    + F  V++D+   ++  
Sbjct: 194 RTLYEKLLTPHASGVALLAGPRTPEEARQLTTAGVAEAVTRAGEAFAHVVVDLEDYFHDE 253

Query: 290 TQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISIS 349
             +VL  + +V++   LD   +RN++ +ID L           +V+N    P   E+ + 
Sbjct: 254 QTDVLDRATRVLVVCRLDFTAVRNARRIIDALVARGVPRSRVEVVVNHAGLPN--ELPLG 311

Query: 350 DFCAPLGITPSAIIPFDGAVFGMSANSG 377
           D  A LG   + ++P D     M+AN+G
Sbjct: 312 DAEAALGGPAAHVLPSDPHTMNMAANTG 339


>gi|187920112|ref|YP_001889143.1| putative pilus assembly protein CpaE [Burkholderia phytofirmans
           PsJN]
 gi|187718550|gb|ACD19773.1| putative pilus assembly protein CpaE [Burkholderia phytofirmans
           PsJN]
          Length = 400

 Score = 67.0 bits (162), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 97/209 (46%), Gaps = 5/209 (2%)

Query: 160 SGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF-DKDPINSI 218
           +G  +S   S+GG G++ IA N A+S+A++     LL DL   +G A++   DK P  ++
Sbjct: 131 AGRVVSLASSKGGSGTTLIAVNLAYSLAALSNRRVLLIDLSQQFGDASLLMADKPPPTTL 190

Query: 219 SDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLV 278
           +D      R+D A +    +    NL +L       +  +     +  +L +  + +  V
Sbjct: 191 ADLCSQAERLDAALLESCVMHVHANLDVLAGAGDPLKAAELLPAQLERILALARERYDAV 250

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL-RPADKPPYLVLNQ 337
           ++DV    N  T   L  SD + +    +L  L   + ++D+ ++L  PA K   +V+N 
Sbjct: 251 LIDVGQSLNPMTIHALDRSDAICMVVRQNLLYLHGGRRMLDIFRELGYPASK-VRVVVNH 309

Query: 338 VKTPKKPEISISDFCAPLGITPSAIIPFD 366
               K  +I++S     LG   +  +P D
Sbjct: 310 YD--KNAQINLSKLEQTLGAKVAHQLPRD 336


>gi|325964115|ref|YP_004242021.1| Flp pilus assembly protein, ATPase CpaE [Arthrobacter
           phenanthrenivorans Sphe3]
 gi|323470202|gb|ADX73887.1| Flp pilus assembly protein, ATPase CpaE [Arthrobacter
           phenanthrenivorans Sphe3]
          Length = 399

 Score = 66.6 bits (161), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 90/215 (41%), Gaps = 2/215 (0%)

Query: 150 FTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN 209
             P  EG    G  I+ +  +GGVG +T+A N A  +  V  M  +L DLDL +G     
Sbjct: 133 MAPAAEGLQDRGRVIAVMSPKGGVGKTTVATNLAIGLGKVAPMSVVLVDLDLQFGDVASG 192

Query: 210 FDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLD 269
              +P +SI+DA++     D   +      +   +  L  P   + +     + +  +++
Sbjct: 193 LLLEPEHSITDAVHGAASQDSMVLKAFLTVHPAGIYALCGPKTPAESDFITAEHVNRLIN 252

Query: 270 ILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADK 329
            L   F  V++D            L  +   V    +D+  +R       VL++L+   +
Sbjct: 253 QLASEFKYVVVDTAPGLGEHVLATLEQATDGVWVCGMDVPSIRGLHKCFSVLRELQLLPQ 312

Query: 330 PPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIP 364
             + VLN     +K  IS+ D  A +G+    ++P
Sbjct: 313 GRHTVLNFAD--RKSGISVQDVEATIGVPVDTVVP 345


>gi|322434105|ref|YP_004216317.1| response regulator receiver protein [Acidobacterium sp. MP5ACTX9]
 gi|321161832|gb|ADW67537.1| response regulator receiver protein [Acidobacterium sp. MP5ACTX9]
          Length = 417

 Score = 66.2 bits (160), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 68/325 (20%), Positives = 133/325 (40%), Gaps = 23/325 (7%)

Query: 17  DNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSS 76
           D  S +M + P +   VF      Y   ER    P++SQ        ++  A  C +   
Sbjct: 22  DVASAAMAACPEVQGSVFAGEFNDYFSGERR---PQISQ--------TLKAATGCVA--- 67

Query: 77  TPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEP 136
                +V    D  + L  +E L  +      V+      D +     +    +E+L +P
Sbjct: 68  -----LVDCDRDPEQALQTMERLRALMLRNLSVVAYATKVDATYLLQAMRVGCNEFLTKP 122

Query: 137 LS---VADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAME 193
            S   + + +N   A    +  G+ +SG  ISF G++GG G++T+A + A ++       
Sbjct: 123 ASTDALEEALNRFRAAHISEAGGQPNSGRVISFFGAKGGAGTTTLAVHLANNLVRRHRKR 182

Query: 194 TLLADLDLPYGTANINFD-KDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAM 252
           TLL D     G  ++    K       + I    R+D   ++     +   L +L +P +
Sbjct: 183 TLLIDHHHELGHISLYLGLKGGQYHFDELIRNSDRLDGNLLNGFVTRHTGGLEVLASPDV 242

Query: 253 LSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLR 312
           ++  Y    + I  V   L   +  +++D    +      +   SD+V + ++ D+A LR
Sbjct: 243 VAADYKSSPEEINSVFAFLRTQYDFIVVDSSMDYKDIVPTMQQSSDEVYLVSTPDVASLR 302

Query: 313 NSKNLIDVLKKLRPADKPPYLVLNQ 337
           +    ++ L+   PA +   +++N+
Sbjct: 303 DLARRVEHLRLTDPASEKLRIIINR 327


>gi|78186534|ref|YP_374577.1| Flp pilus assembly protein ATPase CpaE-like [Chlorobium luteolum
           DSM 273]
 gi|78166436|gb|ABB23534.1| Flp pilus assembly protein ATPase CpaE-like protein [Chlorobium
           luteolum DSM 273]
          Length = 381

 Score = 66.2 bits (160), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 124/275 (45%), Gaps = 27/275 (9%)

Query: 156 GKGSS-GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYG-----TANIN 209
           GK SS G  + F+ ++GG G S +A N A +++       L  D+ LP+G        +N
Sbjct: 120 GKASSRGRVMGFVSAKGGDGGSCLAANLAVALSQEPGTRVLAIDISLPFGDLDMYLTGVN 179

Query: 210 FDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLD 269
             +D    ++D      R+D++ +  +    +  L ++ +PA   +T   + + +  ++ 
Sbjct: 180 HPQD----LADISAETERLDRSLIESMVQHISPTLRLIPSPASFEKTVHIEPERVSELIR 235

Query: 270 ILEQIFPLVILDVPHVWNS---WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRP 326
           I    +  ++LD     +    W  E L   D + + TS  L  LR +  L+ + K    
Sbjct: 236 IAATCYDYILLDFGSCLDQVGIWALEHL---DDLAVVTSPSLPSLRRAGQLLKLSKDF-- 290

Query: 327 ADKPP---YLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEV 383
            DKP     ++LN+ +   +  +S ++    +GI  +  IP D      S   GK + +V
Sbjct: 291 -DKPVSRIEIILNRAEGSVR--LSGTEMEKVIGIPINRRIPSDSDALEESLLVGKPLMQV 347

Query: 384 DPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIK 418
            PKS ++    ++S  + G    S  + +++ ++K
Sbjct: 348 APKSKLSKAFTEWSSEITGS---SNQKHSLWQRLK 379


>gi|167916482|ref|ZP_02503573.1| flp pilus assembly protein, ATPase [Burkholderia pseudomallei 112]
          Length = 402

 Score = 66.2 bits (160), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 77/348 (22%), Positives = 150/348 (43%), Gaps = 12/348 (3%)

Query: 59  RITR--GSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTN 116
           R+TR  G  A+ V         D++++         L+A+E L+ +    T ++V  D +
Sbjct: 28  RVTRTVGRAAQIVQRTDGLDAFDILMIDGAALDTAELAAIEKLSRLHPGLTCLLVTTDAS 87

Query: 117 DVSLYRALIS--NHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVG 174
             +L  A+ +    V  + +EP ++ D +   +A    ++         +SF+  +GG G
Sbjct: 88  SQTLLDAMRAGVRDVLRWPLEPRALDDALKRAAAQCAQRDTPDTRI---VSFMSCKGGAG 144

Query: 175 SSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSISDAIYPVGRIDKAFV 233
           +S IA N A+ IA      TLL DL+  +  A  +  D+ P +S++     + R+D AF+
Sbjct: 145 TSFIAGNIAYEIAEGSKRRTLLIDLNQQFADAAFLVSDQTPPSSVAQLCGQLERLDGAFL 204

Query: 234 SRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEV 293
               V   +   +L       +  D  E  +  +L +    +  VI D+    N+ +   
Sbjct: 205 DASVVRVTDTFHVLAGAGDPIKAADIREDALEWILGVAAPRYDFVIFDLGVSLNAVSMVA 264

Query: 294 LTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN-QVKTPKKPEISISDFC 352
           L  SD + +     +  +R ++ L ++L  L    +   LVLN Q +  ++   ++ +  
Sbjct: 265 LDRSDHIEVVLQPSMPHVRAARRLQELLVSLGCPPERIQLVLNRQTRASERARAALEEV- 323

Query: 353 APLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
             L    + +I  D A    + + G  + ++     +A  L  F+R L
Sbjct: 324 --LSTRAAHVIADDPATVNEAVDQGVPLSQLSRNCGVARSLQAFARQL 369


>gi|115351457|ref|YP_773296.1| response regulator receiver protein [Burkholderia ambifaria AMMD]
 gi|115281445|gb|ABI86962.1| response regulator receiver protein [Burkholderia ambifaria AMMD]
          Length = 426

 Score = 66.2 bits (160), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 123/284 (43%), Gaps = 27/284 (9%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCA------------------FSIASVFAMETLLADLDLP 202
           G  ++ +G+R G+G ST+A N A                  F +A+  A +T L DL LP
Sbjct: 142 GKLVALLGARAGMGVSTLASNLAVWLHKRGAAGIVAGDAPAFGVATPHARQTALVDLGLP 201

Query: 203 YGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEK 262
            G + +  +        +A+  + RID+ FV+     +A  +++ T P  L+   D    
Sbjct: 202 AGDSALFLNTRCEFHFVEAVRNLRRIDRTFVNTALARHASGVALTTLPPNLADLRDVSYA 261

Query: 263 MIVPVLDILEQIFPLVILDVPHVWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL 321
             V +L+ L   F   I+D+    N  +  ++  ++D+  +     +A + ++   +D+L
Sbjct: 262 ACVGLLNRLRAFFDQQIVDLGGFTNLEFVAQIAAVADEAWLVCDQGVASIVSA---VDLL 318

Query: 322 KKLRPAD---KPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
           + LR A        LV+NQ        ++ +     LGI   A +P      G +AN G+
Sbjct: 319 EGLRDAGMDLGKMRLVVNQYDAALS--LTPAQIADRLGIALLATLPARRVSIGQAANQGR 376

Query: 379 MIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFN 422
           +I ++  +      L   +  L G V  +K  ++  + +K+   
Sbjct: 377 LIVDMAERDPYVRALEPLAERLAGTVAPAKSAASGLSVLKRFIQ 420


>gi|261252089|ref|ZP_05944662.1| type II/IV secretion system ATPase TadZ/CpaE associated with Flp
           pilus assembly [Vibrio orientalis CIP 102891]
 gi|260935480|gb|EEX91469.1| type II/IV secretion system ATPase TadZ/CpaE associated with Flp
           pilus assembly [Vibrio orientalis CIP 102891]
          Length = 407

 Score = 66.2 bits (160), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 71/315 (22%), Positives = 139/315 (44%), Gaps = 8/315 (2%)

Query: 69  VSCFSDSSTPDLIIVQTKVDSREVLSALE----PLAEVCDSGTKVIVIGDTNDVSLYRAL 124
           V+  +  S PDLI V+T  +  + +  L+    P ++       +IV G+ ND    +  
Sbjct: 58  VANLAHFSPPDLIFVETGPNWAQKIVELQQYEAPESQESAHEASLIVFGNENDNGALKIA 117

Query: 125 ISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAF 184
           +     +++ +   + ++I  +  I   ++    + G  I F+ ++GG G+S IA N A 
Sbjct: 118 LRIGAMDFISDKAVLDELIPLLRNI-AEEKVATRNLGELIVFMNTKGGAGASLIALNTAI 176

Query: 185 SIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENL 244
           ++A     + LL DLD+ +G      +      I+DAI  V  +D   +  L   +   L
Sbjct: 177 TLAKRQPDDVLLVDLDMQFGVIEDYLNVQCTYGIADAIANVADLDDVSLGSLVTKHDTGL 236

Query: 245 SILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITT 304
            IL      S         +  ++ +L + +P VI+D+    +     V++ + KV + T
Sbjct: 237 HILGFKRENSHENFEKVNQLNKLIPVLRERYPFVIIDLSRGLDRQFGSVISPATKVFLVT 296

Query: 305 SLDLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAII 363
              L  ++N+  ++  L  +   A     +++N+ +  K+  I + D    +G     I+
Sbjct: 297 QQSLVAVKNTTQVLKALTFEFGIAKDQMEVIVNRYE--KRQSIKLKDIKDTVGSIKIHIV 354

Query: 364 PFDGAVFGMSANSGK 378
           P +  V   SAN G+
Sbjct: 355 PNEFKVAIESANLGR 369


>gi|167744180|ref|ZP_02416954.1| flp pilus assembly protein, ATPase [Burkholderia pseudomallei 14]
          Length = 402

 Score = 66.2 bits (160), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 77/348 (22%), Positives = 149/348 (42%), Gaps = 12/348 (3%)

Query: 59  RITR--GSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTN 116
           R+TR  G  A+ V         D++++         L+A+E L+ +    T ++V  D +
Sbjct: 28  RVTRTVGRAAQIVQRTDGLDAFDILMIDGAALDTAELAAIEKLSRLHPGLTCLLVTTDAS 87

Query: 117 DVSLYRALIS--NHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVG 174
             +L  A+ +    V  + +EP ++ D +   +A    ++         +SF+  +GG G
Sbjct: 88  SQTLLDAMRAGVRDVLRWPLEPRALDDALKRAAAQCAQRDTPDTRI---VSFMSCKGGAG 144

Query: 175 SSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSISDAIYPVGRIDKAFV 233
           +S IA N A+ IA      TLL DL+  +  A  +  D+ P +S++     + R+D AF+
Sbjct: 145 TSFIAGNIAYEIAEGSKRRTLLIDLNQQFADAAFLVSDQTPPSSVAQLCGQLERLDGAFL 204

Query: 234 SRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEV 293
               V   +   +L       +  D  E  +  +L +    +  VI D+    N+ +   
Sbjct: 205 DASVVRVTDTFHVLAGAGDPIKAADIREDALEWILGVAAPRYDFVIFDLGVSLNAVSMVA 264

Query: 294 LTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN-QVKTPKKPEISISDFC 352
           L  SD + +     +  +R ++ L ++L  L    +   LVLN Q +  ++   ++ +  
Sbjct: 265 LDRSDHIEVVLQPSMPHVRAARRLQELLASLGCPPERIQLVLNRQTRASERARAALEEV- 323

Query: 353 APLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
             L    + +I  D A    + + G  +  +     +A  L  F+R L
Sbjct: 324 --LSTRAAHVIADDPATVNEAVDQGVPLSRLSRNCGVARSLQAFARQL 369


>gi|126444019|ref|YP_001064081.1| response regulator [Burkholderia pseudomallei 668]
 gi|126223510|gb|ABN87015.1| response regulator [Burkholderia pseudomallei 668]
          Length = 402

 Score = 65.9 bits (159), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 77/350 (22%), Positives = 150/350 (42%), Gaps = 12/350 (3%)

Query: 57  NMRITR--GSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGD 114
           + R+TR  G  A+ V         D++++         L+A+E L+ +    T ++V  D
Sbjct: 26  HYRVTRTVGRAAQIVQRTDGLDAFDILMIDGAALDTAELAAIEKLSRLHPGLTCLLVTTD 85

Query: 115 TNDVSLYRALIS--NHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGG 172
            +  +L  A+ +    V  + +EP ++ D +   +A    ++         +SF+  +GG
Sbjct: 86  ASSQTLLDAMRAGVRDVLRWPLEPRALDDALKRAAAQCAQRDTPDTRI---VSFMSCKGG 142

Query: 173 VGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSISDAIYPVGRIDKA 231
            G+S IA N A+ IA      TLL DL+  +  A  +  D+ P +S++     + R+D A
Sbjct: 143 AGTSFIAGNIAYEIAEGSKRRTLLIDLNQQFADAAFLVSDQTPPSSVAQLCGQLERLDGA 202

Query: 232 FVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQ 291
           F+    V   +   +L       +  D  E  +  +L +    +  VI D+    N+ + 
Sbjct: 203 FLDASVVRVTDTFHVLAGAGDPIKAADIREDALEWILGVAAPRYDFVIFDLGVSLNAVSM 262

Query: 292 EVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN-QVKTPKKPEISISD 350
             L  SD + +     +  +R ++ L ++L  L    +   LVLN Q +  ++   ++ +
Sbjct: 263 VALDRSDHIEVVLQPSMPHVRAARRLQELLVSLGCPPERIQLVLNRQTRASERARAALEE 322

Query: 351 FCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
               L    + +I  D A    + + G  +  +     +A  L  F+R L
Sbjct: 323 V---LSTRAAHVIADDPATVNEAVDQGVPLSRLSRNCGVARSLQAFARQL 369


>gi|94312587|ref|YP_585796.1| pilus assembly protein [Cupriavidus metallidurans CH34]
 gi|93356439|gb|ABF10527.1| pilus assembly protein [Cupriavidus metallidurans CH34]
          Length = 412

 Score = 65.9 bits (159), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/275 (21%), Positives = 117/275 (42%), Gaps = 15/275 (5%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISD 220
           G  ++ +G+R GVG +++A N A ++      E LL DL LP     +  +  P     +
Sbjct: 140 GKIVALLGARPGVGVTSLAVNLAAAVRRGAQAEVLLLDLGLPARDGALYSNVSPEFHFVE 199

Query: 221 AIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVIL 280
           A+  + R D+ FV    V +   +S+L  PA L+   D      + +LD L + F L ++
Sbjct: 200 AVRNLRRFDQVFVDTAIVRHTNGMSVLPLPASLAEMRDISFSEAMALLDRLREFFDLQVV 259

Query: 281 DVPHVWNS-WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVK 339
           D+    N+ +  +++  +D VV+     +  + ++  L+  LKK        +L++++  
Sbjct: 260 DLGGFSNAEFMAQIVKAADTVVLVAEQSVGAIVSAAELLQELKKREVERDDLHLLVSRFD 319

Query: 340 TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPK----SAIANLLVD 395
              +  +        +G+    ++P   A    + N G ++ +  P      AI  LL  
Sbjct: 320 A--ELGVDAEQIADRIGVASVGVLPERRAALLQAGNRGVVLADQSPADPYVRAIGALLER 377

Query: 396 FS--------RVLMGRVTVSKPQSAMYTKIKKIFN 422
                     R ++ R+    PQ     +  ++ N
Sbjct: 378 LGFREGQVPERSVLARIKEKLPQVLRPVRAARVGN 412


>gi|225181997|ref|ZP_03735429.1| response regulator receiver protein [Dethiobacter alkaliphilus AHT
           1]
 gi|225167282|gb|EEG76101.1| response regulator receiver protein [Dethiobacter alkaliphilus AHT
           1]
          Length = 722

 Score = 65.9 bits (159), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/265 (24%), Positives = 121/265 (45%), Gaps = 15/265 (5%)

Query: 166 FIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPV 225
           F G +GGVG +TIA N A  +A     +  L D DL +G  ++  +     +ISD I   
Sbjct: 469 FCG-KGGVGKTTIATNLAVVLAQQEKKKVALVDYDLQFGDVSVLLNLSDGKNISDLIQDA 527

Query: 226 GRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHV 285
             I K  +    + +   + IL AP                +L +L+  +  VI+D    
Sbjct: 528 DTITKELIENYMIRHFTGIDILPAPLFPQDAEYITSDHTDEILRVLKDNYDYVIVDTAAT 587

Query: 286 WNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPE 345
           +N    +V+ L+D +++ T+ D+  ++N+K  +++L+ L   DK   +VLN  ++ +   
Sbjct: 588 FNEINLQVMDLADSILLVTTRDIVTIKNTKTSLNILESLNYRDK-IRVVLN--RSDQDLG 644

Query: 346 ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSR---VLMG 402
           + ++D    L IT S  +  D      + N G  +       A+++   + +R    L  
Sbjct: 645 VGVTDLEKGLEITVSHQVNSDEKSLIAAINKGVPV-------AVSHSNTEITRSFKRLCD 697

Query: 403 RVTVSKPQSAMYTKIKKIFNMKCFS 427
           R+T  + Q++   + K I N + FS
Sbjct: 698 RLTGKRQQNSQEKQSKGIIN-RMFS 721


>gi|84516635|ref|ZP_01003994.1| ATPase, putative [Loktanella vestfoldensis SKA53]
 gi|84509671|gb|EAQ06129.1| ATPase, putative [Loktanella vestfoldensis SKA53]
          Length = 414

 Score = 65.9 bits (159), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 139/312 (44%), Gaps = 25/312 (8%)

Query: 108 KVIVIG-DTNDVSLYRALISNHVSEYLIEPLSVADIINSI--------SAIFTP---QEE 155
           KVI+I  D    +L+R L+     E++  PL   ++  +I        +A F+P   Q +
Sbjct: 92  KVILIAEDLTPAALHR-LLRIGGDEFVPYPLPENELARAIERVLTIDDTAQFSPTGTQFK 150

Query: 156 GKGS-SGCSISFIGSRGGVGSSTIAHNCAFSIASVFAME---TLLADLDLPYGTANINFD 211
             G+ SG  I   G  GG G++ +A N A+ +A++   +     L DLD  +GTA+   D
Sbjct: 151 ATGTKSGVVIPIHGLAGGTGATMMAVNLAWELANIDPKDPPKVCLIDLDFQFGTASTYLD 210

Query: 212 KDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDIL 271
                ++ + +     +D     +  + Y + L +LTAP  +          I  V+++ 
Sbjct: 211 LPRREAVLEMLTDTAAMDAESFMQALLTYGDKLHVLTAPTDMIPLDMISPADITRVIEMA 270

Query: 272 EQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP- 330
              F  V++D+P     W+Q VL  +        L+   +R+++N + + + L+  + P 
Sbjct: 271 RMNFDYVVIDMPSTMVEWSQTVLEAAHVYFAMIELE---MRSAQNTLRLKRALQSEELPF 327

Query: 331 --PYLVLNQVK--TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPK 386
                +LN+    T    +  +      LGI+   ++P  G     SA+ G  + E +PK
Sbjct: 328 EKIRFILNRAPGFTDLNGKSRVKRLAESLGISVEVLMPDGGKAVMQSADHGTPLAESNPK 387

Query: 387 SAIANLLVDFSR 398
           + +   ++  ++
Sbjct: 388 NPLRKEIMKLAK 399


>gi|254187130|ref|ZP_04893645.1| response regulator [Burkholderia pseudomallei Pasteur 52237]
 gi|157934813|gb|EDO90483.1| response regulator [Burkholderia pseudomallei Pasteur 52237]
          Length = 402

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 77/348 (22%), Positives = 149/348 (42%), Gaps = 12/348 (3%)

Query: 59  RITR--GSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTN 116
           R+TR  G  A+ V         D++++         L+A+E L+ +    T ++V  D +
Sbjct: 28  RVTRTVGRAAQIVQRTDGLDAFDILMIDGAALDTAELAAIEKLSRLHPGLTCLLVTTDAS 87

Query: 117 DVSLYRALIS--NHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVG 174
             +L  A+ +    V  + +EP ++ D +   +A    ++         +SF+  +GG G
Sbjct: 88  SQTLLDAMRAGVRDVLRWPLEPRALDDALKRAAAQCAQRDTPDTRI---VSFMSCKGGAG 144

Query: 175 SSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSISDAIYPVGRIDKAFV 233
           +S IA N A+ IA      TLL DL+  +  A  +  D+ P +S++     + R+D AF+
Sbjct: 145 TSFIAGNIAYEIAEGSKRRTLLIDLNQQFADAAFLVSDQTPPSSVAQLCGQLERLDGAFL 204

Query: 234 SRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEV 293
               V   +   +L       +  D  E  +  +L +    +  VI D+    N+ +   
Sbjct: 205 DASVVRVTDTFHVLAGAGDPIKAADIREDALEWILGVAAPRYDFVIFDLGVSLNAVSMVA 264

Query: 294 LTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN-QVKTPKKPEISISDFC 352
           L  SD + +     +  +R ++ L ++L  L    +   LVLN Q +  ++   ++ +  
Sbjct: 265 LDRSDHIEVVLQPSMPHVRAARRLQELLVSLGCPPERIQLVLNRQTRASERARAALEEV- 323

Query: 353 APLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
             L    + +I  D A    + + G  +  +     +A  L  F+R L
Sbjct: 324 --LSTRAAHVIADDPATVNEAVDQGVPLSRLSRNCGVARSLQAFARQL 369


>gi|53723212|ref|YP_112197.1| pilus assembly-related protein [Burkholderia pseudomallei K96243]
 gi|76819415|ref|YP_336472.1| flp pilus assembly protein, ATPase [Burkholderia pseudomallei
           1710b]
 gi|167821379|ref|ZP_02453059.1| flp pilus assembly protein, ATPase [Burkholderia pseudomallei 91]
 gi|167829721|ref|ZP_02461192.1| flp pilus assembly protein, ATPase [Burkholderia pseudomallei 9]
 gi|167899818|ref|ZP_02487219.1| flp pilus assembly protein, ATPase [Burkholderia pseudomallei 7894]
 gi|167924339|ref|ZP_02511430.1| flp pilus assembly protein, ATPase [Burkholderia pseudomallei
           BCC215]
 gi|217424316|ref|ZP_03455815.1| response regulator [Burkholderia pseudomallei 576]
 gi|226194126|ref|ZP_03789726.1| response regulator [Burkholderia pseudomallei Pakistan 9]
 gi|237508233|ref|ZP_04520948.1| flp pilus assembly protein, ATPase [Burkholderia pseudomallei
           MSHR346]
 gi|254182578|ref|ZP_04889172.1| response regulator [Burkholderia pseudomallei 1655]
 gi|254265560|ref|ZP_04956425.1| response regulator [Burkholderia pseudomallei 1710a]
 gi|254296488|ref|ZP_04963944.1| response regulator [Burkholderia pseudomallei 406e]
 gi|52213626|emb|CAH39680.1| putative pilus assembly-related protein [Burkholderia pseudomallei
           K96243]
 gi|76583888|gb|ABA53362.1| flp pilus assembly protein, ATPase [Burkholderia pseudomallei
           1710b]
 gi|157806348|gb|EDO83518.1| response regulator [Burkholderia pseudomallei 406e]
 gi|184213113|gb|EDU10156.1| response regulator [Burkholderia pseudomallei 1655]
 gi|217392781|gb|EEC32804.1| response regulator [Burkholderia pseudomallei 576]
 gi|225933819|gb|EEH29806.1| response regulator [Burkholderia pseudomallei Pakistan 9]
 gi|235000438|gb|EEP49862.1| flp pilus assembly protein, ATPase [Burkholderia pseudomallei
           MSHR346]
 gi|254216562|gb|EET05947.1| response regulator [Burkholderia pseudomallei 1710a]
          Length = 402

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 77/348 (22%), Positives = 149/348 (42%), Gaps = 12/348 (3%)

Query: 59  RITR--GSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTN 116
           R+TR  G  A+ V         D++++         L+A+E L+ +    T ++V  D +
Sbjct: 28  RVTRTVGRAAQIVQRTDGLDAFDILMIDGAALDTAELAAIEKLSRLHPGLTCLLVTTDAS 87

Query: 117 DVSLYRALIS--NHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVG 174
             +L  A+ +    V  + +EP ++ D +   +A    ++         +SF+  +GG G
Sbjct: 88  SQTLLDAMRAGVRDVLRWPLEPRALDDALKRAAAQCAQRDTPDTRI---VSFMSCKGGAG 144

Query: 175 SSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSISDAIYPVGRIDKAFV 233
           +S IA N A+ IA      TLL DL+  +  A  +  D+ P +S++     + R+D AF+
Sbjct: 145 TSFIAGNIAYEIAEGSKRRTLLIDLNQQFADAAFLVSDQTPPSSVAQLCGQLERLDGAFL 204

Query: 234 SRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEV 293
               V   +   +L       +  D  E  +  +L +    +  VI D+    N+ +   
Sbjct: 205 DASVVRVTDTFHVLAGAGDPIKAADIREDALEWILGVAAPRYDFVIFDLGVSLNAVSMVA 264

Query: 294 LTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN-QVKTPKKPEISISDFC 352
           L  SD + +     +  +R ++ L ++L  L    +   LVLN Q +  ++   ++ +  
Sbjct: 265 LDRSDHIEVVLQPSMPHVRAARRLQELLVSLGCPPERIQLVLNRQTRASERARAALEEV- 323

Query: 353 APLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
             L    + +I  D A    + + G  +  +     +A  L  F+R L
Sbjct: 324 --LSTRAAHVIADDPATVNEAVDQGVPLSRLSRNCGVARSLQAFARQL 369


>gi|117928183|ref|YP_872734.1| cobyrinic acid a,c-diamide synthase [Acidothermus cellulolyticus
           11B]
 gi|117648646|gb|ABK52748.1| Cobyrinic acid a,c-diamide synthase [Acidothermus cellulolyticus
           11B]
          Length = 423

 Score = 65.5 bits (158), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 90/196 (45%), Gaps = 2/196 (1%)

Query: 155 EGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDP 214
           +G  S G  ++   ++GG G +T+A N A ++A+    +  L DLDL +G   +     P
Sbjct: 153 DGATSRGVVVTVFSTKGGCGKTTLACNLAATLAAGGRNDVCLVDLDLNFGDVAVVLRLMP 212

Query: 215 INSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI 274
             S++DA      ID   V  L   ++  L  L AP            ++  VL +L + 
Sbjct: 213 ARSLADAAPYSLDIDLPAVETLLTRHSAGLYTLPAPIDPHTAETISAGLVGRVLRLLTRR 272

Query: 275 FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLV 334
           F  V++D P  +          SD + +  +LDL  +R+ +  +D L+ L+   +   +V
Sbjct: 273 FAFVVVDTPPAFTDPVLTAFDQSDLIALVATLDLPAVRSLRATLDTLQALKIPTERLRVV 332

Query: 335 LNQVKTPKKPEISISD 350
           LN+  +  K  +S SD
Sbjct: 333 LNRADS--KVGLSASD 346


>gi|317123664|ref|YP_004097776.1| cobyrinic acid a,c-diamide synthase [Intrasporangium calvum DSM
           43043]
 gi|315587752|gb|ADU47049.1| cobyrinic acid a,c-diamide synthase [Intrasporangium calvum DSM
           43043]
          Length = 389

 Score = 65.5 bits (158), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/183 (28%), Positives = 93/183 (50%), Gaps = 8/183 (4%)

Query: 159 SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSI 218
            +G  I+   ++GGVG +T+A N A  +AS  A ETLL DLDL +G   I+    P + I
Sbjct: 127 GAGKVITIFSAKGGVGKTTLATNLAAYLASTGA-ETLLIDLDLMFGDVAISLQVVPAHDI 185

Query: 219 SDAIYPVGRIDKAFVSRLPVFYAEN-LSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
              I   G +D+  V  +   + ++ L+++ AP+           ++  +L +   +F  
Sbjct: 186 GHLISMRGHLDEQGVHSVVSRHEDSGLAVIAAPSDPEVADRVPAAVVEELLRVARGMFAY 245

Query: 278 VILDVPHVWNSWTQEVLT---LSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLV 334
           VI+D P    + T+ VLT   LSD  ++  +LD+  ++N +  ++ L  L  +     +V
Sbjct: 246 VIVDTP---PNLTEHVLTACDLSDLTMLVATLDIPAVKNLRVAMNALDTLGASKDGRVIV 302

Query: 335 LNQ 337
           LN+
Sbjct: 303 LNR 305


>gi|222523841|ref|YP_002568311.1| response regulator receiver protein [Chloroflexus sp. Y-400-fl]
 gi|222447720|gb|ACM51986.1| response regulator receiver protein [Chloroflexus sp. Y-400-fl]
          Length = 416

 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 74/358 (20%), Positives = 145/358 (40%), Gaps = 19/358 (5%)

Query: 60  ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS 119
           + + S        +    P +I++   +   + ++A E +    D G +VI++    +  
Sbjct: 35  VAKASNGREAIALARQHRPQVILMDINMPDMDGIAATEAIL-TNDPGIQVIIMSVQGETD 93

Query: 120 LYRALISNHVSEYLIEPLSVADIINSI------------SAIFTPQEEGKGSS----GCS 163
             R  +     E+LI+P+S  D+  SI            + +  P  +  G+     G  
Sbjct: 94  YIRRAMLAGAREFLIKPISADDLYRSIRHVARLAMTRPIAPVGAPGGQVPGAQPTVDGQI 153

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
            +    +GGVG S+IA N A +I      +  L D ++ +G  ++  +     +I D   
Sbjct: 154 FAVFSPKGGVGVSSIAANLAVAIRQQTNKKVALVDGNVIFGDLSVLLNLRTDKTILDVAS 213

Query: 224 PVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVP 283
            +  +D+  ++ +   +   + +L AP    R        I  +L+ + Q F  VI+D P
Sbjct: 214 RIEGLDRDLLNDVMATHPTQVKVLLAPPDPQRGELVSADHIRAILEAIRQEFDYVIVDTP 273

Query: 284 HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKK 343
             +   +   L L+ +V+   +L++  +RN K  ++V   L   +    LVLN  K   +
Sbjct: 274 ASFQDRSLAALDLAQRVITLMTLEMHCIRNVKLFLEVADLLGYPNDKVMLVLN--KATNR 331

Query: 344 PEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLM 401
             I   D    L    +  I        +S N G  +    P   +A  +++ +R L+
Sbjct: 332 TGIRAEDVEKHLQRKLALQIGDAAQEMTLSINQGTPLVLAKPNHQVAKDIMNLARELV 389


>gi|13475413|ref|NP_106977.1| pilus assembly protein [Mesorhizobium loti MAFF303099]
 gi|14026165|dbj|BAB52763.1| pilus assembly protein [Mesorhizobium loti MAFF303099]
          Length = 387

 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 113/238 (47%), Gaps = 14/238 (5%)

Query: 109 VIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEG-KGSSGCSISFI 167
           +I + D       R L+  + S++L +PL   +++N++    T  + G +G+    I+FI
Sbjct: 89  LIAVSDELTSEQTRVLVRMNASDWLHKPLDGKELLNAV----TFHDTGNQGAKSRIITFI 144

Query: 168 GSRGGVGSSTIAHNCAFSIASV---FAMETLLADLDLPYGTANINFDKDPINSISDAIYP 224
            + GG G++T+A + A  +AS     A  T L DLD  + +AN     +  N   D    
Sbjct: 145 SASGGAGATTLALSAAEFLASKSTERAASTCLVDLD--FQSANCGAYLNLFNQF-DLAGI 201

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFD---EKMIVPVLDILEQIFPLVILD 281
           + + ++  V  + V      S LT  A       F+      +  +LD++   F  +++D
Sbjct: 202 ISQPERLDVELMDVIKLTRPSGLTLYAFERPQLPFEPHGSDFVFRLLDLVAYRFDDIVID 261

Query: 282 VPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVK 339
           +P++   W   VL+ SD++ I   L++A LR  K L   +++LR       LV N+ K
Sbjct: 262 LPNIETPWHNSVLSTSDEIFIVFELNVASLRQGKRLYKKIRELRGNAVSITLVANKHK 319


>gi|86137995|ref|ZP_01056571.1| ATPase, putative [Roseobacter sp. MED193]
 gi|85825587|gb|EAQ45786.1| ATPase, putative [Roseobacter sp. MED193]
          Length = 412

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 74/341 (21%), Positives = 141/341 (41%), Gaps = 34/341 (9%)

Query: 64  SIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGT----KVIVIGDTNDVS 119
              EA++ F+      L  V   +DS +  + L  + E+         KVI+I +    +
Sbjct: 44  GFGEAMAFFAQPEAETLEFVALAMDSADE-ANLAQMGEIITQAKARDIKVILIAEEVSPA 102

Query: 120 LYRALISNHVSEYLIEPLSVADIINSISAIFTPQEE------------GKGSSGCSISFI 167
               L+     E++  PL   ++  +I  + TP+ E                 G  I   
Sbjct: 103 ALHTLLRQGADEFIPYPLPERELQAAIDRLSTPEPEPVAPNNLHALQADSRREGAVIVCH 162

Query: 168 GSRGGVGSSTIAHNCAFSIASVFAMET---LLADLDLPYGTANINFDKDPINSISDAIYP 224
           G  GG GS+T+A N A+ +A +   +T    L D D+  G+ +   D      + + +  
Sbjct: 163 GLAGGTGSTTLAVNLAWELAQMSTQKTPSVCLLDFDMQQGSVSTYLDLPRREVVMEMLSE 222

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH 284
              +D     +  + + + L +LTAP+ +        + +  V+++    F  VI+D+PH
Sbjct: 223 TEEMDADIFGQALLTFEDKLQVLTAPSEMIPLDFISVEDVERVVEMARSHFDFVIIDMPH 282

Query: 285 VWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR----PADKPPYLVLNQVKT 340
               W++ +L ++        LD   +R+++N + + + L+    P DK  +  LN  + 
Sbjct: 283 TLVQWSETILQMAHVYFALIELD---MRSAQNALRMKRALQSEGLPFDKLRF-ALN--RA 336

Query: 341 PKKPEIS----ISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
           PK  ++S    +      LGI+    +P  G     S + G
Sbjct: 337 PKFTDLSGKSRVKRMAESLGISIDLQLPDGGKPITQSCDHG 377


>gi|116671478|ref|YP_832411.1| Flp pilus assembly protein ATPase CpaE-like protein [Arthrobacter
           sp. FB24]
 gi|116611587|gb|ABK04311.1| Flp pilus assembly protein ATPase CpaE-like protein [Arthrobacter
           sp. FB24]
          Length = 398

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 107/240 (44%), Gaps = 6/240 (2%)

Query: 159 SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSI 218
           + G  I     +GGVG +TIA N A  +  +  M  ++ DLDL +G        DP +++
Sbjct: 142 NKGLVIGVFSPKGGVGKTTIATNIAVGLGKIAPMSVVIVDLDLQFGDVASALYLDPQHTV 201

Query: 219 SDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLV 278
           +DA+ P    D   +      +  ++  + AP       +   + +  +L+ L + F  V
Sbjct: 202 TDAVSPAASQDSLVLKAFLTVHPASIYAVCAPPTPVDADEITPEQVSRLLEQLSEQFQYV 261

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQV 338
           ++D            +     VV  + +D+  +R  ++ +DVL++L    +  ++VLN  
Sbjct: 262 VVDTAPGLPEIGLAAMEQCTDVVWVSGMDIPSVRGLRSGLDVLRQLDILPETRHVVLNMA 321

Query: 339 KTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSG-KMIHEV--DPKSAIANLLVD 395
            +  K  +++ D  + +G      IP   AV  +S N G  ++ E   DP +   N LV+
Sbjct: 322 DS--KLGLTVQDLESTIGAPVDVSIPRSRAV-ALSTNRGIPVLQESAKDPATKGLNQLVN 378


>gi|325964123|ref|YP_004242029.1| Flp pilus assembly protein, ATPase CpaE [Arthrobacter
           phenanthrenivorans Sphe3]
 gi|323470210|gb|ADX73895.1| Flp pilus assembly protein, ATPase CpaE [Arthrobacter
           phenanthrenivorans Sphe3]
          Length = 398

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 93/220 (42%), Gaps = 3/220 (1%)

Query: 158 GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  G  I     +GGVG +T+A N A  +  +  M  ++ DLDL +G        +P ++
Sbjct: 141 GGKGLVIGVFSPKGGVGKTTLATNIAIGLGQIAPMSVVIVDLDLQFGDVASGLYLNPEHT 200

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
           ++DA+ P    D   +      +   +  L AP           + +  +++ L   F  
Sbjct: 201 VTDAVTPAAAQDSLVLKAFLTVHPAGIYALCAPPNPVEADHITPEQVSHLVEQLSHEFQY 260

Query: 278 VILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQ 337
           V+LD            +      V  +++D+  LR  ++ ++VL++L    +  ++VLN 
Sbjct: 261 VVLDTAPGMQEIGLAAMEQCTDAVWVSAMDIPSLRGLRSGLEVLRQLEIMPESRHVVLNM 320

Query: 338 VKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
                +  +++ D  + +G      +P   AV  +S N G
Sbjct: 321 ADA--RAGLNVQDVESTIGAPVDVSVPRSRAV-ALSTNRG 357


>gi|99082188|ref|YP_614342.1| response regulator receiver protein [Ruegeria sp. TM1040]
 gi|99038468|gb|ABF65080.1| response regulator receiver protein [Ruegeria sp. TM1040]
          Length = 414

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 58/251 (23%), Positives = 113/251 (45%), Gaps = 15/251 (5%)

Query: 160 SGCSISFIGSRGGVGSSTIAHNCAFSIASVFAME---TLLADLDLPYGTANINFDKDPIN 216
            G  I   G  GG G+ST A N A+ +A + + +     L DLDL  G+ +   D     
Sbjct: 158 EGAVIVTQGLAGGTGASTFAVNLAWELAELNSGDRPSVCLLDLDLQTGSVSTYLDLPRRE 217

Query: 217 SISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFP 276
           ++ + +     +D+    +  + + + L +LT+PA +        + I+ V+++    F 
Sbjct: 218 AVMEMLSETEAMDEDIFGQSLISFQDKLQVLTSPADMVPLEFITPEDILRVVEMARSHFD 277

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP---PYL 333
            V++D+PH    WT+ VL L+        LD   +R+++N + V + L+  D P      
Sbjct: 278 FVVIDMPHTMVQWTETVLNLAHVYFAMIELD---MRSAQNALRVKRALQSEDLPFEKLRF 334

Query: 334 VLNQVKTPKKPEIS----ISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAI 389
           +LN  + P+  +++    +      LGI+    +P  G     S + G+ +    PK+ +
Sbjct: 335 LLN--RAPRFTDLNGKSRVKRLAESLGISIDVQLPDGGKAILHSCDHGQPLAISAPKNPL 392

Query: 390 ANLLVDFSRVL 400
              +   ++ L
Sbjct: 393 RKEIAKLAKNL 403


>gi|241662163|ref|YP_002980523.1| response regulator receiver protein [Ralstonia pickettii 12D]
 gi|309780758|ref|ZP_07675499.1| response regulator receiver [Ralstonia sp. 5_7_47FAA]
 gi|240864190|gb|ACS61851.1| response regulator receiver protein [Ralstonia pickettii 12D]
 gi|308920440|gb|EFP66096.1| response regulator receiver [Ralstonia sp. 5_7_47FAA]
          Length = 397

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 106/241 (43%), Gaps = 3/241 (1%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF-DKDPINSIS 219
           G  +SF+  RGG G++ IA N A  +++      LL DL   YG A     D+ P  +++
Sbjct: 131 GQVVSFLSCRGGSGTTFIAANFAHVLSARHGKRVLLIDLCQQYGDAAFLLTDQSPPATLA 190

Query: 220 DAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVI 279
           +    + R+D A +       +++  +L       ++ +     +  +L +   ++ +V+
Sbjct: 191 NVCNQIDRLDAALLDACLTHVSQDFDVLAGAGDPIKSGEIKATHLERILALAASMYDVVV 250

Query: 280 LDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVK 339
            DV    N  +  VL  S+ +     L L  LR  + L+++   L    +   LV+NQ  
Sbjct: 251 FDVGQDINPASIVVLDHSNVIYPVLHLSLPYLRAGRKLMEICHSLGYRAERLRLVINQYD 310

Query: 340 TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRV 399
             K   IS +   +  G+  + I+P+D      +   G  + ++   S IA  L D +R 
Sbjct: 311 --KHMPISQNMMESAFGMPVAHILPYDPGPVRDATTQGMPVLQLAENSPIARALADMARQ 368

Query: 400 L 400
           L
Sbjct: 369 L 369


>gi|327541685|gb|EGF28209.1| response regulator receiver protein [Rhodopirellula baltica WH47]
          Length = 403

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 80/336 (23%), Positives = 147/336 (43%), Gaps = 7/336 (2%)

Query: 74  DSSTPDLIIVQTKVDSREVLSALEPLA-EVCDSGTKVIVIGDTNDVSLYRALISNHVSEY 132
           D +TPD+ ++    DS   +  +E +  E  D  T ++     +D  L    I     E+
Sbjct: 41  DQTTPDVGVISLDTDSTAAIKLIERITRETPD--TALLATSAVSDGQLILQAIRAGAREF 98

Query: 133 LIEPLSVADIINSISAIFTPQEEGKGSSGCS---ISFIGSRGGVGSSTIAHNCAFSIASV 189
           L  PL   ++ +++  I   +  G  +   S   I+  G+ GGVG+++ A N    +A  
Sbjct: 99  LTLPLVEEELSSALGRISQTKFGGGDARNRSCEVIAIAGATGGVGTTSTAVNLGCVLAEE 158

Query: 190 FAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTA 249
                 L DLDL  G A++  D  P  +++D +  +GR+D   + +    ++  L +L  
Sbjct: 159 SRNSVALLDLDLALGDADVFLDAIPDYTLADVVQNIGRLDIQLLKKSLTKHSSGLYLLPR 218

Query: 250 PAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLA 309
           P  L      D + +  V+ +L+  F  +I+D+   +N+     +  + KV++ T LDL 
Sbjct: 219 PVELHDLEAIDTESLRKVVGLLKASFTHLIVDLSKTYNALDMIAIESASKVLLVTQLDLP 278

Query: 310 GLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAV 369
            LRN   L+    +     +   +++N+       +IS+      LG    A++P D   
Sbjct: 279 CLRNVVRLMMSFDETEGLAERVEIIVNRAGL-DAGQISLKKAKETLGREIFALLPNDYRT 337

Query: 370 FGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVT 405
                N+G  +    PK+A+     D +  L  R T
Sbjct: 338 MVEVRNNGVPLITQAPKAALTQAFRDVAYRLTHRET 373


>gi|32473555|ref|NP_866549.1| pilus assembly protein CpaE [Rhodopirellula baltica SH 1]
 gi|32398235|emb|CAD78330.1| probable pilus assembly protein CpaE [Rhodopirellula baltica SH 1]
          Length = 409

 Score = 64.3 bits (155), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 80/336 (23%), Positives = 147/336 (43%), Gaps = 7/336 (2%)

Query: 74  DSSTPDLIIVQTKVDSREVLSALEPLA-EVCDSGTKVIVIGDTNDVSLYRALISNHVSEY 132
           D +TPD+ ++    DS   +  +E +  E  D  T ++     +D  L    I     E+
Sbjct: 47  DQTTPDVGVISLDTDSTAAIKLIERITRETPD--TALLATSAVSDGQLILQAIRAGAREF 104

Query: 133 LIEPLSVADIINSISAIFTPQEEGKGSSGCS---ISFIGSRGGVGSSTIAHNCAFSIASV 189
           L  PL   ++ +++  I   +  G  +   S   I+  G+ GGVG+++ A N    +A  
Sbjct: 105 LTLPLVEEELSSALGRISQTKFGGGDARNRSCEVIAIAGATGGVGTTSTAVNLGCVLAEE 164

Query: 190 FAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTA 249
                 L DLDL  G A++  D  P  +++D +  +GR+D   + +    ++  L +L  
Sbjct: 165 SRNSVALLDLDLALGDADVFLDAIPDYTLADVVQNIGRLDIQLLKKSLTKHSSGLYLLPR 224

Query: 250 PAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLA 309
           P  L      D + +  V+ +L+  F  +I+D+   +N+     +  + KV++ T LDL 
Sbjct: 225 PVELHDLEAIDTESLRKVVGLLKASFTHLIVDLSKTYNALDMIAIESASKVLLVTQLDLP 284

Query: 310 GLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAV 369
            LRN   L+    +     +   +++N+       +IS+      LG    A++P D   
Sbjct: 285 CLRNVVRLMMSFDETEGLAERVEIIVNRAGL-DAGQISLKKAKETLGREIFALLPNDYRT 343

Query: 370 FGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVT 405
                N+G  +    PK+A+     D +  L  R T
Sbjct: 344 MVEVRNNGVPLITQAPKAALTQAFRDVAYRLTHRET 379


>gi|269126094|ref|YP_003299464.1| AAA ATPase [Thermomonospora curvata DSM 43183]
 gi|268311052|gb|ACY97426.1| AAA ATPase [Thermomonospora curvata DSM 43183]
          Length = 397

 Score = 64.3 bits (155), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 80/170 (47%), Gaps = 3/170 (1%)

Query: 156 GKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPI 215
           G G  G  +     +GG G S ++ N A ++A     +  L DLDL +G   I     P 
Sbjct: 133 GPGKDGTVVVLFAGKGGCGKSMVSTNLAVALAR-RERQVCLVDLDLAFGDVGIMLQLSPQ 191

Query: 216 NSISDAIYPVGR-IDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI 274
            +I DA+ P+G+ +D+  V  L V +   +  + AP           +++  +L +L Q+
Sbjct: 192 RTIVDAV-PMGQNMDQTGVRSLLVRHESGVHAVLAPVAPGDAEKITGRLVTDLLAVLRQM 250

Query: 275 FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL 324
           F +VI+D P  ++      L  +D+ ++    ++  L+  +  +D+L  L
Sbjct: 251 FDVVIVDTPSQFSETVLAALDAADRHLLLAGPEVTALKALRVTLDMLDLL 300


>gi|328953761|ref|YP_004371095.1| hypothetical protein Desac_2085 [Desulfobacca acetoxidans DSM
           11109]
 gi|328454085|gb|AEB09914.1| hypothetical protein Desac_2085 [Desulfobacca acetoxidans DSM
           11109]
          Length = 397

 Score = 64.3 bits (155), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 116/269 (43%), Gaps = 4/269 (1%)

Query: 158 GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G     IS +G +GGVG + +A N A S         LL DLD+     +   D  P  +
Sbjct: 128 GEKTQIISLLGCKGGVGVTFLAVNLAQSFLQDRKEPVLLFDLDMQAADVSALLDIQPRYT 187

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDIL--EQIF 275
           I D I    R+D  ++  +       L +L  P  L  +       +  +L  L  + ++
Sbjct: 188 ILDVIENFDRLDPQYLKDIIHSRDSGLDVLPGPQRLEDSEIVQAPQVDKILQYLRSQNLY 247

Query: 276 PLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVL 335
             ++LD+    +  T + L  SD V++ T L +  LR+++ ++ +L +L   ++    V 
Sbjct: 248 RWILLDLGDHLDEITLKGLEASDLVLLITVLTIPALRHTRKILQMLHRLEFGEQKLKPVA 307

Query: 336 NQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVD 395
           N        +I+ S+    LG    A++  D  V   S N G+ + E  P   ++  +  
Sbjct: 308 NCFIN--GIDIAPSEATKFLGQDFLAVLRSDPKVVIQSINEGRPLVETQPSDRLSLKISR 365

Query: 396 FSRVLMGRVTVSKPQSAMYTKIKKIFNMK 424
            +R+L G       ++ ++   K++  ++
Sbjct: 366 LARMLNGEEKADSRKAGIWQGFKRLLWLR 394


>gi|221638314|ref|YP_002524576.1| response regulator receiver protein [Rhodobacter sphaeroides KD131]
 gi|221159095|gb|ACM00075.1| Response regulator receiver protein [Rhodobacter sphaeroides KD131]
          Length = 423

 Score = 63.9 bits (154), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 91/187 (48%), Gaps = 13/187 (6%)

Query: 168 GSRGGVGSSTIAHNCAFSIASVFAME---TLLADLDLPYGTANINFDKDPINSISDAIYP 224
           G  GGVG+ST A N A+ +A+V   E     L DLDL +G  +   D     S+ D +  
Sbjct: 174 GMAGGVGASTFACNLAWELATVARTEGPRVCLIDLDLQFGAVSTYLDLPRRESVFDILSD 233

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH 284
               D     +  + + + L + TAP  +        + I  +LD+ +  F  V+LD+P 
Sbjct: 234 TEAADSDGFLQAMLTFNDRLHVFTAPPDMLPLDIMTAEDIGRLLDMAQANFDFVVLDMPT 293

Query: 285 VWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR----PADKPPYLVLNQVKT 340
              SWT+ VLT S        LD   LR+++N++ +++ L+    P DK  + VLN  + 
Sbjct: 294 TVVSWTEAVLTRSQAYFAMMELD---LRSAQNVLRLVRALKAESLPHDKLRF-VLN--RA 347

Query: 341 PKKPEIS 347
           P+  ++S
Sbjct: 348 PRFTDLS 354


>gi|72162671|ref|YP_290328.1| septum site-determining protein [Thermobifida fusca YX]
 gi|71916403|gb|AAZ56305.1| putative septum site-determining protein [Thermobifida fusca YX]
          Length = 537

 Score = 63.9 bits (154), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 96/223 (43%), Gaps = 7/223 (3%)

Query: 158 GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  G  IS  G++GGVG++T A + A  IA+       L DLDL  G     +D     S
Sbjct: 143 GRRGRIISLTGAKGGVGTTTTAIHLA-RIAARNGQAVCLVDLDLQSGDIPGYYDLKHRRS 201

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
           I D +     I  A ++     + +   IL AP       D        +L  L   + +
Sbjct: 202 IVDLVDAADDISAAMLAETVYVHPDGPHILLAPVHGENGEDVTAHAARQILGALRSRYDM 261

Query: 278 VILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR---PADKPPYLV 334
           VI+D     +  T   + LSD  +I  + DL  LR ++ LI + ++L+   P +    LV
Sbjct: 262 VIVDCGSAVDDATAVAVELSDTALILITPDLPALRAAQRLIAMWERLQVRDPKNVTSLLV 321

Query: 335 LNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
            +  K   +PE +     AP+  T   +IP        ++N+G
Sbjct: 322 RHSRKNEIQPEFARKLLRAPMLRT---VIPAAYRALEEASNTG 361


>gi|87310972|ref|ZP_01093097.1| response regulator [Blastopirellula marina DSM 3645]
 gi|87286262|gb|EAQ78171.1| response regulator [Blastopirellula marina DSM 3645]
          Length = 371

 Score = 63.9 bits (154), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 86/185 (46%), Gaps = 4/185 (2%)

Query: 140 ADIINSISAI-FTPQEEGKG--SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLL 196
            D  N +  I F  +++ K    SG  ++F G+ GGVG +T+A NC   +A   A   +L
Sbjct: 95  GDFTNELDEILFHMRDQSKRDVQSGEIVAFCGASGGVGVTTLAVNCGIHLAQEGA-SVVL 153

Query: 197 ADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRT 256
            DL+L  G A+++    P ++I +       I    VS+L   +   L++L AP  L   
Sbjct: 154 VDLNLCGGDASLHLGLQPESNILECAVSADDIHAVTVSKLLARHESGLNLLAAPQFLDGQ 213

Query: 257 YDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKN 316
                + +   + +L  +   VI+D+  V++      LTL D +     ++   L  ++ 
Sbjct: 214 EIMQPESVHRTIGVLAAMHDYVIIDMEDVFHREQIAALTLVDHLYAVFRIEFPSLVRTRR 273

Query: 317 LIDVL 321
           L+D L
Sbjct: 274 LLDYL 278


>gi|126461329|ref|YP_001042443.1| response regulator receiver protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|126102993|gb|ABN75671.1| response regulator receiver protein [Rhodobacter sphaeroides ATCC
           17029]
          Length = 423

 Score = 63.9 bits (154), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 91/187 (48%), Gaps = 13/187 (6%)

Query: 168 GSRGGVGSSTIAHNCAFSIASVFAME---TLLADLDLPYGTANINFDKDPINSISDAIYP 224
           G  GGVG+ST A N A+ +A+V   E     L DLDL +G  +   D     S+ D +  
Sbjct: 174 GMAGGVGASTFACNLAWELATVARTEGPRVCLIDLDLQFGAVSTYLDLPRRESVFDILSD 233

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH 284
               D     +  + + + L + TAP  +        + I  +LD+ +  F  V+LD+P 
Sbjct: 234 TEAADSDGFLQAMLTFNDRLHVFTAPPDMLPLDIMTAEDIGRLLDMAQANFDFVVLDMPT 293

Query: 285 VWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR----PADKPPYLVLNQVKT 340
              SWT+ VLT S        LD   LR+++N++ +++ L+    P DK  + VLN  + 
Sbjct: 294 TVVSWTEAVLTRSQAYFAMMELD---LRSAQNVLRLVRALKAESLPHDKLRF-VLN--RA 347

Query: 341 PKKPEIS 347
           P+  ++S
Sbjct: 348 PRFTDLS 354


>gi|194335916|ref|YP_002017710.1| Flp pilus assembly protein ATPase CpaE-like protein [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|194308393|gb|ACF43093.1| Flp pilus assembly protein ATPase CpaE-like protein [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 381

 Score = 63.5 bits (153), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 59/312 (18%), Positives = 141/312 (45%), Gaps = 9/312 (2%)

Query: 109 VIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSI-SFI 167
           ++V+    +  L  +L+   V E +++  S ++ +  +      + +G   + C +  F+
Sbjct: 75  IVVLHPQTEPELLLSLMRAGVREVIVD--STSETLQEVIERTHLRAKGVSINRCRVFGFV 132

Query: 168 GSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF-DKDPINSISDAIYPVG 226
            S+GG GSS IA N AF+++       L  D+ LP+G  ++    ++    ++D      
Sbjct: 133 SSKGGDGSSCIAANLAFALSQEPDFRVLAVDVSLPFGDLDMYLTGENHPQDLADISGECD 192

Query: 227 RIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVW 286
           R+D++ +  +    +  L ++++PA   +    + + +  ++ I    +  +++D     
Sbjct: 193 RLDQSLLDSMVQHLSPTLDLISSPATFEKIVHIEPERVSELIHIATNFYDYILVDFGSSL 252

Query: 287 NSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEI 346
           +     VL   D++ I  +  L  LR +  ++ + K+         ++LN+  T     I
Sbjct: 253 DQVGIWVLEQLDELCIVFTPSLPSLRRAGQILKLWKEFEKPMSCTEIILNRADTSVP--I 310

Query: 347 SISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTV 406
           + ++    +G   +   P D      S   G+ + +V PKS ++  +VD++  + G    
Sbjct: 311 TGTEIEKVIGRPINKRFPSDAEAVQESLLIGQPLLQVAPKSKLSKTIVDWAEHITGS--- 367

Query: 407 SKPQSAMYTKIK 418
           S  + +++ ++K
Sbjct: 368 SHHKRSLWERLK 379


>gi|325518837|gb|EGC98410.1| response regulator receiver protein [Burkholderia sp. TJI49]
          Length = 402

 Score = 63.5 bits (153), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 66/305 (21%), Positives = 131/305 (42%), Gaps = 10/305 (3%)

Query: 93  LSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISN--HVSEYLIEPLSVADIINSISAIF 150
           L+A+E +  +    T ++V  D +   L  A+ +    V ++ I+P ++   +   +A  
Sbjct: 64  LAAIERICRLHLGLTCILVTADASPHLLLDAMRAGARDVLQWPIDPAALGRALERAAAQS 123

Query: 151 TPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-IN 209
           T ++ G       +SF+  +GG G+S  A N  + IA  F    LL DL   +  A  + 
Sbjct: 124 TRRDSGDTRI---VSFLSCKGGAGTSFAASNVGYEIAEGFGRRVLLIDLSQQFADAAFLV 180

Query: 210 FDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLD 269
            D+ P +++      + R+D AF+        EN  +L       +  +  E  +  VL 
Sbjct: 181 SDETPPSTLPALCAQLERLDGAFLDASVARVTENFHVLAGAGDPVKAAEMHEDALEWVLG 240

Query: 270 ILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADK 329
           +    +  VI DV    ++ +   L  SD++ +     +  +R  + L+++L  L  +  
Sbjct: 241 VASPRYDFVIFDVGVAIDALSMVALDRSDQLQLVLQPAMPHVRAGRRLLEILVSLGYSTD 300

Query: 330 PPYLVLNQV-KTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSA 388
              LV+N+  +  ++   ++ D    LG+  +  IP D      + N G  +  +   +A
Sbjct: 301 RISLVVNRATRASERTRAALEDV---LGMQAAHTIPDDADTVLEAINQGHPVSRIARGAA 357

Query: 389 IANLL 393
           +   L
Sbjct: 358 VTRAL 362


>gi|77462451|ref|YP_351955.1| putative Flp pilus assembly protein ATPase CpaE [Rhodobacter
           sphaeroides 2.4.1]
 gi|77386869|gb|ABA78054.1| Putative Flp pilus assembly protein ATPase CpaE [Rhodobacter
           sphaeroides 2.4.1]
          Length = 423

 Score = 63.5 bits (153), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 86/178 (48%), Gaps = 11/178 (6%)

Query: 168 GSRGGVGSSTIAHNCAFSIASVFAME---TLLADLDLPYGTANINFDKDPINSISDAIYP 224
           G  GGVG+ST A N A+ +A+V   E     L DLDL +G  +   D     S+ D +  
Sbjct: 174 GMAGGVGASTFACNLAWELATVARTEGPRVCLIDLDLQFGAVSTYLDLPRRESVFDILSD 233

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH 284
               D     +  + + + L + TAP  +        + I  +LD+ +  F  V+LD+P 
Sbjct: 234 TEAADSDGFLQAMLTFNDRLHVFTAPPDMLPLDIMTAEDIGRLLDMAQANFDFVVLDMPT 293

Query: 285 VWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR----PADKPPYLVLNQV 338
              SWT+ VLT S        LD   LR+++N++ +++ L+    P DK  + VLN+ 
Sbjct: 294 TVVSWTEAVLTRSQAYFAMMELD---LRSAQNVLRLVRALKAESLPHDKLRF-VLNRA 347


>gi|332560335|ref|ZP_08414657.1| putative Flp pilus assembly protein ATPase CpaE [Rhodobacter
           sphaeroides WS8N]
 gi|332278047|gb|EGJ23362.1| putative Flp pilus assembly protein ATPase CpaE [Rhodobacter
           sphaeroides WS8N]
          Length = 423

 Score = 63.2 bits (152), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 86/178 (48%), Gaps = 11/178 (6%)

Query: 168 GSRGGVGSSTIAHNCAFSIASVFAME---TLLADLDLPYGTANINFDKDPINSISDAIYP 224
           G  GGVG+ST A N A+ +A+V   E     L DLDL +G  +   D     S+ D +  
Sbjct: 174 GMAGGVGASTFACNLAWELATVTRTEGPRVCLIDLDLQFGAVSTYLDLPRRESVFDILSD 233

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH 284
               D     +  + + + L + TAP  +        + I  +LD+ +  F  V+LD+P 
Sbjct: 234 TEAADSDGFLQAMLTFNDRLHVFTAPPDMLPLDIMTAEDIGRLLDMAQANFDFVVLDMPT 293

Query: 285 VWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR----PADKPPYLVLNQV 338
              SWT+ VLT S        LD   LR+++N++ +++ L+    P DK  + VLN+ 
Sbjct: 294 TVVSWTEAVLTRSQAYFAMMELD---LRSAQNVLRLVRALKAESLPHDKLRF-VLNRA 347


>gi|126733575|ref|ZP_01749322.1| ATPase, putative [Roseobacter sp. CCS2]
 gi|126716441|gb|EBA13305.1| ATPase, putative [Roseobacter sp. CCS2]
          Length = 443

 Score = 63.2 bits (152), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 69/311 (22%), Positives = 131/311 (42%), Gaps = 23/311 (7%)

Query: 108 KVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFT---PQEEGKGS----- 159
           KVI+I +    +    L+     E++  PL   ++  +I  + T   PQ    G      
Sbjct: 121 KVILIAEDVSPTALHQLLREGGDEFVPYPLPENELARAIERVLTKEDPQAPQSGEKSFKT 180

Query: 160 ----SGCSISFIGSRGGVGSSTIAHNCAFSIASVFAME---TLLADLDLPYGTANINFDK 212
               SG  I   G  GG G+S +A N A+ +A++   E     L DLD  +G+A+   D 
Sbjct: 181 TGDRSGVIIPVHGLAGGTGASMMAVNLAWELANIEGEEPAKVCLLDLDFQFGSASTYLDL 240

Query: 213 DPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILE 272
               ++ + +     +D     +  + + + L +LTAP  +        + I  ++++  
Sbjct: 241 PRREAVLELLTDTATMDAESFMQAMLTFGDKLHVLTAPMDMIPLDMITPEDIGRLIEMAS 300

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP-- 330
             F  VI+D+P     W+Q VL ++        LD   +R+++N + + + L+  D P  
Sbjct: 301 SHFDYVIIDMPSTMVEWSQTVLEMAHVYFAMIELD---MRSAQNTLRLKRALQSEDLPFE 357

Query: 331 -PYLVLNQVK--TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS 387
               VLN+    T    +  +      LGI+    +P  G     + + G  + E   K+
Sbjct: 358 KIRFVLNRAPGFTDMNGKSRVKRLSDNLGISIEVQLPDGGKPVMQATDHGAPLAETIAKN 417

Query: 388 AIANLLVDFSR 398
           A+   ++  ++
Sbjct: 418 ALRKEILKLAK 428


>gi|116620260|ref|YP_822416.1| response regulator receiver protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223422|gb|ABJ82131.1| response regulator receiver protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 398

 Score = 63.2 bits (152), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 63/271 (23%), Positives = 120/271 (44%), Gaps = 16/271 (5%)

Query: 109 VIVIGDTNDVSLYRALISNHVSEYLIEPLSVAD-----IINSISAIFTPQEEGKGSSGCS 163
           VI++   +D S+  A +     +YL++     D     +I +I+    P E    S   +
Sbjct: 84  VIILTALDDESMALAGVQQGAQDYLVKGKLNKDTLVRALIYAIARNRKPAEPAARSQDLA 143

Query: 164 --ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDA 221
             + F+GS GGVG++T+A +CA  +      + LL DLD     A+     +   S+ DA
Sbjct: 144 HVVGFLGSNGGVGTTTMAAHCALQLNRQTEQKVLLVDLDCSSSGASFLMKVESPYSLLDA 203

Query: 222 IYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILD 281
              + R+D  +   +   Y E + +L  P   S       + +  VL   + ++  +++D
Sbjct: 204 TENLHRLDTGYWKGVITTYREGVDLLPGPGATSIREAPTVERVRHVLRFAQPLYSYIVID 263

Query: 282 VPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTP 341
           +  +  S +  +L  +  + +TT+ DL  L  +  ++  L +   A +   L+LN  +  
Sbjct: 264 LGRLSAS-SLAMLDETRDLFVTTTPDLTALFEASRILRRLLEAGFARERLQLLLN--RRE 320

Query: 342 KKPEISISDFCAPLGITPSAIIPFDGAVFGM 372
           KK  +++    + LG       P  GA+  M
Sbjct: 321 KKSSVAVEHIESALG------YPIYGAILDM 345


>gi|207728104|ref|YP_002256498.1| pilus assembly protein [Ralstonia solanacearum MolK2]
 gi|206591349|emb|CAQ56961.1| pilus assembly protein [Ralstonia solanacearum MolK2]
          Length = 397

 Score = 62.8 bits (151), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 106/246 (43%), Gaps = 3/246 (1%)

Query: 156 GKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDP 214
           G    G  +SF+  +GG G++  A N A  +++      LL DL   YG A  +  D+ P
Sbjct: 126 GTRHDGQVLSFLSCKGGSGTTFTAANFAHVLSARHGKHVLLVDLCQQYGDAAFLVTDQSP 185

Query: 215 INSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI 274
             ++++    + R+D A +       +    +L       +  +     +  +L +   +
Sbjct: 186 PATLANVCNQIDRLDAALLDTCVTHVSHGFDVLAGAGDPVKAGEIKAAHLERILVLAASM 245

Query: 275 FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLV 334
           + +V+ D+    N  +  VL  S  +     L L+ LR  + L+++   L        LV
Sbjct: 246 YDVVVFDLGQDINPASIVVLDHSSVIYPVLQLSLSYLRAGRRLMEICHSLGYHADRLRLV 305

Query: 335 LNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLV 394
           +NQ    K+  I+ +   +  G+  + ++P+D      +AN G  + ++   S IA  L 
Sbjct: 306 VNQYD--KRVPITQNTLESAFGMPVAHVLPYDPGTVRDAANQGVPVLQLAEGSPIARALA 363

Query: 395 DFSRVL 400
           D +R L
Sbjct: 364 DMARQL 369


>gi|295700368|ref|YP_003608261.1| response regulator receiver protein [Burkholderia sp. CCGE1002]
 gi|295439581|gb|ADG18750.1| response regulator receiver protein [Burkholderia sp. CCGE1002]
          Length = 403

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 108/245 (44%), Gaps = 6/245 (2%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASV-FAMETLLADLDLPYGTAN-INFDKDPINSISDA 221
           +SF+  +GG G+S +A N A +IA++      LL DL+  +  A  +  D+ P +++   
Sbjct: 134 LSFVSCKGGAGTSFVAANVAHAIATLPQKKRVLLIDLNQQFADAAFLVSDQTPPSTLPQI 193

Query: 222 IYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILD 281
              + R+D AF     V  +++  IL       +  +  E  +  +L +    +  V+ D
Sbjct: 194 CAQIERMDAAFFDTSLVHVSDSFHILAGAGDPVKAAEVKEDRLEWLLGVAAPHYDFVLFD 253

Query: 282 VPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQ-VKT 340
           +    N  +   L  SD++ +     +  +R  + L ++L  L  A +   L+LN+  + 
Sbjct: 254 LGQTLNRLSMLALDRSDQIHLVLQASMPHVRAGRRLQEILCSLGYAQEQMRLILNRYTRH 313

Query: 341 PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
            ++P  ++      LG++   +IP D      + N G  + +    S +A  L   +  +
Sbjct: 314 GERPRAALESV---LGMSAFQVIPEDAETVTDAMNQGLPVSKTARGSGVARSLQTLAENI 370

Query: 401 MGRVT 405
             R T
Sbjct: 371 AARAT 375


>gi|87312291|ref|ZP_01094389.1| probable pilus assembly protein CpaE [Blastopirellula marina DSM
           3645]
 gi|87284995|gb|EAQ76931.1| probable pilus assembly protein CpaE [Blastopirellula marina DSM
           3645]
          Length = 417

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 83/337 (24%), Positives = 150/337 (44%), Gaps = 17/337 (5%)

Query: 75  SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLI 134
            + PD+ IV       + L+ +E L +  +    ++VI  + D +L    +     E+L 
Sbjct: 48  QTNPDIGIVSLDASPEKGLALIEELHD-ANPECSILVISASTDGNLILRAMRAGAKEFLT 106

Query: 135 EPLSVADIINSISAIFTPQEEGKGSS---GCS-ISFIGSRGGVGSSTIAHNCAFSIASVF 190
            P+ + D++ ++  I + Q+ GKG S   GC  I+  G+ GGVG++++A N    +AS  
Sbjct: 107 HPVVLEDLMAALERI-SSQKFGKGESRSRGCRVITVGGATGGVGATSLAVNLGCLLASNE 165

Query: 191 AMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAP 250
               +L DLDL  G A++  D  P  ++ D    + R+D   + R    ++  L +L  P
Sbjct: 166 KNNVVLIDLDLALGDADVFLDTIPDYTLVDVAQNIQRLDFNLLKRSLTKHSSGLYLLPRP 225

Query: 251 AMLSRTYDFDEKMIVP-----VLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTS 305
             L      D+ +I P     V+ +L+  F  VI+D+   +       +  +   ++   
Sbjct: 226 VQL-----HDDSLISPSDFTRVIGLLKATFTHVIIDLSKGFRPLDFVAMREAQDNLMVIQ 280

Query: 306 LDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPF 365
           LDL  LRN   L+    +     +   +++N+V      +IS+      +G      IP 
Sbjct: 281 LDLPCLRNVVRLMMSFSETDGLKEKTRIIVNRVGL-DSGQISLKKAQETIGSEIFWQIPN 339

Query: 366 DGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMG 402
           D  V     N+G  + E  P++ I   +   + VL G
Sbjct: 340 DYRVMVEVRNNGVPLIEQAPRAGITQAMAGLANVLSG 376


>gi|219850070|ref|YP_002464503.1| response regulator receiver protein [Chloroflexus aggregans DSM
           9485]
 gi|219544329|gb|ACL26067.1| response regulator receiver protein [Chloroflexus aggregans DSM
           9485]
          Length = 416

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/296 (20%), Positives = 122/296 (41%), Gaps = 19/296 (6%)

Query: 60  ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS 119
           + + S       F+    P +I++   +   + ++A E +    D G +VI++    +  
Sbjct: 35  VAKASNGREAIAFARQYRPQVILMDINMPDMDGIAATEAIL-TQDPGIQVIIMSVQGETD 93

Query: 120 LYRALISNHVSEYLIEPLSVADIINSISAI------------------FTPQEEGKGSSG 161
             R  +     E+LI+P+S  D+  SI  +                            +G
Sbjct: 94  YIRRAMLAGAREFLIKPISADDLYRSIRHVARLAAMRPVVPVAGGAVAGAAGAAQPAVNG 153

Query: 162 CSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDA 221
              +    +GGVG S+IA N A +I      +  L D ++ +G  ++  +     +I D 
Sbjct: 154 QIFAVFSPKGGVGVSSIAANLAVAIRQQTNKKVALVDGNVIFGDLSVLLNLRADKTIIDV 213

Query: 222 IYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILD 281
              +  +D+  ++ +   +   + +L AP    R        I  +L++L Q +  V++D
Sbjct: 214 ASRIENLDRDLLNDVMATHPTQVKVLLAPPDPQRGELVTADHIRAILEMLRQEYDYVVVD 273

Query: 282 VPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQ 337
            P  +   +   L L+ +V+   +L++  +RN K  ++V   L   +    LVLN+
Sbjct: 274 TPASFQDRSLAALDLAQRVITLMTLEMHCIRNVKLFLEVADLLGYPNDKVVLVLNK 329


>gi|145219381|ref|YP_001130090.1| Flp pilus assembly protein ATPase CpaE-like protein
           [Prosthecochloris vibrioformis DSM 265]
 gi|145205545|gb|ABP36588.1| Flp pilus assembly protein ATPase CpaE-like protein [Chlorobium
           phaeovibrioides DSM 265]
          Length = 381

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/271 (21%), Positives = 122/271 (45%), Gaps = 19/271 (7%)

Query: 156 GKGSSGCSI-SFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF-DKD 213
           G  SS   I  F  ++GG G S IA N AF+++       L  D+ LP+G  ++    ++
Sbjct: 120 GASSSRARIMGFASAKGGDGGSCIAANLAFALSQEPGTRVLAIDICLPFGDLDMYLTGEN 179

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
               ++D      R+D++ +  +    +  L ++ +P    +T   + + +  ++ I   
Sbjct: 180 HPQDLADISSQTARLDRSLIESMVQHISPTLRLIPSPTTFEKTVHIEAERVSELIQIAAT 239

Query: 274 IFPLVILDVPHVWNS---WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP 330
            +  ++LD+    +    W  E L   D++ + T+  L  +R +  L+ + K     DKP
Sbjct: 240 CYDYILLDIGSCIDQVGIWALEHL---DELFVVTTPSLPSIRRAGQLLQLSKDF---DKP 293

Query: 331 ---PYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS 387
                ++LN+ +   +  +S ++    +G   +  IP D      S  +GK   +  PKS
Sbjct: 294 ISRIEIILNRAEGNVR--LSDNEIEKVIGKPINRRIPSDSEAVEESLLTGKSFLQAAPKS 351

Query: 388 AIANLLVDFSRVLMGRVTVSKPQSAMYTKIK 418
            ++N  + +S  + G    S  + +++ ++K
Sbjct: 352 KLSNAFIHWSSEITGN---SNQKHSLWQRLK 379


>gi|219847767|ref|YP_002462200.1| response regulator receiver protein [Chloroflexus aggregans DSM
           9485]
 gi|219542026|gb|ACL23764.1| response regulator receiver protein [Chloroflexus aggregans DSM
           9485]
          Length = 390

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/237 (21%), Positives = 109/237 (45%), Gaps = 6/237 (2%)

Query: 109 VIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSS-----GCS 163
           ++++    D+S   A      ++YL +P    +++  +  + T +  G+  S     G  
Sbjct: 80  ILMLTAQGDISAKIAGFEAGANDYLAKPFEPPELVYRVKNLLT-RFTGETPSTPLPRGKI 138

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           I+  G++GGVG +TIA + A +I        ++ D DL +G   ++ +  P  SI D + 
Sbjct: 139 IAVFGAKGGVGKTTIAVSLALAIRLRTRKRVIIVDADLTFGDVAVHLNIAPTRSIVDIVR 198

Query: 224 PVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVP 283
               I++  V+++ + +   L  L AP         + + +  +LD+L      VI+D  
Sbjct: 199 GGDEIEQEMVTQVLLSHPSGLQALLAPPRPEEAELVNAEHMTRILDLLAVSADYVIVDCQ 258

Query: 284 HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKT 340
             ++  T  V   +D V++  + ++  L+N+   + +  +L    +   +VLN+  +
Sbjct: 259 TSYDDRTLSVFDRADHVLLVITPEIGPLKNTSLFLTLANQLGIDQQAISIVLNRANS 315


>gi|159901124|ref|YP_001547371.1| response regulator receiver protein [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159894163|gb|ABX07243.1| response regulator receiver protein [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 417

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/278 (23%), Positives = 136/278 (48%), Gaps = 23/278 (8%)

Query: 78  PDLIIVQTKVDSREVLSALEP-LAEVCDSGTKVIVI---GDTNDVSLYRALISNHVSEYL 133
           PD++++   +   + ++A E  +A+V +  T+VI++   G+T+   L RA+++    ++L
Sbjct: 53  PDVVLMDINMPDMDGIAATEAIMAQVPN--TQVIMMSVQGETD--YLRRAMLAG-ARQFL 107

Query: 134 IEPLSVADIINSISAIFTPQ-------------EEGKGSSGCSISFIGSRGGVGSSTIAH 180
            +P+   ++ +SI  ++  Q             EE   S+G  I+    +GG G S IA 
Sbjct: 108 TKPVGGDELASSIREVYRLQQTQRRFVVAAQQVEEHDQSTGQIIAVYSPKGGTGKSAIAS 167

Query: 181 NCAFSIASVFAMETL-LADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVF 239
           N A ++  +     + L D  L +G   + F+ +   +I+D    +  +DK  ++ +   
Sbjct: 168 NLAVALKLLPGNRKICLVDASLLFGDIAVMFNINSSKTINDLTSRIDDLDKDLLNDVMTT 227

Query: 240 YAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDK 299
           +A  + +L APA            +  VL+ L + +  V++D    +   T  VL  + +
Sbjct: 228 HASQIKVLLAPANPQMGELVTADHVRTVLEALRREYDYVVVDTQSSFQDQTMAVLDAAHR 287

Query: 300 VVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQ 337
           +V+  +++L+ ++N +  ++V + L   D+   LVLN+
Sbjct: 288 IVLLMTMELSSIKNIRQFLEVAELLGYNDEKLVLVLNK 325


>gi|300704932|ref|YP_003746535.1| flp pilus assembly protein, ATPase [Ralstonia solanacearum
           CFBP2957]
 gi|299072596|emb|CBJ43946.1| Flp pilus assembly protein, ATPase [Ralstonia solanacearum
           CFBP2957]
          Length = 397

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 106/246 (43%), Gaps = 3/246 (1%)

Query: 156 GKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDP 214
           G  + G  +SF+  +GG G++  A N A  +++      LL DL   YG A  +  D+ P
Sbjct: 126 GTRNDGQVLSFLSCKGGSGTTFTAANFAHVLSARHGKHVLLVDLCQQYGDAAFLVTDQSP 185

Query: 215 INSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI 274
             ++++    + R+D A +            +L       +  +     +  +L +   +
Sbjct: 186 PATLANVCNQIDRLDAALLDTCVTHVGPGFDVLAGAGDPVKAGEIKAAHLERILVLAASL 245

Query: 275 FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLV 334
           + +V+ D+    N  +  VL  S  +     L L+ LR  + L+++   L        LV
Sbjct: 246 YDVVVFDLGQDINPASIVVLDHSSVIYPVLQLSLSYLRAGRRLMEICHSLGYHADRLRLV 305

Query: 335 LNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLV 394
           +NQ    K+  I+ +   +  G+  + ++P+D      +AN G  + ++   S IA  L 
Sbjct: 306 VNQYD--KRVPITQNTLESAFGMPVAHVLPYDPGTVRDAANQGVPVLQLAEGSPIARALA 363

Query: 395 DFSRVL 400
           D +R L
Sbjct: 364 DMARQL 369


>gi|260574614|ref|ZP_05842617.1| conserved hypothetical protein [Rhodobacter sp. SW2]
 gi|259023031|gb|EEW26324.1| conserved hypothetical protein [Rhodobacter sp. SW2]
          Length = 427

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 103/234 (44%), Gaps = 15/234 (6%)

Query: 152 PQEEGKGS-SGCSISFIGSRGGVGSSTIAHNCAFSIA---SVFAMETLLADLDLPYGTAN 207
           P  + KG  +G  +   G  GGVG+ST A N A+ +A      A    L DLD  +G  +
Sbjct: 161 PAFKAKGDRNGVVLPVHGLAGGVGASTFATNLAWELAIADKTKATRVCLIDLDFQFGATS 220

Query: 208 INFDKDPINSISDAIYPVGRIDK-AFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVP 266
              D     ++ + +      D  AF+  +  F  + LS+ TAPA +          I  
Sbjct: 221 TYLDLPRKEAVFEILSDTAHTDSDAFLQAMLTFN-DRLSVFTAPADMLPLDIVQPDDIGR 279

Query: 267 VLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK-KLR 325
           ++D+ +  F  V++D+P    SWT+ VL  +        LDL   +N   L+  LK +  
Sbjct: 280 IIDMAQANFDFVVIDMPSTIISWTETVLNRAHVYFALLELDLRSAQNVLRLVRALKAEAL 339

Query: 326 PADKPPYLVLNQVKTPKKPEIS----ISDFCAPLGITPSAIIPFDGAVFGMSAN 375
           P +K  Y VLN  + PK  ++S    +      L IT    +P DG V    AN
Sbjct: 340 PHEKLRY-VLN--RAPKFTDLSAKGRVKRMAESLDITIELQLP-DGGVQVTQAN 389


>gi|207744160|ref|YP_002260552.1| pilus assembly protein [Ralstonia solanacearum IPO1609]
 gi|206595564|emb|CAQ62491.1| pilus assembly protein [Ralstonia solanacearum IPO1609]
          Length = 397

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 105/241 (43%), Gaps = 3/241 (1%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSIS 219
           G  +SF+  +GG G++  A N A  +++      LL DL   YG A  +  D+ P  +++
Sbjct: 131 GQVLSFLSCKGGSGTTFTAANFAHVLSARHGKHVLLVDLCQQYGDAAFLVTDQSPPATLA 190

Query: 220 DAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVI 279
           +    + R+D A +       +    +L       +  +     +  +L +   ++ +V+
Sbjct: 191 NVCNQIDRLDAALLDTCVTHVSHGFDVLAGAGDPVKAGEIKAAHLERILVLAASMYDVVV 250

Query: 280 LDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVK 339
            D+    N  +  VL  S  +     L L+ LR  + L+++   L        LV+NQ  
Sbjct: 251 FDLGQDINPASIVVLDHSSVIYPVLQLSLSYLRAGRRLMEICHSLGYHADRLRLVVNQYD 310

Query: 340 TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRV 399
             K+  I+ +   +  G+  + ++P+D      +AN G  + ++   S IA  L D +R 
Sbjct: 311 --KRVPITQNTLESAFGMPVAHVLPYDPGTVRDAANQGVPVLQLAEGSPIARALADMARQ 368

Query: 400 L 400
           L
Sbjct: 369 L 369


>gi|146276359|ref|YP_001166518.1| chromosome partitioning ATPase [Rhodobacter sphaeroides ATCC 17025]
 gi|145554600|gb|ABP69213.1| ATPase involved in chromosome partitioning-like protein
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 423

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 99/240 (41%), Gaps = 9/240 (3%)

Query: 168 GSRGGVGSSTIAHNCAFSIASVF---AMETLLADLDLPYGTANINFDKDPINSISDAIYP 224
           G  GGVG+ST A N A+ +A+V    A    L DLD  +G  +   D     S+ D +  
Sbjct: 174 GMAGGVGASTFACNLAWELATVTRTDAPRVCLIDLDFQFGAISTYLDLPRRESVFDILSD 233

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH 284
               D     +  + + E L + TAP  +        + I  +LD+    F  V++D+P 
Sbjct: 234 TESADSDSFLQAMITFNEKLHVFTAPPDMLPLDIVTAEDIGRLLDMAHANFDFVVVDMPT 293

Query: 285 VWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKP 344
              SWT+ VL  S        LDL   +N   L+  LK      +    VLN  + P+  
Sbjct: 294 TVTSWTEAVLARSHAYFAMMELDLRSAQNVLRLVRALKAESLPHEKLRFVLN--RAPRFT 351

Query: 345 EIS----ISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
           ++S    +      L IT    +P  GA    + + G  + E   K+ +   L   ++ L
Sbjct: 352 DLSAKSRVKRMAESLDITIELQLPDGGAAVTQANDHGLPLSESAAKNPLRRELQKLAKSL 411


>gi|264678231|ref|YP_003278138.1| response regulator receiver protein [Comamonas testosteroni CNB-2]
 gi|262208744|gb|ACY32842.1| response regulator receiver protein [Comamonas testosteroni CNB-2]
          Length = 386

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/270 (21%), Positives = 124/270 (45%), Gaps = 7/270 (2%)

Query: 136 PLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETL 195
           P ++AD +  +++        + + G  ++F+  +GG G++ +A N  +++A   ++  L
Sbjct: 106 PQALADAVQRLASKLQDSSPNR-AQGQVMAFLPCKGGAGATFLATNLGWALAQKHSV--L 162

Query: 196 LADLDLPYGTA-NINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLS 254
           L DL+L +G A     +  P ++++D    + R+D +F++   V     L +L AP    
Sbjct: 163 LIDLNLQFGDALPYLHEGKPSSTLADVARDLHRLDASFLTASTVKITPRLHVLAAPEDAM 222

Query: 255 RTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNS 314
              + +   I  ++ +    +  V+LD+  V +     VL  +  +V     ++  +RN+
Sbjct: 223 HAMEVEPGHIEAIVQLAATHYDFVLLDMGRVLDPLALRVLDKAQCIVPVLLPNVPAVRNA 282

Query: 315 KNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPS-AIIPFDGAVFGMS 373
           + L+ +   L   +   + VLN+V   ++ EI +S+    LG+      IP        +
Sbjct: 283 QKLLRMFHDLGYPESRLHPVLNRVD--RRSEIGLSEVRKTLGLEQQWRSIPDSAQEVQAA 340

Query: 374 ANSGKMIHEVDPKSAIANLLVDFSRVLMGR 403
            N+G  + E    S++   L  ++  L  R
Sbjct: 341 INAGAPLAESARSSSVVRELTAWADALSPR 370


>gi|320101692|ref|YP_004177283.1| response regulator receiver [Isosphaera pallida ATCC 43644]
 gi|319748974|gb|ADV60734.1| response regulator receiver [Isosphaera pallida ATCC 43644]
          Length = 407

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 75/353 (21%), Positives = 153/353 (43%), Gaps = 24/353 (6%)

Query: 65  IAEAVSCFSDS------STPDLIIVQTKVDSREVLSALE------PLAEVCDSGTKVIVI 112
           +A+  + +S++      S PDL ++    +  E L  +       P A V  + T  ++ 
Sbjct: 33  LADVCTAYSNAAATVAESPPDLTVIVMDNNPEEALGVIAGIYKVVPDALVLPACTAALIQ 92

Query: 113 GDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTP--QEEGKGSSGCSISFIGSR 170
            D     +   L+    +  L  P  +  +I +I     P  Q++   S    ++  G+ 
Sbjct: 93  PD-----MLMRLMRFKTAPVLPLPTEMDQLIKAIEDQVRPGAQDQSDSSVPKLVAVTGAS 147

Query: 171 GGVGSSTIAHNCAFSIASVFAMETL-LADLDLPYGTANINFDKDPINSISDAIYPVGRID 229
           GGVG +++A N    +A     +++ L D D+ +GT +   D  P  ++ D +  + R+D
Sbjct: 148 GGVGCTSLAVNVGAMLARSHPNQSVALLDFDMLFGTVDSCLDLIPERTVMDMLRDLDRLD 207

Query: 230 KAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSW 289
           +  + ++ +     L +L  P  +  +   + + +  ++ +L+  F  V++D      + 
Sbjct: 208 QTSMRQILLSDESGLHVLPHPVSMEESAQINPEALRRMVGMLKVSFDTVLIDCSKSLQAP 267

Query: 290 TQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKK--LRPADKPPYLVLNQVKTPKKPEIS 347
                 L+D +++   LDL  LRNS  L+ + ++      DK   +V+N+  +  + EI+
Sbjct: 268 DFIAFELADIILLVVQLDLNNLRNSARLLSLFRQPEFEWGDK-IRVVVNRYGSHTQ-EIT 325

Query: 348 ISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
                  L    S  IP D A +  + + G+ I  V+PK     ++ D    L
Sbjct: 326 PRRAQEVLETPISWQIPNDTATYSAAMSRGRPIDVVNPKCPARKVIQDIVETL 378


>gi|156741664|ref|YP_001431793.1| response regulator receiver protein [Roseiflexus castenholzii DSM
           13941]
 gi|156232992|gb|ABU57775.1| response regulator receiver protein [Roseiflexus castenholzii DSM
           13941]
          Length = 430

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/296 (19%), Positives = 134/296 (45%), Gaps = 20/296 (6%)

Query: 60  ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPL-AEVCDSGTKVIVIGDTNDV 118
           + + S        +    PD++++   +   + ++A E L ++V ++   ++ +    D 
Sbjct: 44  VAKASTGREALALAKQHRPDVVLMDINMPDMDGIAATEALLSQVPEAQVIMMSVQGEQDY 103

Query: 119 SLYRALISNHVSEYLIEPLSVADIINSISAIF---TPQE--------------EGKGSSG 161
            L RA+++    E+L +P+   ++ ++I  +    + Q               E +G+ G
Sbjct: 104 -LRRAMLAG-AREFLPKPIGAEELYSAIRHVHRLASTQRRYITTAPPGAGGSGEDEGAHG 161

Query: 162 CSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDA 221
             I+    +GG G+S+IA N A ++  +   +  L D +L +G      +     +I+D 
Sbjct: 162 QVIAVFSPKGGTGTSSIACNLAVALRLLTNKKVALVDGNLTFGDVGAILNLVSSKTIADL 221

Query: 222 IYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILD 281
           +  +  +D+  ++ +   +A  + +L AP             +  +L+++++ F  VI+D
Sbjct: 222 VNRISELDRDLLNDVMATHASQVKVLLAPPNPQTGELVTSDHLRAILEMMKKEFDYVIVD 281

Query: 282 VPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQ 337
               +       L +SD++V   +L++  ++N K  ++V + L    +   LVLN+
Sbjct: 282 TQASFQDRALAALDMSDRIVALMTLEIPCIKNIKLFLEVAELLEYPKEKIVLVLNK 337


>gi|261820216|ref|YP_003258322.1| response regulator receiver protein [Pectobacterium wasabiae
           WPP163]
 gi|261604229|gb|ACX86715.1| response regulator receiver protein [Pectobacterium wasabiae
           WPP163]
          Length = 399

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 80/335 (23%), Positives = 143/335 (42%), Gaps = 16/335 (4%)

Query: 52  RMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIV 111
           R+ Q ++ +  G I  A      +  P +++V  +  +   L ALE L  VC   ++VI 
Sbjct: 35  RLKQPDVPVMPGGITAARQWCELNVPPHVLLVDLE-GTHWPLPALEELLSVCGPTSQVIA 93

Query: 112 IGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGK--GSSGCSISFIGS 169
            G   DV LYRAL+   V +YL++P ++ D++ +  A    Q+ G     +G +I+ + +
Sbjct: 94  TGKEQDVGLYRALLQAGVVDYLVKPFTL-DLLAATLAKCEGQQAGPEYARTGRTIAVVSA 152

Query: 170 RGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISD-----AIYP 224
            GG G ST+A   +  ++    +   L D D        N D+  +   +D     A+  
Sbjct: 153 SGGSGGSTVAMGLSRLLSGERHLPVALVDFD------RRNGDQLLLQGQTDDAGLAAVLG 206

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH 284
              +D   + R  +     L +L     L      D   ++ +   L ++F  VI D+P 
Sbjct: 207 TQELDTRLLQRAMLRVDTRLHLLAQKPELGELSPVDVDNVLNLGGALCRMFNQVIWDLPS 266

Query: 285 VWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKP 344
            + +   +VLT +D  +I T L L   RN + +++ +       +   LV NQ +     
Sbjct: 267 SYPTGALDVLTYADLRIIVTELTLQDARNVRRVLNEIGDESEGQR-LLLVHNQSRFATTA 325

Query: 345 EISISDFCAPLGITPSAIIPFDGAVFGMSANSGKM 379
            +S   F   +G     ++P  G     S   G +
Sbjct: 326 PLSRDQFEQFIGRKIDVVLPNAGHALAQSLALGAL 360


>gi|299532598|ref|ZP_07045987.1| response regulator receiver protein [Comamonas testosteroni S44]
 gi|298719401|gb|EFI60369.1| response regulator receiver protein [Comamonas testosteroni S44]
          Length = 386

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/270 (21%), Positives = 124/270 (45%), Gaps = 7/270 (2%)

Query: 136 PLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETL 195
           P ++AD +  +++        + + G  ++F+  +GG G++ +A N  +++A   ++  L
Sbjct: 106 PQALADAVQRLASKLQDSTPNR-AQGQVMAFLPCKGGAGATFLATNLGWALAQKHSV--L 162

Query: 196 LADLDLPYGTA-NINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLS 254
           L DL+L +G A     +  P ++++D    + R+D +F++   V     L +L AP    
Sbjct: 163 LIDLNLQFGDALPYLHEGKPSSTLADVARDLHRLDASFLTASTVKITPRLHVLAAPEDAM 222

Query: 255 RTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNS 314
              + +   I  ++ +    +  V+LD+  V +     VL  +  +V     ++  +RN+
Sbjct: 223 HAMEVEPGHIEAIVQLAATHYDFVLLDMGRVLDPLALRVLDKAQCIVPVLLPNVPAVRNA 282

Query: 315 KNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPS-AIIPFDGAVFGMS 373
           + L+ +   L   +   + VLN+V   ++ EI +S+    LG+      IP        +
Sbjct: 283 QKLLRMFHDLGYPESRLHPVLNRVD--RRSEIGLSEVRKTLGLEQQWRSIPDSAQEVQAA 340

Query: 374 ANSGKMIHEVDPKSAIANLLVDFSRVLMGR 403
            N+G  + E    S++   L  ++  L  R
Sbjct: 341 INAGAPLAESARSSSVVRELTAWADALSPR 370


>gi|114799365|ref|YP_759871.1| putative pilus assembly protein CpaE [Hyphomonas neptunium ATCC
           15444]
 gi|114739539|gb|ABI77664.1| putative pilus assembly protein CpaE [Hyphomonas neptunium ATCC
           15444]
          Length = 405

 Score = 61.6 bits (148), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 108/251 (43%), Gaps = 29/251 (11%)

Query: 165 SFIGSRGGVGSSTIAHNCAFSIASVFA-METLLADLDLPYGTANINFDKDPINSISDAIY 223
           +F G+ GG G ST+A   AF++A +    +  L DL+L  G      +  P   +     
Sbjct: 147 AFRGAVGGAGVSTLAIESAFALARIVGPGKVCLVDLNLADGMTASFLEAVPKLDLKALSA 206

Query: 224 PVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFD----EKMIVPVLDILEQIFPLVI 279
              R+D+  ++     + + +SI+T+P    R  D D    E  I+ +LD+    F  V+
Sbjct: 207 APERLDERLLAAWCWQHEDGVSIITSP----RNPDADAMATEAAILRLLDVTCATFEYVL 262

Query: 280 LDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVK 339
           LD+P     WT+ V+   D+ ++ + L +  L  + ++   +  LR       LVLN++ 
Sbjct: 263 LDMPRHMMPWTKPVMAAVDQAIVVSELTVPSLHAAADMCRDIDILRAGGSKARLVLNRMF 322

Query: 340 TPK---------KPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSA-- 388
             K         K E SI         T    I  D      + N GK I +V PKS   
Sbjct: 323 PKKQFRAGFPVDKAEKSIER-------TIDVTITSDWDAARTAVNLGKPIADVKPKSLLV 375

Query: 389 --IANLLVDFS 397
             +A L+  F+
Sbjct: 376 ADVAGLVRKFA 386


>gi|119962025|ref|YP_948620.1| flp pilus assembly protein CpaE [Arthrobacter aurescens TC1]
 gi|119948884|gb|ABM07795.1| putative flp pilus assembly protein CpaE [Arthrobacter aurescens
           TC1]
          Length = 398

 Score = 61.6 bits (148), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 90/206 (43%), Gaps = 2/206 (0%)

Query: 159 SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSI 218
             G  I+ +  +GGVG +TI+ N A  +  +  M  ++ADLDL +G        DP  +I
Sbjct: 141 QGGRIIAVMSPKGGVGKTTISTNLAIGLGRISPMRVVIADLDLQFGDVASGLLIDPDRTI 200

Query: 219 SDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLV 278
           +DA+      D   +      +   +  L AP   S+      + +  +L+ L + F  V
Sbjct: 201 ADAVTGAAVQDSMVLKSYLSVHPAGIYALCAPRNPSQIEQISAEQVGHLLEQLAREFDYV 260

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQV 338
           I+D            L  +  VV    +D+  +R  +N +++L ++    +  ++VLN  
Sbjct: 261 IVDTAPGLGEHVLATLERASDVVWVCGMDIPSIRGLRNGLEILDEIGLVPEQRHVVLNFA 320

Query: 339 KTPKKPEISISDFCAPLGITPSAIIP 364
              K+  +++ D  A +G      +P
Sbjct: 321 D--KRSGLTLIDVEATIGCPVDVTLP 344


>gi|83749636|ref|ZP_00946619.1| PILUS ASSEMBLY PROTEIN; cpaE1 [Ralstonia solanacearum UW551]
 gi|83723697|gb|EAP70892.1| PILUS ASSEMBLY PROTEIN; cpaE1 [Ralstonia solanacearum UW551]
          Length = 438

 Score = 61.6 bits (148), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 105/241 (43%), Gaps = 3/241 (1%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSIS 219
           G  +SF+  +GG G++  A N A  +++      LL DL   YG A  +  D+ P  +++
Sbjct: 172 GQVLSFLSCKGGSGTTFTAANFAHVLSARHGKHVLLVDLCQQYGDAAFLVTDQSPPATLA 231

Query: 220 DAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVI 279
           +    + R+D A +       +    +L       +  +     +  +L +   ++ +V+
Sbjct: 232 NVCNQIDRLDAALLDTCVTHVSHGFDVLAGAGDPVKAGEIKAAHLERILVLAASMYDVVV 291

Query: 280 LDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVK 339
            D+    N  +  VL  S  +     L L+ LR  + L+++   L        LV+NQ  
Sbjct: 292 FDLGQDINPASIVVLDHSSVIYPVLQLSLSYLRAGRRLMEICHSLGYHADRLRLVVNQYD 351

Query: 340 TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRV 399
             K+  I+ +   +  G+  + ++P+D      +AN G  + ++   S IA  L D +R 
Sbjct: 352 --KRVPITQNTLESAFGMPVAHVLPYDPGTVRDAANQGVPVLQLAEGSPIARALADMARQ 409

Query: 400 L 400
           L
Sbjct: 410 L 410


>gi|225872755|ref|YP_002754212.1| type II secretion system protein [Acidobacterium capsulatum ATCC
           51196]
 gi|225793148|gb|ACO33238.1| type II secretion system protein [Acidobacterium capsulatum ATCC
           51196]
          Length = 408

 Score = 61.2 bits (147), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 115/249 (46%), Gaps = 27/249 (10%)

Query: 90  REVLSALEPLAEVCDS--GTKVIVIGDTNDVS---LYRALISNHVSEYLIEPLSVADIIN 144
           R+V +ALE  AE   +    +V  +G + ++    L RA+ +   +E+L +PL    ++ 
Sbjct: 71  RDVEAALET-AETLHTMASPRVTCVGVSTNLDTEILLRAMRAG-CNEFLQKPLDSTHLVE 128

Query: 145 SISAI---FTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLAD--- 198
           ++  I      + E   + G  +S  G++GGVG++T+A + A  +    + +TLL D   
Sbjct: 129 TLERIQGRIFSKMESTAARGRVLSVFGAKGGVGTTTLAVHLASYLVRRCSKKTLLIDHYH 188

Query: 199 ------LDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAM 252
                 L L    +N +FD        D I  V R+D   +    + +A  LS++ +P  
Sbjct: 189 QLGHVCLHLGLKESNYHFD--------DLIRNVDRLDSDLLQGFLLRHASGLSVICSPDT 240

Query: 253 LSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLR 312
            +       + +  + D L + +  +ILD    +      ++ LSD V + ++ D+A LR
Sbjct: 241 CTARSRASYEDLERIFDFLRREYDYIILDSSLQYEETAAAMIRLSDSVYLVSTPDVAALR 300

Query: 313 NSKNLIDVL 321
           +    I+ L
Sbjct: 301 DLSRHIENL 309


>gi|83943937|ref|ZP_00956394.1| ATPase, putative [Sulfitobacter sp. EE-36]
 gi|83845184|gb|EAP83064.1| ATPase, putative [Sulfitobacter sp. EE-36]
          Length = 412

 Score = 61.2 bits (147), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 75/336 (22%), Positives = 142/336 (42%), Gaps = 27/336 (8%)

Query: 66  AEAVSCFS--DSSTPDLIIVQTKVDSREVLSAL-EPLAEVCDSGTKVIVIGDTNDVSLYR 122
           +E+++ FS  +++T +LI +    +  E L  + E +++      KVI+I +    +   
Sbjct: 46  SESLAFFSQPEAATLELIALALDSEDEENLPMMSEIISQAKSRHIKVILIAEDMSPASLH 105

Query: 123 ALISNHVSEYLIEPL---SVADIINSISAIFTPQEE----------GKGSSGCSISFIGS 169
           +L+     E++  PL    +A  I  + A   P+ E          G    G  I   G 
Sbjct: 106 SLLRQGADEFVPYPLPEGELAATIERLRAGPEPKAEHIEAGPKLKPGADKDGAVIVVHGL 165

Query: 170 RGGVGSSTIAHNCAFSIASVFAM---ETLLADLDLPYGTANINFDKDPINSISDAIYPVG 226
            GG G++++A N A+ +A+       +  L D DL +G      D      + D +    
Sbjct: 166 AGGTGATSMAVNLAWELATSDKKNPPKVCLLDFDLQFGAVATYLDLPRREVVYDMLIETD 225

Query: 227 RIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVW 286
            +D+    +  + Y + L +LTAPA +        + +  +LD+    F  V++D+P   
Sbjct: 226 EMDEESFGQALLTYEDTLQVLTAPADMLPLDLITSEDVTRILDMARNQFDYVVVDMPSTL 285

Query: 287 NSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR-PADKPPYLVLNQVKTPKKPE 345
             WT+ VL+ +        LD+   +N+      L+    P +K  Y V+N  + PK  +
Sbjct: 286 VQWTETVLSNAHVYFAMLELDMRCAQNALRFKRALQSEELPVEKLRY-VMN--RAPKFTD 342

Query: 346 IS----ISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
           ++    +      LGI+    +P  G     + + G
Sbjct: 343 LNAKARVKRMAESLGISIDVQLPDGGKQVTQANDHG 378


>gi|283777931|ref|YP_003368686.1| response regulator receiver protein [Pirellula staleyi DSM 6068]
 gi|283436384|gb|ADB14826.1| response regulator receiver protein [Pirellula staleyi DSM 6068]
          Length = 368

 Score = 60.8 bits (146), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 65/282 (23%), Positives = 123/282 (43%), Gaps = 5/282 (1%)

Query: 47  SKIDPRMSQVNMRITRGS---IAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVC 103
           S+I  R+S+  +   R S   + +A +       PDL+ +     +  V   +    E  
Sbjct: 14  SRIATRLSKAGIECPRASCVPLEQARALLHAGMNPDLLFLNCNSPTDRVDDLIHRYRETT 73

Query: 104 DSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCS 163
                V+ IG    ++    LI    S+YL     +   ++++ A      +G+G  G +
Sbjct: 74  GGSGTVVAIGKGLGMTRILELIRTGASDYLDAGGDLDAELDALIARLRMSSQGRGK-GQA 132

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           I  + + GG G+S+IA N A S+A       L+ DL L  G      +  P ++I D  +
Sbjct: 133 ICVLSASGGSGASSIAANLAISLAKQRGSACLI-DLKLRGGDLATLMNLKPRHTIVDLCF 191

Query: 224 PVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVP 283
              R+D A      + +   + +L AP +L+     D + I  V  +    FP V+LD+ 
Sbjct: 192 QGERLDHAMFDSALLPHPSGVKLLAAPTLLTDHAGVDVETISQVFKLAATDFPYVVLDLE 251

Query: 284 HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
            V +   Q  +  SD +++   LD   +  ++ ++  L++++
Sbjct: 252 DVVHREQQRAIASSDLLIVVLRLDFPCILRTRRMLAYLREMQ 293


>gi|294139872|ref|YP_003555850.1| hypothetical protein SVI_1101 [Shewanella violacea DSS12]
 gi|293326341|dbj|BAJ01072.1| hypothetical protein [Shewanella violacea DSS12]
          Length = 284

 Score = 60.8 bits (146), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 117/290 (40%), Gaps = 24/290 (8%)

Query: 147 SAIFTPQEEGK-----------GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETL 195
           S+I+  QE G            G  G  I    ++GG GS+ IA N A+ ++        
Sbjct: 3   SSIYKIQETGSQTDYSQYRVASGELGKRILVASAKGGAGSTCIAANLAWVLSQQLDKRVA 62

Query: 196 LADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTA-PAMLS 254
            ADLD   G  +++ +    N +++ +    R++     R  V  AE L + T     L+
Sbjct: 63  CADLDFVSGDLDLHLNISANNRLTEMLQYPERLEPIVFERSGVKAAEKLHVFTGYSQQLA 122

Query: 255 RTYDFDEKMIVPVLDILEQIFPLVILDVPH--VWNSWTQEVLTLSDKVVITTSLDLAGLR 312
           + +  D           +Q    +I D+P   + +S   E +  +D  ++     LA +R
Sbjct: 123 QEFWPDSAAFEATSQFCQQQTDYLIWDIPSFCLRDSVGFEAICSADIRIVIIEPTLASIR 182

Query: 313 NSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGM 372
           ++  L+  L      D+   L+LN  K  K   IS++D    LG +   +IPF       
Sbjct: 183 HTNQLLTQLAT--DHDQQTILILNHTKPEKASLISLADVNQALGQSVDLVIPFSPEKMLS 240

Query: 373 SANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFN 422
           SA  G   H  D    +  +     + L  RVT    Q A  +++K  F 
Sbjct: 241 SATLGS--HVADDNGRLGRVF----KQLAARVT--GEQLAPTSRLKLWFR 282


>gi|188592033|ref|YP_001796631.1| response receiver involved in pilum assembly [Cupriavidus
           taiwanensis LMG 19424]
 gi|170938407|emb|CAP63394.1| putative response receiver involved in pilum assembly [Cupriavidus
           taiwanensis LMG 19424]
          Length = 419

 Score = 60.8 bits (146), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 60/280 (21%), Positives = 118/280 (42%), Gaps = 22/280 (7%)

Query: 152 PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVF--------AMETLLADLDLPY 203
           P E  +   G  ++ +G+R GVG +++A N A +               E LL DL LP 
Sbjct: 126 PAEAAR--QGKIVALLGARAGVGVTSLAVNLAAAARRHLPRHAKTDARAEVLLTDLGLPA 183

Query: 204 GTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKM 263
               +  +  P     +A+  + R D+ FV      +A  + +L  PA LS   D     
Sbjct: 184 RDGALYLNLSPGFHFVEAVRNLRRFDQVFVQTALTRHANGVCVLPLPAALSELRDISYAD 243

Query: 264 IVPVLDILEQIFPLVILDVPHVWNS-WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK 322
            + +L+ L   F L I+D+    N+ +T +++  +D VV+     +  + ++  L+  L+
Sbjct: 244 AIGLLERLRAFFDLQIVDLGGFGNAEFTAQIVKAADSVVLVADQSVGAIVSAAELVHELR 303

Query: 323 KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHE 382
                    +L++++     +  +  +     +G+   A +P       ++ N G ++ +
Sbjct: 304 AREVERDDLHLLVSRFDA--RLGVDAAQIARRVGVESVATLPDSREALVLAMNRGAVLAD 361

Query: 383 VDPK----SAIANLLVDFSRVLMGRVTVSKPQSAMYTKIK 418
            DP      A+A LL       +G  T +   + +  +IK
Sbjct: 362 DDPHCPYVRALAELLER-----LGYRTAAARDTTLLARIK 396


>gi|116620533|ref|YP_822689.1| response regulator receiver protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223695|gb|ABJ82404.1| response regulator receiver protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 388

 Score = 60.5 bits (145), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 75/330 (22%), Positives = 136/330 (41%), Gaps = 18/330 (5%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPL 137
           PD+++V      +E L  L            +I +  T +     + +   ++EYL  PL
Sbjct: 52  PDVVLVDIS-GWKEPLEGLVASIRAAAGDPMIIALNTTAEADSILSALRAGINEYLYPPL 110

Query: 138 S--VADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETL 195
              +   +   S   + + EG   +G S+ F+ ++GG GS+T+  + A  +        L
Sbjct: 111 QDPLRRSLERRSLERSRRREGAKGNGKSLGFMSAKGGCGSTTLVCHVAAELGR-LNQRVL 169

Query: 196 LADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSR 255
           LADLDL  G          + SI DA+  + R+D  +   L       + I+++P  L+ 
Sbjct: 170 LADLDLDAGMVAFITKTKSVYSILDAVNNLHRLDIHYWKALVSNGIPGVEIVSSPLALAS 229

Query: 256 TYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSK 315
                +  I  V+      +   ++D+    +      L   D+  + T+L++  L  SK
Sbjct: 230 KQQPKDDQIRQVISFARPHYDWTLVDLGRSLSRLGMAALEEIDEACLVTTLEVPALHQSK 289

Query: 316 NLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFD--------- 366
            +I  L           L+LN  + PK+ +I+  +    LG    A++P D         
Sbjct: 290 QIIQTLIDSGYGKNRIKLILN--RAPKRLDITPGELEKMLGTAIFAMVPNDYPELYETYA 347

Query: 367 -GAVFGMSANSGKMIHEVDPKSAIANLLVD 395
            G +   ++  GK I ++  K  +ANL  D
Sbjct: 348 EGRMLTRTSELGKQIAKLATK--LANLEED 375


>gi|187926428|ref|YP_001892773.1| putative pilus assembly protein [Ralstonia pickettii 12J]
 gi|241665915|ref|YP_002984274.1| pilus assembly protein [Ralstonia pickettii 12D]
 gi|187728182|gb|ACD29346.1| putative pilus assembly protein [Ralstonia pickettii 12J]
 gi|240867942|gb|ACS65602.1| pilus assembly protein [Ralstonia pickettii 12D]
          Length = 447

 Score = 60.5 bits (145), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 104/241 (43%), Gaps = 3/241 (1%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISD 220
           G  ++ +G+R GVG++T+A N A  +    A + +L DL  P     +  +        +
Sbjct: 158 GRVLAVLGARPGVGATTLATNLATLVRRTSASDVMLLDLGQPLRDGALYLNVQANFHFVE 217

Query: 221 AIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVIL 280
           A+  + R D+ FV      +   L++L  P  L+   D      + +L+ L   F L ++
Sbjct: 218 AVRNLRRFDQVFVQTALSRHPNGLAVLPLPISLAEMRDVSFSEALGLLNRLRTFFDLQVV 277

Query: 281 DVPHVWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVK 339
           D+    N  +  +++  +D V++ T   +  + ++  L+  LKK R  D+  +L L   K
Sbjct: 278 DLGGFGNIDFIAQIIKAADDVMLVTEQSVGAIVSAAELMQELKK-REIDR-DHLHLTISK 335

Query: 340 TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRV 399
              +  +  +     L I     +P       +++N G M+ E  P  A    L   ++ 
Sbjct: 336 FDARLSLDAAQIAERLEIPSVLTVPNRREALVIASNQGAMLAETHPTDAYVRALAQIAQT 395

Query: 400 L 400
           L
Sbjct: 396 L 396


>gi|78186668|ref|YP_374711.1| Flp pilus assembly protein ATPase CpaE-like [Chlorobium luteolum
           DSM 273]
 gi|78166570|gb|ABB23668.1| Flp pilus assembly protein ATPase CpaE-like protein [Chlorobium
           luteolum DSM 273]
          Length = 381

 Score = 60.5 bits (145), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/248 (21%), Positives = 115/248 (46%), Gaps = 9/248 (3%)

Query: 159 SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDP-INS 217
           S G  I F+ S+GG GSS +A N AF+++   A+  L  D  LP+G  ++    +     
Sbjct: 124 SRGRVIGFVSSKGGDGSSCLAANLAFALSCEPAIRVLAIDASLPFGDLDMYLTGETHCQD 183

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
           ++D      R+D++ +  +    +    ++++PA   +  D +   +  ++ I  + +  
Sbjct: 184 LADISCQSDRLDRSLLDSMVQHLSSTFDLISSPATFEKIVDIEPARVSQLVQIARESYNF 243

Query: 278 VILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP-PY--LV 334
           +++D+    +     VL   D++ I ++  L  LR + +L+ +  +L   DKP P   ++
Sbjct: 244 ILVDLGSCIDQVGVWVLEQLDELSIVSTPSLPSLRRAGHLLKLSGEL---DKPVPEINII 300

Query: 335 LNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLV 394
           LN+     +  ++ ++    +        P D      S   G+ + +  P+S ++  +V
Sbjct: 301 LNRADASVR--LTCTEIEKVIERPIERRFPSDADAVEESLMMGQPLLQAAPESRLSKTIV 358

Query: 395 DFSRVLMG 402
           D++  L G
Sbjct: 359 DWALQLTG 366


>gi|255264071|ref|ZP_05343413.1| response regulator receiver protein [Thalassiobium sp. R2A62]
 gi|255106406|gb|EET49080.1| response regulator receiver protein [Thalassiobium sp. R2A62]
          Length = 415

 Score = 60.5 bits (145), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 135/306 (44%), Gaps = 35/306 (11%)

Query: 104 DSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTP----------- 152
           D G K+I+I +    +   +L+     E++  PL   ++  +I  I TP           
Sbjct: 88  DKGIKIILIAEDTTPAALHSLLRMGADEFIPYPLPENELGAAIERIQTPPPAPVAEVPAE 147

Query: 153 -QEEGKG---SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMET---LLADLDLPYGT 205
            Q   K     +G  ++  G  GG G++T+A N A+ + +V   +T    + D DL  G 
Sbjct: 148 MQSNLKAVNDRNGVVLAVHGMAGGTGATTLAINLAWELVTVEKDKTPRVCILDFDLQCGN 207

Query: 206 ANINFDKDPINSISDAIYPVGRIDK-AFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMI 264
            +   D D   ++ + +     +D  AF+  L + Y E L + TAP+ +      + + I
Sbjct: 208 VSTYLDLDRREAVYELLSDTESMDSDAFMQTL-LAYNEKLHVFTAPSDMLPLDLVEPEDI 266

Query: 265 VPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL 324
             ++      F  VI+D+P    +WT+ VL  +     T  L++   +N++     LK+L
Sbjct: 267 QRLIGFAASNFDYVIVDMPSTVVAWTETVLQSAHVYFATLELEMRSAQNTQR----LKRL 322

Query: 325 RPADKPPY----LVLNQVKTPKKPEIS----ISDFCAPLGITPSAIIPFDGAVFGMSANS 376
             ++  P+     VLN  + PK  +++    I      LGI+   ++P  G     +A++
Sbjct: 323 LQSEDLPFEKIRFVLN--RAPKFIDLNGKSRIKRLAESLGISIELLMPDGGKAVVQNADN 380

Query: 377 G-KMIH 381
           G  M H
Sbjct: 381 GLAMAH 386


>gi|84386795|ref|ZP_00989820.1| probable CpaE2 pilus assembly protein [Vibrio splendidus 12B01]
 gi|84378323|gb|EAP95181.1| probable CpaE2 pilus assembly protein [Vibrio splendidus 12B01]
          Length = 386

 Score = 60.5 bits (145), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 68/306 (22%), Positives = 137/306 (44%), Gaps = 13/306 (4%)

Query: 88  DSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSIS 147
           +S++V+  L     +  +G +VI IG + ++  YR ++++  S+YL+ P++  D+ +   
Sbjct: 67  ESKQVVQRL-----IQRTGCQVIAIGHSTEIFAYRGMLASGASDYLVNPVTPQDLEHVSF 121

Query: 148 AIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN 207
           A      E +     SI  + ++GG GSSTI    +  +A +    T + DLD   G  +
Sbjct: 122 AALQLNNEKRNEKIVSI--VSAKGGSGSSTIIATLSQQLAELDKRVTCM-DLDFSMGDLD 178

Query: 208 INFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIV-P 266
           +  + +   ++ + +    R++     R  +  +   ++ T    L  T  + +K     
Sbjct: 179 LLLNVEGNTALVELLQYPERLEPLVFERSGISVSPEHTLFTGYLPLDTTPFWPQKSAFDQ 238

Query: 267 VLDILEQIFPLVILDVP--HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL 324
                 Q    +++D+P   + +    E L  +D  +I     L+ +RN+  +I  L+  
Sbjct: 239 FTKFCLQSSDYLLIDIPTYSLRDQVGFEALKSADIRIIVVEPTLSSIRNAGQIIKRLQN- 297

Query: 325 RPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVD 384
             A     +VLN  K+     IS++D    LG +   +IPF    F   ++ G+  H+ +
Sbjct: 298 -QAASQTIVVLNHCKSDSASLISVNDVKKSLGTSVDVMIPFLPNHFLSKSSLGQPAHKGN 356

Query: 385 PKSAIA 390
            K  +A
Sbjct: 357 RKVKLA 362


>gi|83954510|ref|ZP_00963221.1| ATPase, putative [Sulfitobacter sp. NAS-14.1]
 gi|83840794|gb|EAP79965.1| ATPase, putative [Sulfitobacter sp. NAS-14.1]
          Length = 408

 Score = 60.5 bits (145), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 75/338 (22%), Positives = 141/338 (41%), Gaps = 27/338 (7%)

Query: 64  SIAEAVSCFS--DSSTPDLIIVQTKVDSREVLSAL-EPLAEVCDSGTKVIVIGDTNDVSL 120
             +E+++ FS  +++T +LI +    +  E L  + E +++      KVI+I +    + 
Sbjct: 40  GFSESLAFFSQPEAATLELIALALDSEDEENLPMMSEIISQAKSRHIKVILIAEDMSPAS 99

Query: 121 YRALISNHVSEYLIEPL---SVADIINSISAIFTPQEE----------GKGSSGCSISFI 167
             +L+     E++  PL    +A  I  + A   P  E          G    G  I   
Sbjct: 100 LHSLLRQGADEFVPYPLPEGELAATIERLRAGPEPTAEHIEAGPKLKPGADKDGAVIVVH 159

Query: 168 GSRGGVGSSTIAHNCAFSIASVFAM---ETLLADLDLPYGTANINFDKDPINSISDAIYP 224
           G  GG G++++A N A+ +A+       +  L D DL +G      D      + D +  
Sbjct: 160 GLAGGTGATSMAVNMAWELATSDKKNPPKVCLLDFDLQFGAVATYLDLPRREVVYDMLIE 219

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH 284
              +D+    +  + Y + L +LTAPA +        + +  +LD+    F  V++D+P 
Sbjct: 220 TDEMDEESFGQALLTYEDTLQVLTAPADMLPLDLITSEDVTRILDMARNQFDYVVVDMPS 279

Query: 285 VWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR-PADKPPYLVLNQVKTPKK 343
               WT+ VL+ +        LD+   +N+      L+    P +K  Y V+N  + PK 
Sbjct: 280 TLVQWTETVLSNAHVYFAMLELDMRCAQNALRFKRALQSEELPVEKLRY-VMN--RAPKF 336

Query: 344 PEIS----ISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
            +++    +      LGI+    +P  G     + + G
Sbjct: 337 TDLNAKARVKRMAESLGISIDVQLPDGGKQVTQANDHG 374


>gi|260426905|ref|ZP_05780884.1| response regulator receiver protein [Citreicella sp. SE45]
 gi|260421397|gb|EEX14648.1| response regulator receiver protein [Citreicella sp. SE45]
          Length = 416

 Score = 60.5 bits (145), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 67/290 (23%), Positives = 123/290 (42%), Gaps = 27/290 (9%)

Query: 64  SIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVC----DSGTKVIVIGDTNDVS 119
              EA++  + S+   L  V   +D ++  + L  LAEV     + G KV++I +    S
Sbjct: 45  GFGEALAFLNQSNARTLEFVALAIDDQDEQN-LGLLAEVIAAAKNRGIKVVLIAEDVTPS 103

Query: 120 LYRALISNHVSEYLIEPL-------SVADIINSISAIFTPQEEGK---------GSSGCS 163
               L+     E++  PL       +V  + ++  A+  P    +         G  G  
Sbjct: 104 ALHQLLRRGADEFVPYPLPEGELSVAVDRMRSATRAVSDPTLNRRSNDGVKLSGGGDGVL 163

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASV---FAMETLLADLDLPYGTANINFDKDPINSISD 220
           I+  G  GG G++T A N A+ +A++    A    L D    +G+     D     S+ +
Sbjct: 164 IAVQGLAGGCGATTFAVNLAWELANIGKERAPRVCLLDFGFQFGSVATYLDLPRRESVME 223

Query: 221 AIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVIL 280
            +  V  +D     +  V + + L +LT+P+ +          I  +LD+  + F  V++
Sbjct: 224 LLGSVEAMDGDSFGQALVTFQDKLQVLTSPSDVVPLDLLGPDEIKALLDVAREHFDYVVV 283

Query: 281 DVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP 330
           D+P     WT+ VL  S        LD   +R+++N + + + L+  D P
Sbjct: 284 DMPGTLVQWTETVLLESQVYFALLELD---MRSAQNALRMKRALQAEDLP 330


>gi|17545372|ref|NP_518774.1| pilus assembly protein [Ralstonia solanacearum GMI1000]
 gi|17427664|emb|CAD14183.1| putative pilus assembly protein [Ralstonia solanacearum GMI1000]
          Length = 397

 Score = 60.5 bits (145), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 104/246 (42%), Gaps = 3/246 (1%)

Query: 156 GKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDP 214
           G  S    +SF+  +GG G++  A N  +++A+      LL DL   YG A  +  D+ P
Sbjct: 126 GHRSEAKVVSFLSCKGGSGTTFTAANFGYTLAARQGKRVLLIDLSQQYGDAAFLVTDQAP 185

Query: 215 INSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI 274
             +++     + R+D A +         N  +L A     +  +     +  +L ++  +
Sbjct: 186 PATLASVCQQIERLDPALLDACLTHVCPNFDVLPAAGDPVKAGEIKAMHLERILTLISPL 245

Query: 275 FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLV 334
           + +VI DV    N  +  VL  S  +     L L  LR  + L+D+   L    +   LV
Sbjct: 246 YDVVIFDVGQDINPASIVVLDHSTVIYPVLQLTLPHLRAGRRLLDICHSLGYHAERLRLV 305

Query: 335 LNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLV 394
           +N+ +  K   + +       G+  + ++P D      +++ G  + ++   S IA  L 
Sbjct: 306 INRYE--KHTPVDLHTLENAFGLHAAHLLPNDRGPVRDASSQGVPVLQLAEHSPIARALA 363

Query: 395 DFSRVL 400
           D +  L
Sbjct: 364 DMASQL 369


>gi|84501674|ref|ZP_00999846.1| ATPase, putative [Oceanicola batsensis HTCC2597]
 gi|84390295|gb|EAQ02854.1| ATPase, putative [Oceanicola batsensis HTCC2597]
          Length = 410

 Score = 60.5 bits (145), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 68/305 (22%), Positives = 131/305 (42%), Gaps = 24/305 (7%)

Query: 64  SIAEAVSCFSDSSTPDLIIVQTKVDSRE---VLSALEPLAEVCDSGTKVIVIGDTNDVSL 120
            IAEA+  F+      L  +   +D ++   +    E +++  ++G KVI+I +    S 
Sbjct: 39  GIAEALLFFNQPEAQSLEFIALAMDEQDESNIAMLGEVISQARNNGIKVILIAEDVSPSA 98

Query: 121 YRALISNHVSEYLIEPLSVADIINSISAIFTP-----QEEGKGSS-------GCSISFIG 168
              L+ +   E++  PL   ++  +I  + TP      E  + SS       G      G
Sbjct: 99  LHQLLRHGADEFVPYPLPEGELAAAIDRVQTPVHDPEDEAPRKSSTPRGTREGAVFVCHG 158

Query: 169 SRGGVGSSTIAHNCAFSIASVFAME-----TLLADLDLPYGTANINFDKDPINSISDAIY 223
             GGVG+++ A N A+ +A     E       + DLDL +G      D     +I + + 
Sbjct: 159 LAGGVGATSFAVNLAWELAHSARKEEDQPRVCVLDLDLQFGAVGTYLDLPRREAIYELLS 218

Query: 224 PVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVP 283
               +D    ++  + +   + +LT+PA +      +   +  ++++    F  VI+D+P
Sbjct: 219 DTESMDDDVFTQALLDFEGKIHVLTSPAEMLPLELINSDDVTRLIEMARSHFDFVIIDMP 278

Query: 284 HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQVKTPK 342
                W++  L  +        LD+   +N++ L   L+ +  P +K  Y VLN  + PK
Sbjct: 279 STLVQWSEVALNAAHVYFALMELDMRSAQNAQRLKRALQAEDLPVEKLRY-VLN--RAPK 335

Query: 343 KPEIS 347
             ++S
Sbjct: 336 SLDLS 340


>gi|51245383|ref|YP_065267.1| septum site-determining protein (MinD) [Desulfotalea psychrophila
           LSv54]
 gi|50876420|emb|CAG36260.1| related to septum site-determining protein (MinD) [Desulfotalea
           psychrophila LSv54]
          Length = 386

 Score = 60.1 bits (144), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 70/335 (20%), Positives = 147/335 (43%), Gaps = 16/335 (4%)

Query: 79  DLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLS 138
           D+++++   D    L  +  L +    GT  +   +     L  AL +    E+  +P+ 
Sbjct: 46  DVLVLEIGSDPDSELETIRTLLQEGVVGTLFVTSAEATSKILLPALHTG-AKEFFQQPIL 104

Query: 139 VADIINS-----ISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAME 193
             +++ +     +S      EE     G   S +G++GGVG++T A N A SI S F   
Sbjct: 105 PQEVVKAFMEVRVSDNGQESEEMPSKEGSIFSVLGAKGGVGTTTFAVNLATSIQS-FDKS 163

Query: 194 TLLADLDLPYGTANI----NFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTA 249
            L+A +D+      +    N + D   +  +    + R+D A++      ++  + ++ A
Sbjct: 164 KLVALIDMNRMVGEVPLFLNLETDL--NWEEIGKNINRLDAAYLKSAMTRHSSGVYVMPA 221

Query: 250 PAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLA 309
           P  ++         +V +L  ++  F  +++D     +  + ++   S+ V + ++L L 
Sbjct: 222 PNKIANGVQLARDYLVTILTAMQDFFDYIVIDSGMYLDDISFKIFEKSEVVYLISTLSLP 281

Query: 310 GLRNSKNLIDVLK-KLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGA 368
            + N+K L + L       +    ++ N+ +  KK +IS+ +    +G   S  IP D  
Sbjct: 282 CIINAKRLKESLDMGGEMTNGKVQIIANRFE--KKSQISLKEAGKMIGGEISVTIPNDYE 339

Query: 369 VFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGR 403
           +   + N+GK I  V  KS +A +    +  ++G+
Sbjct: 340 LTMSAINNGKPIANVRGKSNLARVYSALAETIVGK 374


>gi|89053486|ref|YP_508937.1| ATPase, putative [Jannaschia sp. CCS1]
 gi|88863035|gb|ABD53912.1| ATPase putative [Jannaschia sp. CCS1]
          Length = 419

 Score = 60.1 bits (144), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 105/239 (43%), Gaps = 13/239 (5%)

Query: 171 GGVGSSTIAHNCAFSIASVFAME---TLLADLDLPYGTANINFDKDPINSISDAIYPVGR 227
           GG G++T+A N A+ +A           + D DL  G+     D    + + + +     
Sbjct: 173 GGTGATTLAVNLAWELAHADKKNPPSVCVLDFDLQQGSVATYLDLPRRDIVLELLQDAAT 232

Query: 228 IDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWN 287
           +D     +  V Y + +S+ T PA +        + +  V+D+  Q F +V++D+P    
Sbjct: 233 MDTDGFKQALVNYGDKISVFTTPAEIVPLDLIGPEEVTAVVDLAAQCFDIVVIDMPRTMV 292

Query: 288 SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQV--KTPKKPE 345
            WT+ VLT +D    T  LD   LR+++N +  +K  +  D  P   +N V  + P   +
Sbjct: 293 MWTETVLTRADVYFATMELD---LRSAQNAMRFIKACQSEDL-PLEKMNYVINRAPGLTD 348

Query: 346 IS----ISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
           ++    +      LG+  S  +P  G     + ++G+ + E   K+ +   ++  S  L
Sbjct: 349 LNGKNRMKKMADSLGVAFSTHLPDGGKPVMQAGDNGETLAEAAKKNPLRKEILKLSEGL 407


>gi|149183732|ref|ZP_01862140.1| MinD [Bacillus sp. SG-1]
 gi|148848553|gb|EDL62795.1| MinD [Bacillus sp. SG-1]
          Length = 267

 Score = 59.7 bits (143), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 63/276 (22%), Positives = 133/276 (48%), Gaps = 21/276 (7%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN----FDKDPIN 216
           G +I     +GGVG +T + N   ++A +   +  L D D+  G  N++     +   I 
Sbjct: 2   GEAIVITSGKGGVGKTTTSANVGTALA-LQGKKVCLVDTDI--GLRNLDVVMGLENRIIY 58

Query: 217 SISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFP 276
            + D +    +I +A V      + + L +L A     ++    E+M   +++ L+Q + 
Sbjct: 59  DLVDVVEGRCKIHQALVK--DKRFEDKLFLLPAAQTSDKSAVSPEQM-KKLIETLKQDYD 115

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            +I+D P       +  +  +D+ ++ T+ +++ +R++  +I +L+K     +PP LV+N
Sbjct: 116 YIIIDCPAGIEQGYKNAVAGADRAIVVTTPEISAVRDADRIIGLLEK--EDIEPPKLVIN 173

Query: 337 QVKTP--KKPE-ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
           +++T   K  E + + +    L I    I+  D  V   S+N G+ I  +DP S  +   
Sbjct: 174 RIRTHMMKSGEMLDVDEITTHLSIDLIGIVADDDNVI-KSSNRGEPIA-MDPSSKASIAY 231

Query: 394 VDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMKC 425
            + +R ++G      ++ + +  ++TK+KK F +K 
Sbjct: 232 RNIARRILGESVPLQSLDEDKQGVFTKLKKFFGVKA 267


>gi|134291852|ref|YP_001115621.1| response regulator receiver protein [Burkholderia vietnamiensis G4]
 gi|134135041|gb|ABO59366.1| response regulator receiver protein [Burkholderia vietnamiensis G4]
          Length = 402

 Score = 59.7 bits (143), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 66/314 (21%), Positives = 133/314 (42%), Gaps = 7/314 (2%)

Query: 80  LIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSV 139
           L+I   ++D+ E L+ALE +       T ++V  D +   L  A+ +    + L  P+  
Sbjct: 52  LLIDSGQIDAAE-LAALERICRQHPGLTGILVSADASPQMLLDAMRAG-ARDVLQWPIDT 109

Query: 140 ADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADL 199
           A +  ++           G     ISF   +GG G+S +A N A+ I+  F    LL DL
Sbjct: 110 AALARALERAAAQSTRRDGDDTRIISFTSCKGGAGTSFVASNVAYEISEQFKRRVLLIDL 169

Query: 200 DLPYGTAN-INFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYD 258
           +  Y  A  +  D+ P +++      + RID AF+            +L       +  +
Sbjct: 170 NQQYADAAFLVSDETPPSTLPQLCAQIERIDGAFLDASLAHVTPTFHVLAGAGDPVKAAE 229

Query: 259 FDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLI 318
             E  +  +L +    +  VI D+    ++ +   L  SD++ +     +  +R  + ++
Sbjct: 230 MREDALEWILGVAAPRYDFVIFDIGVSISALSMVALDRSDQIQLVLQPAMPHVRAGRRML 289

Query: 319 DVLKKLRPADKPPYLVLNQV-KTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
           ++L  L  +     LV+N++ +T ++   ++ +    LG+  S  IP D      + + G
Sbjct: 290 EILVSLGYSSDQLRLVVNRMTRTGERTRTALEEV---LGLHASTTIPDDADTVREAIDQG 346

Query: 378 KMIHEVDPKSAIAN 391
             +  +   + +A 
Sbjct: 347 YPVSRLARTAGVAR 360


>gi|309778768|ref|ZP_07673541.1| pilus assembly protein [Ralstonia sp. 5_7_47FAA]
 gi|308922476|gb|EFP68100.1| pilus assembly protein [Ralstonia sp. 5_7_47FAA]
          Length = 447

 Score = 59.7 bits (143), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 58/261 (22%), Positives = 112/261 (42%), Gaps = 4/261 (1%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISD 220
           G  ++ +G+R GVG++T+A N A  +    A + +L DL  P     +  +        +
Sbjct: 158 GRVLAVLGARPGVGATTLATNLATLVRRTSASDVMLLDLGQPLRDGALYLNVQANFHFVE 217

Query: 221 AIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVIL 280
           A+  + R D+ FV      +   L++L  P  L+   D      + +L+ L   F L ++
Sbjct: 218 AVRNLRRFDQVFVQTALSRHPNGLAVLPLPISLADMRDISFSEALGLLNRLRTFFDLQVV 277

Query: 281 DVPHVWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVK 339
           D+    N  +  +++  +D V++ T   +  + ++  L+  LKK R  D+  +L L   K
Sbjct: 278 DLGGFGNIDFIAQIIKAADDVMLVTEQSVGAIVSAAELMQELKK-REIDR-DHLHLTISK 335

Query: 340 TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRV 399
              +  +  +     L I     +P       +++N G M+ E  P  A    L   ++ 
Sbjct: 336 FDARLSLDAAQIAERLEIPSVLTVPNRREALVIASNQGAMLAETHPTDAYVRALARIAQT 395

Query: 400 LMGRVTVSKPQSAMYTKIKKI 420
           L G    S   SA+ + +  +
Sbjct: 396 L-GYAQQSAHASALSSWVSGV 415


>gi|116671470|ref|YP_832403.1| Flp pilus assembly protein ATPase CpaE-like protein [Arthrobacter
           sp. FB24]
 gi|116611579|gb|ABK04303.1| Flp pilus assembly protein ATPase CpaE-like protein [Arthrobacter
           sp. FB24]
          Length = 399

 Score = 59.7 bits (143), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 50/246 (20%), Positives = 99/246 (40%), Gaps = 20/246 (8%)

Query: 160 SGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSIS 219
           +G  I+ +  +GGVG +T+A N A  +  +  M  ++ DLD+ +G        +P +++ 
Sbjct: 143 AGRVIAVMSPKGGVGKTTVATNLAIGLGKIAPMGVVIVDLDVQFGDVATGLQLEPEHTLR 202

Query: 220 DAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVI 279
           DA+      D   +      +   +  L AP           + +  +L+ +   F  V+
Sbjct: 203 DAVGGAAFQDSMVLKAFLTVHPSGIYALCAPNTPGEADHISGEAVSHLLNQMAAEFQYVV 262

Query: 280 LDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVK 339
           +D            L  +   V    +D+  +R      +VL++L+   +  ++VLN   
Sbjct: 263 VDTTPGLGEHVLATLEQATDAVWVCGMDIPSIRGLHTSFEVLRELQLLPQGRHVVLNFAD 322

Query: 340 TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSG-----------------KMIHE 382
             ++  +++ D  A +G+    ++P   AV   S N G                 K++  
Sbjct: 323 --RRSGLTVQDVEATIGVPVDTVVPRSRAV-PFSTNKGVPLLQDSSHDGAARAFAKLVER 379

Query: 383 VDPKSA 388
            DPK A
Sbjct: 380 FDPKRA 385


>gi|299067809|emb|CBJ39020.1| Flp pilus assembly protein, ATPase [Ralstonia solanacearum CMR15]
          Length = 397

 Score = 59.7 bits (143), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 103/238 (43%), Gaps = 3/238 (1%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSISDAI 222
           ISF+  +GG G++  A N  +++A+      LL DL+  YG A  +  D+ P  +++   
Sbjct: 134 ISFLSCKGGSGTTFTAANFGYTLAARQGKRVLLIDLNQQYGDAAFLVTDQAPPATLASVC 193

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDV 282
             + R+D A +         N  +L A     +  +     +  +L ++  ++ +VI DV
Sbjct: 194 QQIERLDPALLDACLTHVCPNFDVLPAAGDPVKAGEIKAIHLERILTLISPLYDVVIFDV 253

Query: 283 PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPK 342
               N  +  VL  S  +     L L  LR  + L+D+   L    +   LV+N+ +  K
Sbjct: 254 GQDINPASIVVLDHSTVIYPVLQLTLPHLRAGRRLLDICHSLGYHAERLRLVINRYE--K 311

Query: 343 KPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
              + +       G+  + ++P D      +++ G  + ++   S IA  L D +  L
Sbjct: 312 HTPVDLHTLENAFGMHAAHLLPNDQGPVRDASSQGVPVLQLAEHSPIARALADMASQL 369


>gi|309791478|ref|ZP_07685982.1| response regulator receiver [Oscillochloris trichoides DG6]
 gi|308226475|gb|EFO80199.1| response regulator receiver [Oscillochloris trichoides DG6]
          Length = 407

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/268 (22%), Positives = 119/268 (44%), Gaps = 11/268 (4%)

Query: 78  PDLIIVQT---KVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLI 134
           PDL I+      +D  EV   L  +         ++   DT +  + R L +    +Y+ 
Sbjct: 50  PDLFILDVMMPDIDGYEVCRRLRRMTTFAQHPILMLTANDTLEERV-RGLEAG-ADDYMS 107

Query: 135 EPLSVADIINSISAIFT----PQEEGKGS-SGCSISFIGSRGGVGSSTIAHNCAFSIASV 189
           +P    ++   + A+      P  + + +    +++F   RGGVG ST+A N A  +A +
Sbjct: 108 KPFQPIELQARVKALLRRVPLPAIQPQAAIQNETLAFFSLRGGVGVSTLATNLAVGLAQI 167

Query: 190 FAMETLLADLDLPYGTANINFDKDPINSISDAIYP-VGRIDKAFVSRLPVFYAENLSILT 248
           +     L DL    G + +  +     +  D   P +  ID   + ++ + +   + +L 
Sbjct: 168 WGQPVALVDLAFISGQSALMLNLPLRTTWGDLANPALHEIDYDLLQQVLMPHTSGVHVLA 227

Query: 249 APAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDL 308
           + A   ++     + +  VL +L Q +  V+LD+PH ++  T   L  ++ V++  + ++
Sbjct: 228 SAARPEQSELITGEKVAHVLRLLRQHYAYVVLDLPHDFSDTTLAGLDSANTVLLVLAPEI 287

Query: 309 AGLRNSKNLIDVLKKLRPADKPPYLVLN 336
           A +R +   +DV  KL  A     L+LN
Sbjct: 288 ASVRATACALDVFAKLEYAPDKLLLLLN 315


>gi|73539232|ref|YP_299599.1| pilus assembly protein [Ralstonia eutropha JMP134]
 gi|72122569|gb|AAZ64755.1| cpaE2, RSp1086; probable pilus assembly protein [Ralstonia eutropha
           JMP134]
          Length = 423

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/246 (23%), Positives = 107/246 (43%), Gaps = 21/246 (8%)

Query: 97  EPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEE- 155
           E LA+V   G  ++ +GD ++  +  A +   V +++    + AD +  +  +  P+E+ 
Sbjct: 66  EQLAQVF-PGLPLVAVGDADEPGMMLAALRMGVRDFIDLRDTPADAMAVVRRLMVPREQV 124

Query: 156 --GKGS-SGCSISFIGSRGGVGSSTIAHNCAFSI------------ASVFA---METLLA 197
              +G+  G  I+ +G+R GVG +T+A N A +             A   A    E LL 
Sbjct: 125 CRAEGTRQGKIIALLGARPGVGVTTLAVNLAATARRQLVRNQQEVRAGAHADGRAEVLLL 184

Query: 198 DLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTY 257
           DL LP     +  +  P     +A+    R D+ FV      +A    +L  P  L+   
Sbjct: 185 DLGLPARDGALYLNLSPGFHFVEAVRNQRRFDQVFVQTALSRHANGACVLPLPPSLAELR 244

Query: 258 DFDEKMIVPVLDILEQIFPLVILDVPHVWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKN 316
           D        +LD L   F L I+D+    N  +T +++  +D V++     +  + ++  
Sbjct: 245 DISYSEATALLDRLRAYFDLQIIDLGGFTNIEFTAQIVKAADTVMLVAEQSVGAIVSAAE 304

Query: 317 LIDVLK 322
           L+  LK
Sbjct: 305 LLHELK 310


>gi|258651610|ref|YP_003200766.1| hypothetical protein Namu_1375 [Nakamurella multipartita DSM 44233]
 gi|258554835|gb|ACV77777.1| hypothetical protein Namu_1375 [Nakamurella multipartita DSM 44233]
          Length = 420

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 68/268 (25%), Positives = 116/268 (43%), Gaps = 31/268 (11%)

Query: 155 EGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF---D 211
           +G  + G  ++  G  G  G +T+A N A   AS   + TLL D D+  G  +  F   D
Sbjct: 151 DGPPARGSVVAVWGPTGAPGRTTVATNLAVE-ASGLGVPTLLIDADVYGGVISSAFGLLD 209

Query: 212 KDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDIL 271
           + P  + +  +   G +D   ++ L     ++L +LT  A   R  +     I  VLD  
Sbjct: 210 ESPGLAGACRLAAAGSLDLGALAGLCWSLGDDLRLLTGIARADRWPEVRPSAIPLVLDAA 269

Query: 272 EQIFPLVILDVPHV---------------WNSWTQEVLTLSDKVVITTSLDLAGLRNSKN 316
            ++ PL I+D                    N  T  VL  +D +++  S D  GL   + 
Sbjct: 270 REMAPLTIVDCAFAVEADEELSFDTRAPRRNGATLTVLAEADVLLVVGSCDPPGL---ER 326

Query: 317 LIDVLKKLRPA--DKPPYLVLNQ----VKTPKKPEISISDFCAPLGITPSAIIPFDGAVF 370
           L+  L +LR    D  P +VLN+    V +  + + ++  F    G+  SA +P D A  
Sbjct: 327 LVRALAELREVVPDAAPRVVLNRCRPSVGSTAEAQAAVRRFT---GLDVSARLPEDRAAT 383

Query: 371 GMSANSGKMIHEVDPKSAIANLLVDFSR 398
             +   G  + +  P+SA+ + +V+ +R
Sbjct: 384 DRAWRRGVPLADAAPRSALRSAVVELAR 411


>gi|116694141|ref|YP_728352.1| flp pilus assembly ATPase [Ralstonia eutropha H16]
 gi|113528640|emb|CAJ94987.1| flp pilus assembly ATPase [Ralstonia eutropha H16]
          Length = 413

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/326 (18%), Positives = 136/326 (41%), Gaps = 16/326 (4%)

Query: 106 GTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGK----GSSG 161
           G  ++ +G  ++  +  A +   V +++    + AD    +  +  P E+ +       G
Sbjct: 74  GLPLVAVGHADEPGIMLAALRVGVKDFIDLRDAPADAEAVVKRLAVPGEQVRQAESARQG 133

Query: 162 CSISFIGSRGGVGSSTIAHNCAFSIASVFAM--------ETLLADLDLPYGTANINFDKD 213
             ++ +G+R GVG +++A N A +      +        E LL DL LP     +  +  
Sbjct: 134 KIVALLGARPGVGVTSLAVNLAAAARRHLPLNEKTDARAEVLLLDLGLPARDGALYLNLS 193

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
           P     +A+  + R D+ FV      +   + +L  PA L    D      + +L+ L  
Sbjct: 194 PGFHFVEAVRNLRRFDQVFVQTALTRHGNGVCVLPLPAALGELRDISYSEAISLLERLRA 253

Query: 274 IFPLVILDVPHVWNS-WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY 332
            F + I+D+    N+ +T +++  +D VV+     +  + ++  L+  L+         +
Sbjct: 254 FFDMQIIDLGGFGNAEFTAQIVKAADSVVLVADQSVGAIVSAAELVHELRAREVERDDLH 313

Query: 333 LVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANL 392
           L++++     +  +  +     +G+     +P   A   ++ N G ++ + DP       
Sbjct: 314 LLVSRFDA--RLGVDAAQIAHRVGVQSVGTLPDSRAPLVLAMNRGAVLADDDPHDPYVRA 371

Query: 393 LVDFSRVLMGRVTVSKPQSAMYTKIK 418
           L D    L  R   ++ ++++  ++K
Sbjct: 372 LADLLARLGYRAAQAR-ETSLLARMK 396


>gi|126725972|ref|ZP_01741814.1| ATPase, putative [Rhodobacterales bacterium HTCC2150]
 gi|126705176|gb|EBA04267.1| ATPase, putative [Rhodobacterales bacterium HTCC2150]
          Length = 415

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 90/194 (46%), Gaps = 7/194 (3%)

Query: 158 GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAME---TLLADLDLPYGTANINFDKDP 214
             +G   +  G  GG G++T A N A  +A++           DLD  +G+A    D   
Sbjct: 158 AKNGSVFAIQGLCGGAGATTFAVNLAHELATLDKKNPKTVCFLDLDFQFGSAATYLDLPR 217

Query: 215 INSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI 274
            +++ + +     +D+   S+  V ++EN+ +LTAPA +          I  V+D     
Sbjct: 218 KDAVLEMLTNAEDLDEDVFSQALVGFSENMHVLTAPADVLPLDIVGPDEIRSVIDNARTK 277

Query: 275 FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK-KLRPADKPPYL 333
           F  V++D+P     WT+ V+  +D       +D+   +N+  L+  LK +  P +K  Y 
Sbjct: 278 FDFVVVDMPKTLVQWTETVMDRADVHFALMEMDMRSAQNALRLVRALKAEDLPFEKIKY- 336

Query: 334 VLNQVKTPKKPEIS 347
           VLN  + PK  ++S
Sbjct: 337 VLN--RAPKFTDLS 348


>gi|149915640|ref|ZP_01904166.1| ATPase, putative [Roseobacter sp. AzwK-3b]
 gi|149810532|gb|EDM70375.1| ATPase, putative [Roseobacter sp. AzwK-3b]
          Length = 406

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 120/295 (40%), Gaps = 24/295 (8%)

Query: 105 SGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEE------GKG 158
            G KVI+I +    +    L+     E++  PL   ++  +I  +    E       G+ 
Sbjct: 82  KGIKVILIAEDVSPAALHQLLRKGADEFVPYPLPEGELEAAIDRLKRMAERPAAAVAGRH 141

Query: 159 SSGCS-------ISFIGSRGGVGSSTIAHNCAFSIASVFAME---TLLADLDLPYGTANI 208
           + G         ++  G  GG G++T+A N A+ +A+V   +     + D  L  GT   
Sbjct: 142 APGFEAPADGVLLAVQGLAGGTGATTLAVNLAWELATVDKKDPPRVCILDFGLQSGTVAT 201

Query: 209 NFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVL 268
             D     ++ +       +D     +    + E LS+LTAP  +          +  +L
Sbjct: 202 YLDLPRRETVFEMWSDTEAVDDDVFRQALTQFEEKLSVLTAPPDILPLDMLTPDDVQRIL 261

Query: 269 DILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPAD 328
           D   + F  V++D+P     WT+ VLT +     T  LD   +R+++N I + + LR  +
Sbjct: 262 DQARRRFDYVVVDMPSTLVQWTETVLTNAQIYFTTLELD---MRSAQNAIRLKRALRAEE 318

Query: 329 KP-PYLVLNQVKTPKKPEIS----ISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
            P   L     + PK  ++     +   C  L I+   ++P  G     + + G+
Sbjct: 319 LPIERLRFCLNRAPKFTDLQGKSRVKRLCESLEISIEVLLPDGGRPVTQAGDHGQ 373


>gi|107022595|ref|YP_620922.1| response regulator receiver protein [Burkholderia cenocepacia AU
           1054]
 gi|116689544|ref|YP_835167.1| response regulator receiver protein [Burkholderia cenocepacia
           HI2424]
 gi|170732848|ref|YP_001764795.1| response regulator receiver protein [Burkholderia cenocepacia
           MC0-3]
 gi|105892784|gb|ABF75949.1| response regulator receiver protein [Burkholderia cenocepacia AU
           1054]
 gi|116647633|gb|ABK08274.1| response regulator receiver protein [Burkholderia cenocepacia
           HI2424]
 gi|169816090|gb|ACA90673.1| response regulator receiver protein [Burkholderia cenocepacia
           MC0-3]
          Length = 412

 Score = 58.9 bits (141), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 104/241 (43%), Gaps = 28/241 (11%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA---SVFAMETLLADLDLPYGTANINFDKDPINS 217
           G   + +G+R G+G ST+A N +  +    +  A    L DL LP G   +  +      
Sbjct: 141 GKVTALLGARAGMGVSTLAANLSVLMQRRPADPARTAALLDLGLPAGDGALFLNTRCEFH 200

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
             +A+  + RID+ FV+     ++  +++ T P  L+   D        +L+ L   F  
Sbjct: 201 FVEAVRNLRRIDRTFVTTALARHSSGVALTTLPPNLAELRDVATASCAALLNRLRAFFDH 260

Query: 278 VILDVPHVWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            I+D+    N  +  +V+ L+D+  +     +A + ++  ++D L++   A     LV+N
Sbjct: 261 QIVDLGGFPNREFIAQVVNLADEAWLVCDQGVASVVSAVEMLDGLREAGAATDRIRLVVN 320

Query: 337 QVKTPKKPEISISDFCAPLGITPS-----------AIIPFDGAVFGMSANSGKMIHEVDP 385
           Q             F A LG+ P+           A +P      G +AN GK+I EV  
Sbjct: 321 Q-------------FDAELGLMPAQIAERLDLSLLATLPSRRVSIGHAANQGKLIAEVAE 367

Query: 386 K 386
           +
Sbjct: 368 R 368


>gi|167719682|ref|ZP_02402918.1| putative CpaE protein [Burkholderia pseudomallei DM98]
          Length = 151

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 62/111 (55%), Gaps = 5/111 (4%)

Query: 59  RITRGSIAEAVSCFSD-SSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTND 117
           ++ RG I +A++   D S  P  ++V     +   LS L  LA+VCD    VIVIG+ ND
Sbjct: 45  QVARGGIDDAIALMRDLSHGPQHLLVDVS-GAAMPLSDLARLADVCDPSVNVIVIGERND 103

Query: 118 VSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIG 168
           V L+R+++   V +YL++PL+V  +  ++SA           +G +I F+G
Sbjct: 104 VGLFRSMLRIGVRDYLVKPLTVELVHRALSAADPNAAA---RAGKAIGFVG 151


>gi|126653727|ref|ZP_01725645.1| hypothetical protein BB14905_20993 [Bacillus sp. B14905]
 gi|126589691|gb|EAZ83827.1| hypothetical protein BB14905_20993 [Bacillus sp. B14905]
          Length = 291

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/207 (19%), Positives = 103/207 (49%), Gaps = 19/207 (9%)

Query: 157 KGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPIN 216
           +G  G +I+ +  +GGVG S    N A S+A     + ++ D+D+  G  +I   K+  N
Sbjct: 16  QGDLGRAIAVVSGKGGVGKSNFTMNFALSLAQK-GKKVVIVDMDIGMGNIHILIGKNASN 74

Query: 217 SISDAIYPVGRIDKAFVSRLPVFYA-ENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI- 274
           S+ D +     +D+       +F     L  ++  + ++  +++ E M   ++   EQ+ 
Sbjct: 75  SLKDYLEGNKLLDEV------IFEGPHGLRYISGGSGMTNIFNWSEMMFEQLIHAFEQLQ 128

Query: 275 --FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY 332
             +  ++ D+     +W+ ++LT  D++++ ++ +   + ++ +++  +  +R ADK  Y
Sbjct: 129 KNYDYILFDMGAGATNWSLDLLTSVDEIIVISTAEPTAITDAYSMMKYI-HMRDADKQFY 187

Query: 333 LVLNQ-------VKTPKKPEISISDFC 352
           ++ N+       ++T ++ ++++  F 
Sbjct: 188 VLCNRAFSKEEGIETNERLKLAMKRFL 214


>gi|170692562|ref|ZP_02883724.1| response regulator receiver protein [Burkholderia graminis C4D1M]
 gi|170142218|gb|EDT10384.1| response regulator receiver protein [Burkholderia graminis C4D1M]
          Length = 403

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 70/333 (21%), Positives = 141/333 (42%), Gaps = 4/333 (1%)

Query: 79  DLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLS 138
           D++I+      R  L ++  L       T ++++  T+  +L  A+ +  + + L  PL 
Sbjct: 50  DVLIIDASSPERAGLDSVNALVHRYPRLTCLLLLPQTSPDTLIAAMRAG-IRDVLNWPLD 108

Query: 139 VADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLAD 198
              +  ++     P           +SFI  +GG G+S IA N   +IA++     LL D
Sbjct: 109 ARALGAAVQRAMAPHAGDARHETHMVSFISCKGGAGTSLIAANVGHAIATLHGKRVLLVD 168

Query: 199 LDLPYGTAN-INFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTY 257
           L+  +  A  +  D++P +++      + RID AF+            +L       +  
Sbjct: 169 LNPMFADAAFLVSDQEPPSTLPQMCAQIERIDAAFLDASLTHVTPGFHVLAGAGDPLKAL 228

Query: 258 DFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNL 317
           +  E+ +  +L +    + +V+ D+    N+ +   L  S ++ +     +  +R ++ L
Sbjct: 229 EIHEEQLEWILGVAAPRYDVVLFDLGQSINALSIVALDRSAEIHMVLQASMPYVRAARRL 288

Query: 318 IDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
            D+L  L  A  P  L L   +  +  E + S     LG  PS +I  D      + N G
Sbjct: 289 QDMLVSL--AYSPERLRLLLNRHRRHDERAASALEQVLGKRPSHVIADDPHAASEAVNLG 346

Query: 378 KMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQ 410
           + + +V   SA++  +   ++ ++ + T   PQ
Sbjct: 347 EPLLKVARNSALSRGVQALAQSIVNQSTGVVPQ 379


>gi|46580526|ref|YP_011334.1| response regulator [Desulfovibrio vulgaris str. Hildenborough]
 gi|120602157|ref|YP_966557.1| response regulator receiver protein [Desulfovibrio vulgaris DP4]
 gi|46449945|gb|AAS96594.1| response regulator [Desulfovibrio vulgaris str. Hildenborough]
 gi|120562386|gb|ABM28130.1| response regulator receiver protein [Desulfovibrio vulgaris DP4]
 gi|311234265|gb|ADP87119.1| response regulator receiver protein [Desulfovibrio vulgaris RCH1]
          Length = 404

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/231 (19%), Positives = 97/231 (41%), Gaps = 17/231 (7%)

Query: 107 TKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIF-----------TPQEE 155
           T++ V     D  L    +    +E++ +PL   D+  ++                  EE
Sbjct: 68  TEIFVTARKKDPDLIIEAMRAGATEFMAQPLRPEDMSAALEGYLMRCRTREAHPVATSEE 127

Query: 156 GKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPI 215
           G    G  +  + ++GGVG +T+A   +  + +    ET+L D+ LP G   +  D    
Sbjct: 128 G----GRIVHVVSAKGGVGGTTVA--ASLGVLAAQRGETVLMDMRLPQGDVPLFLDLAYT 181

Query: 216 NSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIF 275
           ++ + A+  + R+D  F+  L   ++  L +L +P             +  +L ++   F
Sbjct: 182 HTWASAMRDLARLDATFLRSLVERHSSGLHVLPSPDRQDGLESLSALGVKAMLGLMRATF 241

Query: 276 PLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRP 326
           P  I+D     +      +  ++ +++ T L L  L  ++ ++D +++  P
Sbjct: 242 PTTIVDGGPFSDELALASMQQAESILLVTELALPSLSGARRILDDIRQHAP 292


>gi|126729096|ref|ZP_01744910.1| ATPase, putative [Sagittula stellata E-37]
 gi|126710086|gb|EBA09138.1| ATPase, putative [Sagittula stellata E-37]
          Length = 415

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/244 (22%), Positives = 109/244 (44%), Gaps = 23/244 (9%)

Query: 106 GTKVIVIG-DTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEE--------- 155
           G KVI+I  D    SL++ L+ +   E++  PL   ++  ++  +  P+ E         
Sbjct: 90  GIKVILIAEDVTPASLHQ-LLRSGADEFIPYPLPEGELAEAVERLRAPEPEPAPPQEASA 148

Query: 156 ------GKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFA---METLLADLDLPYGTA 206
                   G  G  I+  G  GG G++T+A N A+ + +V      +  L D  L +G+ 
Sbjct: 149 PAKVKLSGGGDGVLIAVQGLSGGCGATTLAVNLAYELTAVGGDKPPKVCLIDFGLQFGSV 208

Query: 207 NINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVP 266
               D     ++ + +  +  +D   +++  V + + L + T+PA +          +  
Sbjct: 209 ATYLDLPRREAVFETLSDIESMDGESLAQALVSFEDKLQVFTSPADILPLDLIGPSDVSK 268

Query: 267 VLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRP 326
           +LDI    F  V++D+P     WT+ VLT +   +    LD   +R+++N + + + L+ 
Sbjct: 269 LLDIARDHFDYVVVDMPGTLVQWTETVLTEAQIYIALVELD---MRSAQNTLRLKRMLQS 325

Query: 327 ADKP 330
            D P
Sbjct: 326 EDLP 329


>gi|206559895|ref|YP_002230659.1| flp pilus type assembly-related protein [Burkholderia cenocepacia
           J2315]
 gi|198035936|emb|CAR51828.1| flp pilus type assembly-related protein [Burkholderia cenocepacia
           J2315]
          Length = 412

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 104/241 (43%), Gaps = 28/241 (11%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA---SVFAMETLLADLDLPYGTANINFDKDPINS 217
           G   + +G+R G+G ST+A N +  +    +  A    L DL LP G   +  +      
Sbjct: 141 GKVTALLGARAGMGVSTLAANLSVLMQRRPADPARTAALLDLGLPAGDGALFLNTRCEFH 200

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
             +A+  + RID+ FV+     ++  +++ T P  L+   D        +L+ L   F  
Sbjct: 201 FVEAVRNLRRIDRTFVTTALARHSSGVALTTLPPNLAELRDVATASCAALLNRLRAFFDH 260

Query: 278 VILDVPHVWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            I+D+    N  +  +V+ L+D+  +     +A + ++  ++D L++   A     LV+N
Sbjct: 261 QIVDLGGFPNREFIAQVVNLADEAWLVCDQGVASVVSAVEMLDGLREAGAATDRIRLVVN 320

Query: 337 QVKTPKKPEISISDFCAPLGITPS-----------AIIPFDGAVFGMSANSGKMIHEVDP 385
           Q             F A LG+ P+           A +P      G +AN GK+I EV  
Sbjct: 321 Q-------------FDAELGLLPAQIAERLELSLLATLPSRRVSIGHAANQGKLIAEVAE 367

Query: 386 K 386
           +
Sbjct: 368 R 368


>gi|294676061|ref|YP_003576676.1| PP-loop family ATPase [Rhodobacter capsulatus SB 1003]
 gi|294474881|gb|ADE84269.1| ATPase, PP-loop family [Rhodobacter capsulatus SB 1003]
          Length = 421

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 92/199 (46%), Gaps = 12/199 (6%)

Query: 158 GSSGCSISFIGSRGGVGSSTIAHNCAFSIAS--------VFAMETLLADLDLPYGTANIN 209
           G  G  +   G  GGVG++T A N A+ +A+        V      L D DL +GTA+  
Sbjct: 157 GRDGVVLPVHGLSGGVGATTFAVNLAWELATPETSKKAPVPPPRVCLLDFDLQFGTASTY 216

Query: 210 FDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLD 269
            D    + + + +     +D    ++  + + + L +LTAP+ +        + I  +++
Sbjct: 217 LDLPRRDLVFEMLQDTAHLDAESFNQALLTFNDRLHVLTAPSEMLPLDIVTAEDISRIIE 276

Query: 270 ILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR-PAD 328
           +    F  V++D+P    SWT+ VL+ +        LD+   +N+  +I  LK    P +
Sbjct: 277 MARSNFDFVVIDMPTTVVSWTETVLSQAHLYFALIELDMRSAQNTLRMIRALKAENLPVE 336

Query: 329 KPPYLVLNQVKTPKKPEIS 347
           K  + VLN  + PK  ++S
Sbjct: 337 KLRF-VLN--RAPKFTDLS 352


>gi|332798622|ref|YP_004460121.1| response regulator receiver protein [Tepidanaerobacter sp. Re1]
 gi|332696357|gb|AEE90814.1| response regulator receiver protein [Tepidanaerobacter sp. Re1]
          Length = 393

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/293 (21%), Positives = 118/293 (40%), Gaps = 14/293 (4%)

Query: 110 IVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQ-------EEGKGSSGC 162
           +V+   ND+   + +I   V   L   +  A +I+ +  IFT +       E    S   
Sbjct: 76  VVLTQENDLDALQKIIETGVHYILPAQMEPAALISELKGIFTNEVNRILSLENSSASPSK 135

Query: 163 S--ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISD 220
           S  +   G++GG+G ST+A N A  +A       ++ D    +G           ++IS+
Sbjct: 136 SKVVLVFGTKGGIGKSTVAVNLAVKLAQ-RQNRVVILDYSFQFGCVGTMLGLSNRSTISE 194

Query: 221 AIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVIL 280
            +      +     +    ++  +S L AP           +    ++ +L   +  +I+
Sbjct: 195 LVQEQVSPNADLTRQFLALHSSGVSALLAPNSPEDGAAITARQAEQIISVLRVYYDYIII 254

Query: 281 DVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKT 340
           D   V N  T   L  +  +V  T  D+A LRN+K  + +++ L  ++K   +V + +  
Sbjct: 255 DSAPVLNDITTVCLDCASVIVFITKCDIASLRNAKKGLAIVEALADSEKIKLVVCDDLNG 314

Query: 341 PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
               +I  SD    L      +IP D      + N GK + E  P S ++  L
Sbjct: 315 ----QIRESDIARVLSRPIWQVIPHDYRAATEAVNLGKPVVESYPMSKLSKGL 363


>gi|52081281|ref|YP_080072.1| ATPase activator of MinC [Bacillus licheniformis ATCC 14580]
 gi|52786660|ref|YP_092489.1| hypothetical protein BLi02928 [Bacillus licheniformis ATCC 14580]
 gi|319644753|ref|ZP_07998986.1| MinD protein [Bacillus sp. BT1B_CT2]
 gi|52004492|gb|AAU24434.1| ATPase activator of MinC [Bacillus licheniformis ATCC 14580]
 gi|52349162|gb|AAU41796.1| MinD [Bacillus licheniformis ATCC 14580]
 gi|317392562|gb|EFV73356.1| MinD protein [Bacillus sp. BT1B_CT2]
          Length = 268

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/276 (21%), Positives = 126/276 (45%), Gaps = 20/276 (7%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN----FDKDPIN 216
           G +I     +GGVG +T + N   ++A +      L D D+  G  N++     +   I 
Sbjct: 2   GEAIVITSGKGGVGKTTTSANLGTALA-ILGKRVCLVDTDI--GLRNLDVVMGLENRIIY 58

Query: 217 SISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFP 276
            + D +    +I +A V      + + L +L A     ++    E+M V ++  L+Q F 
Sbjct: 59  DLVDVVEERCKIHQALVK--DKRFDDLLYLLPAAQTSDKSAVLPEQM-VKLIQQLKQDFD 115

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            +++D P       +  ++ +DK ++ T+ +++ +R++  +I +L+K    + PP LV+N
Sbjct: 116 YIVIDCPAGIEQGYKNAVSGADKAIVVTTPEISAVRDADRIIGLLEKEENIE-PPRLVVN 174

Query: 337 QVKT---PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
           +++         + + +    L I    I+  D  V   S N   ++ + + K++IA   
Sbjct: 175 RIRNHLMKNGDTLDVDEVIQHLSIELIGIVADDDEVIKASNNGEPVVMDPNNKASIA--Y 232

Query: 394 VDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMKC 425
            + +R ++G      +  +    ++ KIK  F ++ 
Sbjct: 233 RNIARRVLGESVPLQSFEEENKGVFAKIKSFFGVRA 268


>gi|163849322|ref|YP_001637366.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222527316|ref|YP_002571787.1| response regulator receiver protein [Chloroflexus sp. Y-400-fl]
 gi|163670611|gb|ABY36977.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222451195|gb|ACM55461.1| response regulator receiver protein [Chloroflexus sp. Y-400-fl]
          Length = 390

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/238 (21%), Positives = 105/238 (44%), Gaps = 14/238 (5%)

Query: 109 VIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIF---------TPQEEGKGS 159
           ++++    D+S   A      ++YL +P    +++  +  I          TP + GK  
Sbjct: 80  ILMLTAQGDISAKIAGFEAGANDYLAKPFEPQELVYRVKNILARTTIETPTTPVQRGK-- 137

Query: 160 SGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSIS 219
               I+  G++GGVG +TIA + A ++        ++ D DL +G   ++ +  P  SI 
Sbjct: 138 ---VITVFGAKGGVGKTTIAVSVALALRLRSRRRVVIVDADLTFGDVAVHLNIAPTRSII 194

Query: 220 DAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVI 279
           D +     I++  V ++ + +   L  L AP           + +  +LD+L      V+
Sbjct: 195 DIVRSGDEIEQEMVKQVLLSHPSGLQALLAPPRPEEAELVSAEHMTRILDLLAVNADYVV 254

Query: 280 LDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQ 337
           +D    ++  T  V   +D V++  + ++  L+N+   + +  +L    +   +VLN+
Sbjct: 255 VDCQTSYDDRTLSVFDRTDHVLLVITPEIGPLKNTSLFLSLANQLGIDPRAISIVLNR 312


>gi|84685159|ref|ZP_01013058.1| ATPase, putative [Maritimibacter alkaliphilus HTCC2654]
 gi|84666891|gb|EAQ13362.1| ATPase, putative [Rhodobacterales bacterium HTCC2654]
          Length = 416

 Score = 57.8 bits (138), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 123/296 (41%), Gaps = 18/296 (6%)

Query: 111 VIGDTNDVSLYRALISNHVSEYLIEPLS----VADIINSISAIFTPQEEGKGSS--GCSI 164
           V G+   ++  R L+   V+E +  PLS     AD   S+ A+ T  E   G +     +
Sbjct: 107 VTGEALTLATARTLMEAGVAEVI--PLSNTQPQADHAASLGALTTQAETTGGETRDAMVL 164

Query: 165 SFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTANINFDKDPINSI 218
           +  G+ GGVG++T A N A  +A              + DLD   G    + D     + 
Sbjct: 165 AVCGAAGGVGTTTFALNLATLLARPDKTSKGEPARVAVVDLDFQNGVLGASIDLTDGGAY 224

Query: 219 SDAIYPVGRIDKAFVSRLPVFYA-ENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
            + +      +++F+ R    YA     ++ AP  L+        M+  ++D L   +  
Sbjct: 225 LEMLQGQANPNQSFLKRALESYAPGGFDVMAAPVTLAPLDAMTPDMVAWLIDELRLAYDY 284

Query: 278 VILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQ 337
           V+LD+P V   W   VL  +D+  I     +  +R  + +ID+      A  P  +V+++
Sbjct: 285 VVLDLPRVVVDWIDAVLARADRFFILGDTSVHTVRQIRRMIDLYTDDHAA-LPVQVVVSK 343

Query: 338 VKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
            K P    +  ++    LG T +  +P D      +   G+ +    PK+ ++  +
Sbjct: 344 EKKPGAAHVKEAEHF--LGQTLATWLPRDDKTAARARAHGQPMALSGPKAPVSRAM 397


>gi|297568752|ref|YP_003690096.1| response regulator receiver protein [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296924667|gb|ADH85477.1| response regulator receiver protein [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 403

 Score = 57.8 bits (138), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 84/363 (23%), Positives = 145/363 (39%), Gaps = 50/363 (13%)

Query: 67  EAVSCFSDSSTPDLIIVQ---TKVDSR----EVLSALEPLAEVCDSGTKVIVIGDTNDVS 119
           E +    D++   +I VQ    ++ S     E L AL+P       G  V+ I    D +
Sbjct: 41  ERIGLLVDAAKATVIFVQLEEGEIHSHTSLIEGLLALKP-------GLSVVAISTDVDQT 93

Query: 120 LYRALISNHVSEYLI---EPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSS 176
           L  A +     +YL    +P  V ++++ +      ++     S  + SFI +R   G +
Sbjct: 94  LLLAAMRAGARDYLRVGSDPREVVNLVHHLEETTPARQAATPESSRTYSFISARPYEGVT 153

Query: 177 TIAHNCAFSIASVFAMETLLADLDLPYGTANIN--------------FDKDPINSISDAI 222
           T+A +CA            LA L  P G   +                   P  S  DAI
Sbjct: 154 TLAVHCA------------LAMLTRPPGDGRVLLLDLGLPPGDTQLALGLQPTYSFLDAI 201

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDV 282
             V R D+  +    + +   L+ L  P  L    +     ++ +L++L   F  +++ +
Sbjct: 202 RSVRRFDQTLIQTAFIRHDSGLTTLALPEDLKGMAEVTAADVMILLNVLRSYFSRIVVHL 261

Query: 283 PHVW-NSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTP 341
             V    + + +L  SD  ++     L   R+S+ L   L KL   D P    +  V   
Sbjct: 262 GGVEPTDFVRLILAKSDLALLMVEQSLPHCRSSQQL---LAKLANHDYPVN-SMGMVVDR 317

Query: 342 KKPEI--SISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRV 399
             P++  S SD    L +T    +P  G V   + NSG+ I E+ P++  A  + +F+  
Sbjct: 318 YSPDVGLSASDISEALELTLFHRLPPSGLVRMQALNSGQSIFELAPRNGYAKAVHEFTDK 377

Query: 400 LMG 402
           L+G
Sbjct: 378 LIG 380


>gi|319940442|ref|ZP_08014787.1| hypothetical protein HMPREF9464_00006 [Sutterella wadsworthensis
           3_1_45B]
 gi|319806068|gb|EFW02817.1| hypothetical protein HMPREF9464_00006 [Sutterella wadsworthensis
           3_1_45B]
          Length = 427

 Score = 57.8 bits (138), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 94/400 (23%), Positives = 168/400 (42%), Gaps = 22/400 (5%)

Query: 14  ENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFS 73
           ENE+N      S+  I+  VFC    L    +   +  R+ +      +G + EA +  +
Sbjct: 4   ENENN-----ASVEGITTAVFCREGDLKQFTD---VFARLGRSCTAAQKGGMDEAQAWLT 55

Query: 74  DSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYL 133
               P L+IV        V  AL  LA +   G +++ +G   +V LYR+L+S    +YL
Sbjct: 56  QHDAPGLLIVDISASPFPV-PALADLAALAGPGCRIVAVGAEENVELYRSLLSAGAFDYL 114

Query: 134 IEPLSVADIINSISAIFTPQEEGKGSS-----GCSISFIGSRGGVGSSTIAHNCAFSIAS 188
           + P++ A ++  ++   + +  G   +     G +I+  G+ GG G+ST+A      IA 
Sbjct: 115 VSPVADALVVELLNRADSDRWLGMPDASSVRVGQTIAVTGAAGGAGTSTVAALLGRWIAE 174

Query: 189 VFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILT 248
                TLL D D   G   +       N ++  I     ID   ++R  +   E   +  
Sbjct: 175 AAKYPTLLVDFDRRKGDLALLLGLKADNGLA-GILSAAEIDYRLIARTVLADGEKKRLSL 233

Query: 249 APAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDL 308
                      D ++++ +   L ++F + I D+P    + + E+L  +D  VI     +
Sbjct: 234 LAQRPGPETPVDPQLLLQLGGALCELFSVSIWDIPSHRPAGSAEILKNADVCVILIDYTV 293

Query: 309 AGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTP----KKPEISISDFCAPLGITPSAIIP 364
           +  R +K L+  L   +P  +  +LV N  +       KP ++  +F   LG+     +P
Sbjct: 294 SNARAAKILLAELGAPQPGQR-RFLVANACRAGAGKRSKPVLTREEFENFLGVKVDFELP 352

Query: 365 FDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRV 404
             G V   S   G +  +  P  A A  +   +  L+GR 
Sbjct: 353 NAGTVLDASLLHGALTSQAAP--AFARSIEALACGLLGRA 390


>gi|307726377|ref|YP_003909590.1| response regulator receiver protein [Burkholderia sp. CCGE1003]
 gi|307586902|gb|ADN60299.1| response regulator receiver protein [Burkholderia sp. CCGE1003]
          Length = 403

 Score = 57.8 bits (138), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 67/314 (21%), Positives = 132/314 (42%), Gaps = 4/314 (1%)

Query: 79  DLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLS 138
           D++I+      R  L ++  L       T ++++  T+  +L  A+ +  + + L  PL 
Sbjct: 50  DVLIIDAASPERAELDSVNVLVHRYPRLTCLLLLPQTSPDTLIAAMRAG-IRDVLNWPLD 108

Query: 139 VADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLAD 198
              + +++     P           +SFI  +GG G+S IA N   +IA++     LL D
Sbjct: 109 ARALGDAVQRAMAPHAADARHETHMVSFISCKGGAGTSLIAANVGHAIATLHGKRVLLVD 168

Query: 199 LDLPYGTAN-INFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTY 257
           L+  +  A  +  D++P +++      + R+D AF+            +L       +  
Sbjct: 169 LNQMFADAAFLVSDQEPPSTLPQMCAQIERMDAAFLDASLTHVTPGFHVLAGAGDPIKAL 228

Query: 258 DFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNL 317
           D  E+ +  +L +    + +V+ D+    N+ +   L  S ++ +     +  +R ++ L
Sbjct: 229 DIREEQLEWILGVAAPRYDVVLFDLGQSINALSIVALDRSAEIHMVLQASMPYVRAARRL 288

Query: 318 IDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
            ++L  L  A  P  L L   +  +  E + S     LG  PS +I  D      + N G
Sbjct: 289 QEMLVSL--AYSPERLRLLLNRHRRHDERAASALEQVLGKRPSHVIADDPQAASEAVNLG 346

Query: 378 KMIHEVDPKSAIAN 391
             + +V   SA+A 
Sbjct: 347 DPVLKVARSSALAR 360


>gi|167836792|ref|ZP_02463675.1| hypothetical protein Bpse38_09915 [Burkholderia thailandensis
           MSMB43]
          Length = 367

 Score = 57.8 bits (138), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 121/294 (41%), Gaps = 13/294 (4%)

Query: 101 EVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSS 160
            V   G  V+ +G   +     A +   V +++       D +     +     +     
Sbjct: 4   RVSHPGLPVVALGSLGEPESALAALRAGVRDFIDFSAPAEDALRITRGLLDHVGDQPSRH 63

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSI---ASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  I+ +G+R G+G+ST+A N +  +   ++    +T L DL LP G   +  +      
Sbjct: 64  GRLIALLGARAGMGASTLAANLSVLVQKRSAALGRQTALVDLGLPAGDGALFLNTRCEFD 123

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
             +A+  + R D+ FV+     +A  +++ + P  L+   D      V +L+ L   F  
Sbjct: 124 FVEAVRNLRRFDRTFVNTALARHASGVALTSLPPNLAGLRDVSYASCVGLLNRLRAFFDC 183

Query: 278 VILDVPHVWNS-WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            I+D+    N  +  +    +D+  +     +A + ++  L++ L+          LV+N
Sbjct: 184 QIVDLGGFSNRDFVAQTANAADESWLLCDQGVASVVSAAELLESLRDAGVDTDNVRLVVN 243

Query: 337 QVKTPKKPEISI--SDFCAPLGITPSAIIPFDGAVFGMSANSGKMI---HEVDP 385
           Q      P + +  +     LG+  +A +P      G +AN GK+I    E DP
Sbjct: 244 QY----DPALGLAPAQIAERLGLALAATLPSRRVPIGHAANQGKLIVDAAERDP 293


>gi|221067367|ref|ZP_03543472.1| response regulator receiver protein [Comamonas testosteroni KF-1]
 gi|220712390|gb|EED67758.1| response regulator receiver protein [Comamonas testosteroni KF-1]
          Length = 386

 Score = 57.4 bits (137), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/232 (20%), Positives = 108/232 (46%), Gaps = 7/232 (3%)

Query: 129 VSEYLIEPLSVADIINSISAIFTPQEEGKG--SSGCSISFIGSRGGVGSSTIAHNCAFSI 186
           V E L  P     +++++  I   ++        G  ++ +  +GG G++ ++ N  + +
Sbjct: 96  VREVLTSPAPHQALLDAVHRIAAKRQHHTADRHQGQIMALLPCKGGSGATFLSTNLGWML 155

Query: 187 ASVFAMETLLADLDLPYG-TANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLS 245
           A   ++  LL DL+L +G T     +  P ++++D    + R+D +F++   V     L 
Sbjct: 156 ARKHSV--LLIDLNLQFGDTLAYLHEAKPASTLADVARDIHRLDASFLTASTVKITTQLH 213

Query: 246 ILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTS 305
           +L AP       + +   +  +L +    +  V++D+  V +     VL  +  +V    
Sbjct: 214 VLAAPENAMHAMEVEPLHVDAILQLAAAHYDFVLIDMGRVLDPLALRVLDRAQLIVPVLL 273

Query: 306 LDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGI 357
            ++  +RN++ L+ + ++L   +   + VLN+V   ++ EI + +    LG+
Sbjct: 274 PNVPAVRNAQKLLHMFRELGYPESSLHPVLNRVD--RRSEIGLPEVRKALGL 323


>gi|323529411|ref|YP_004231563.1| response regulator receiver protein [Burkholderia sp. CCGE1001]
 gi|323386413|gb|ADX58503.1| response regulator receiver protein [Burkholderia sp. CCGE1001]
          Length = 403

 Score = 57.4 bits (137), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 69/333 (20%), Positives = 142/333 (42%), Gaps = 4/333 (1%)

Query: 79  DLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLS 138
           D++I+      R  L ++  L       T ++++  T+  +L  A+ +  + + L  PL 
Sbjct: 50  DVLIIDASSPERAELDSVNVLVHRYPRLTCLLLLPQTSPDTLIAAMRAG-IRDVLNWPLD 108

Query: 139 VADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLAD 198
              + +++     P           +SFI  +GG G+S IA N   +IA++     LL D
Sbjct: 109 ARALGDAVQRAMAPHAGDARHETHMVSFISCKGGAGTSLIAANVGHAIATLHNKRVLLVD 168

Query: 199 LDLPYGTAN-INFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTY 257
           L+  +  A  +  D++P +++      + RID AF+            +L       +  
Sbjct: 169 LNQMFADAAFLVSDQEPPSTLPQMCAQIERIDAAFLEASLTHVTPGFHVLAGAGDPLKAL 228

Query: 258 DFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNL 317
           +  E+ +  +L +    + +V+ D+    N+ +   L  S ++ +     +  +R ++ L
Sbjct: 229 EIHEEQLEWILGVAAPRYDVVLFDLGQSINALSIVALDRSAEIHMVLQASMPYVRAARRL 288

Query: 318 IDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
            ++L  L  A  P  L L   +  +  E + S     LG  PS +I  D      + N G
Sbjct: 289 QEMLVAL--AYSPERLRLLLNRHRRHDERAASALEQVLGKRPSHVIADDPQAASEAVNLG 346

Query: 378 KMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQ 410
           + + +V   SA++  +   ++ ++ + T   PQ
Sbjct: 347 EPLLKVARNSALSRGVQALAQSIVNQSTGVVPQ 379


>gi|53719508|ref|YP_108494.1| putative fimbriae assembly protein [Burkholderia pseudomallei
           K96243]
 gi|53723519|ref|YP_102953.1| hypothetical protein BMA1289 [Burkholderia mallei ATCC 23344]
 gi|76812198|ref|YP_333342.1| putative fimbriae assembly protein [Burkholderia pseudomallei
           1710b]
 gi|121599691|ref|YP_993097.1| hypothetical protein BMASAVP1_A1777 [Burkholderia mallei SAVP1]
 gi|126451407|ref|YP_001080602.1| hypothetical protein BMA10247_1047 [Burkholderia mallei NCTC 10247]
 gi|126453930|ref|YP_001066059.1| hypothetical protein BURPS1106A_1790 [Burkholderia pseudomallei
           1106a]
 gi|134282386|ref|ZP_01769091.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|167719787|ref|ZP_02403023.1| hypothetical protein BpseD_12275 [Burkholderia pseudomallei DM98]
 gi|167816008|ref|ZP_02447688.1| hypothetical protein Bpse9_12762 [Burkholderia pseudomallei 91]
 gi|167845915|ref|ZP_02471423.1| hypothetical protein BpseB_11550 [Burkholderia pseudomallei B7210]
 gi|167894491|ref|ZP_02481893.1| hypothetical protein Bpse7_12139 [Burkholderia pseudomallei 7894]
 gi|237812068|ref|YP_002896519.1| response regulator receiver protein [Burkholderia pseudomallei
           MSHR346]
 gi|242314964|ref|ZP_04813980.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|251767751|ref|ZP_02268271.2| conserved hypothetical protein [Burkholderia mallei PRL-20]
 gi|254178564|ref|ZP_04885219.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|254197771|ref|ZP_04904193.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|254259935|ref|ZP_04950989.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
 gi|254297792|ref|ZP_04965245.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|52209922|emb|CAH35894.1| putative fimbriae assembly protein [Burkholderia pseudomallei
           K96243]
 gi|52426942|gb|AAU47535.1| conserved hypothetical protein [Burkholderia mallei ATCC 23344]
 gi|76581651|gb|ABA51126.1| putative fimbriae assembly protein [Burkholderia pseudomallei
           1710b]
 gi|121228501|gb|ABM51019.1| conserved hypothetical protein [Burkholderia mallei SAVP1]
 gi|126227572|gb|ABN91112.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a]
 gi|126244277|gb|ABO07370.1| conserved hypothetical protein [Burkholderia mallei NCTC 10247]
 gi|134246424|gb|EBA46513.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|157807075|gb|EDO84245.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|160699603|gb|EDP89573.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|169654512|gb|EDS87205.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|237506855|gb|ACQ99173.1| response regulator receiver protein [Burkholderia pseudomallei
           MSHR346]
 gi|242138203|gb|EES24605.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|243061821|gb|EES44007.1| conserved hypothetical protein [Burkholderia mallei PRL-20]
 gi|254218624|gb|EET08008.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
          Length = 412

 Score = 57.4 bits (137), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 105/232 (45%), Gaps = 10/232 (4%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSI---ASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  I+ +G+R G+G+ST+A N +  +   ++    +T L DL LP G   +  +      
Sbjct: 142 GRLIALLGARAGMGASTLAANLSVLVQKRSAALGRQTALVDLGLPAGDGALFLNTRCEFD 201

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
             +A+  + R D+ FV+     +A  +++ + P  L+   D      V +++ L   F  
Sbjct: 202 FVEAVRNLRRFDRTFVNTALARHASGVALTSLPPNLAGLRDVSYASCVGLMNRLRAFFDC 261

Query: 278 VILDVPHVWNS-WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            I+D+    N  +  +    +D+  +     +A + ++  L++ L+      +   LV+N
Sbjct: 262 QIVDLGGFSNRDFVAQTANAADESWLLCDQGVASVVSAVELLESLRDTGVDTENVRLVVN 321

Query: 337 QVKTPKKPEISI--SDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPK 386
           Q      P + +  +     LG+  +A +P      G +AN GK+I +V  +
Sbjct: 322 QY----DPALGLAPAQIAERLGLALAATLPSRRVPIGHAANQGKLIVDVAER 369


>gi|167738785|ref|ZP_02411559.1| hypothetical protein Bpse14_12008 [Burkholderia pseudomallei 14]
          Length = 359

 Score = 57.4 bits (137), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 104/229 (45%), Gaps = 10/229 (4%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSI---ASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  I+ +G+R G+G+ST+A N +  +   ++    +T L DL LP G   +  +      
Sbjct: 135 GRLIALLGARAGMGASTLAANLSVLVQKRSAALGRQTALVDLGLPAGDGALFLNTRCEFD 194

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
             +A+  + R D+ FV+     +A  +++ + P  L+   D      V +++ L   F  
Sbjct: 195 FVEAVRNLRRFDRTFVNTALARHASGVALTSLPPNLAGLRDVSYASCVGLMNRLRAFFDC 254

Query: 278 VILDVPHVWNS-WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            I+D+    N  +  +    +D+  +     +A + ++  L++ L+      +   LV+N
Sbjct: 255 QIVDLGGFSNRDFVAQTANAADESWLLCDQGVASVVSAVELLESLRDTGVDTENVRLVVN 314

Query: 337 QVKTPKKPEISI--SDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEV 383
           Q      P + +  +     LG+  +A +P      G +AN GK+I +V
Sbjct: 315 QY----DPALGLAPAQIAERLGLALAATLPSRRVPIGHAANQGKLIVDV 359


>gi|67641293|ref|ZP_00440074.1| response regulator receiver protein [Burkholderia mallei GB8 horse
           4]
 gi|124384374|ref|YP_001026126.1| hypothetical protein BMA10229_A0118 [Burkholderia mallei NCTC
           10229]
 gi|126442256|ref|YP_001058808.1| hypothetical protein BURPS668_1769 [Burkholderia pseudomallei 668]
 gi|217423454|ref|ZP_03454955.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|226199657|ref|ZP_03795210.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|254179956|ref|ZP_04886555.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|254188634|ref|ZP_04895145.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254199895|ref|ZP_04906261.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|254358356|ref|ZP_04974629.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|124292394|gb|ABN01663.1| conserved hypothetical protein [Burkholderia mallei NCTC 10229]
 gi|126221749|gb|ABN85255.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
 gi|147749491|gb|EDK56565.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|148027483|gb|EDK85504.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|157936313|gb|EDO91983.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|184210496|gb|EDU07539.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|217393312|gb|EEC33333.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|225928243|gb|EEH24277.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|238522202|gb|EEP85648.1| response regulator receiver protein [Burkholderia mallei GB8 horse
           4]
          Length = 405

 Score = 57.0 bits (136), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 104/229 (45%), Gaps = 10/229 (4%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSI---ASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  I+ +G+R G+G+ST+A N +  +   ++    +T L DL LP G   +  +      
Sbjct: 135 GRLIALLGARAGMGASTLAANLSVLVQKRSAALGRQTALVDLGLPAGDGALFLNTRCEFD 194

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
             +A+  + R D+ FV+     +A  +++ + P  L+   D      V +++ L   F  
Sbjct: 195 FVEAVRNLRRFDRTFVNTALARHASGVALTSLPPNLAGLRDVSYASCVGLMNRLRAFFDC 254

Query: 278 VILDVPHVWNS-WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            I+D+    N  +  +    +D+  +     +A + ++  L++ L+      +   LV+N
Sbjct: 255 QIVDLGGFSNRDFVAQTANAADESWLLCDQGVASVVSAVELLESLRDTGVDTENVRLVVN 314

Query: 337 QVKTPKKPEISI--SDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEV 383
           Q      P + +  +     LG+  +A +P      G +AN GK+I +V
Sbjct: 315 QY----DPALGLAPAQIAERLGLALAATLPSRRVPIGHAANQGKLIVDV 359


>gi|254206227|ref|ZP_04912579.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|147753670|gb|EDK60735.1| conserved hypothetical protein [Burkholderia mallei JHU]
          Length = 386

 Score = 57.0 bits (136), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 105/232 (45%), Gaps = 10/232 (4%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSI---ASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  I+ +G+R G+G+ST+A N +  +   ++    +T L DL LP G   +  +      
Sbjct: 116 GRLIALLGARAGMGASTLAANLSVLVQKRSAALGRQTALVDLGLPAGDGALFLNTRCEFD 175

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
             +A+  + R D+ FV+     +A  +++ + P  L+   D      V +++ L   F  
Sbjct: 176 FVEAVRNLRRFDRTFVNTALARHASGVALTSLPPNLAGLRDVSYASCVGLMNRLRAFFDC 235

Query: 278 VILDVPHVWNS-WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            I+D+    N  +  +    +D+  +     +A + ++  L++ L+      +   LV+N
Sbjct: 236 QIVDLGGFSNRDFVAQTANAADESWLLCDQGVASVVSAVELLESLRDTGVDTENVRLVVN 295

Query: 337 QVKTPKKPEISI--SDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPK 386
           Q      P + +  +     LG+  +A +P      G +AN GK+I +V  +
Sbjct: 296 QY----DPALGLAPAQIAERLGLALAATLPSRRVPIGHAANQGKLIVDVAER 343


>gi|226310156|ref|YP_002770050.1| hypothetical protein BBR47_05690 [Brevibacillus brevis NBRC 100599]
 gi|226093104|dbj|BAH41546.1| hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 385

 Score = 57.0 bits (136), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 66/288 (22%), Positives = 121/288 (42%), Gaps = 23/288 (7%)

Query: 109 VIVIGDTNDVSLYRALISNHVSEYLIEPLSV---ADIINSISAIFTPQEEGKGS------ 159
           VI + +  D  L R ++     EY++ P  +   +D ++ IS +   ++  KG+      
Sbjct: 76  VIYLTERQDFVLLRDVVRAGAVEYIVMPDELNLLSDRLDKISDLSLIKQRKKGADVSGKA 135

Query: 160 ----SGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPI 215
                G   SF   +GG G + +A   A ++        LL DL+L YG        +  
Sbjct: 136 FVRGRGKVYSFYSGKGGSGRTQLATGFAQALKLESTASVLLIDLNLQYGGVETFLSFENN 195

Query: 216 NSISDAIYPVGRIDKAFVSRLPVFYAEN---LSILTAPAMLSRTYDFDEKMIVPVLDILE 272
            ++ D +  +  I++  +    V   EN   L +L +P       +  E  +  ++    
Sbjct: 196 RTLGDLMPVMDEINEFHIRN--VAQRENYSKLEVLVSPRDAETAENMSEAFVTRLIRASR 253

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY 332
           + +  VILD+P   N  T   L+ SD +    +LD   ++  + + D+ K+LR  D    
Sbjct: 254 RSYDFVILDLPTHMNELTFAALSESDMIYYVMNLDTPSVQIYQLVEDLFKRLR-IDTAGR 312

Query: 333 L--VLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
           L  ++NQV   +  E+++SD         +A I  D      + N G+
Sbjct: 313 LEVIVNQV--GRDNELNVSDLKGLFNAPITAEISRDHQGVQAAVNQGR 358


>gi|220913383|ref|YP_002488692.1| flp pilus assembly protein CpaE [Arthrobacter chlorophenolicus A6]
 gi|219860261|gb|ACL40603.1| putative flp pilus assembly protein CpaE [Arthrobacter
           chlorophenolicus A6]
          Length = 401

 Score = 57.0 bits (136), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 88/212 (41%), Gaps = 2/212 (0%)

Query: 153 QEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDK 212
           + +   + G  I+ I  +GGVG +T+A N A  +  +  M  ++ DLDL +G        
Sbjct: 138 EHKEHAAGGRIIAVISPKGGVGKTTVATNIAVGLGQIAPMGVVIVDLDLQFGDVASGLML 197

Query: 213 DPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILE 272
           +P ++I+DA+      D   +      +   +  L AP           + +  +L  L 
Sbjct: 198 EPEHTITDAVVGAASQDSMVLKTYLTLHPAGIYALCAPKNPVEMDRISGEHVSHLLSQLR 257

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY 332
           Q F  V++D            L L+   V    +D+  +R  +    +L +L    +  +
Sbjct: 258 QEFQYVVVDTAPGLGEHVLATLDLASDAVWICGMDVPSIRGLRTGNQILAELGLLPETRH 317

Query: 333 LVLNQVKTPKKPEISISDFCAPLGITPSAIIP 364
           +VLN     ++  +++ D  A +G     ++P
Sbjct: 318 VVLNMAD--RRSGLTLRDVEATIGAPVDIVLP 347


>gi|167824384|ref|ZP_02455855.1| hypothetical protein Bpseu9_11988 [Burkholderia pseudomallei 9]
          Length = 390

 Score = 57.0 bits (136), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 104/229 (45%), Gaps = 10/229 (4%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSI---ASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  I+ +G+R G+G+ST+A N +  +   ++    +T L DL LP G   +  +      
Sbjct: 135 GRLIALLGARAGMGASTLAANLSVLVQKRSAALGRQTALVDLGLPAGDGALFLNTRCEFD 194

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
             +A+  + R D+ FV+     +A  +++ + P  L+   D      V +++ L   F  
Sbjct: 195 FVEAVRNLRRFDRTFVNTALARHASGVALTSLPPNLAGLRDVSYASCVGLMNRLRAFFDC 254

Query: 278 VILDVPHVWNS-WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            I+D+    N  +  +    +D+  +     +A + ++  L++ L+      +   LV+N
Sbjct: 255 QIVDLGGFSNRDFVAQTANAADESWLLCDQGVASVVSAVELLESLRDTGVDTENVRLVVN 314

Query: 337 QVKTPKKPEISI--SDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEV 383
           Q      P + +  +     LG+  +A +P      G +AN GK+I +V
Sbjct: 315 QY----DPALGLAPAQIAERLGLALAATLPSRRVPIGHAANQGKLIVDV 359


>gi|212635452|ref|YP_002311977.1| Flp pilus assembly protein [Shewanella piezotolerans WP3]
 gi|212556936|gb|ACJ29390.1| Flp pilus assembly protein [Shewanella piezotolerans WP3]
          Length = 410

 Score = 57.0 bits (136), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 81/327 (24%), Positives = 144/327 (44%), Gaps = 21/327 (6%)

Query: 72  FSDSSTPD--LIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHV 129
           F++ S  D  LI++    D RE   A E L         +I++G     ++ R     +V
Sbjct: 64  FNEESKNDINLILLHLPNDERE---AKEALGYGAKFDAHIILLGKDTPPNILRLAFQYNV 120

Query: 130 SEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASV 189
           S+++     + ++  +I  +     E +      ++ +  + G G+S IA + A   A  
Sbjct: 121 SDFIAVDAPIEELHEAILKVSNRLIE-EAELAPVLAVVNGKAGSGASFIAASIASVAAKR 179

Query: 190 FAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDK-AFVSRLPVFYAENLSILT 248
            + +  L D DL +G+       +   SI D ++ +  +D+ A  S +    +ENL++L 
Sbjct: 180 ESYDVCLLDTDLHHGSLGHILGMEANYSICDVLWSLEELDEVALKSTMAT--SENLNLLA 237

Query: 249 AP--AMLSRTYDFDEKMIVPVLDILEQIFPLVILDV---PHVWNSWTQEVLTLSDKVVIT 303
           +    +LS   D D  + + ++    Q +  VILD    P +WN    + L L  K++I 
Sbjct: 238 SKPFELLSINNDLDLSITIDLVRKCRQFYKQVILDFSRGPELWN----DELLLDAKILIV 293

Query: 304 TSLDLAGLRNSKNLIDVL-KKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAI 362
           T  ++  LR +K+LI  L   +  A     LV+N  +  KK +I +SD    +GI     
Sbjct: 294 TQQNIMHLRQTKDLIRQLTNHMGIARNRISLVVN--RYDKKSDIKLSDIKQTVGIDSVFT 351

Query: 363 IPFDGAVFGMSANSGKMIHEVDPKSAI 389
           I  D  +       GK I E+  K  +
Sbjct: 352 IVNDYRLSSECVELGKSITEIAKKQKM 378


>gi|152981702|ref|YP_001355005.1| pilus assembly protein CpaE [Janthinobacterium sp. Marseille]
 gi|151281779|gb|ABR90189.1| pilus assembly protein CpaE [Janthinobacterium sp. Marseille]
          Length = 420

 Score = 57.0 bits (136), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 59/270 (21%), Positives = 110/270 (40%), Gaps = 19/270 (7%)

Query: 142 IINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAM--------- 192
           I   +SA+ TP        G  I+ +G+R GVGS+T++      +A V  +         
Sbjct: 139 IYKLVSAVSTP---AVAIQGTLITLLGARAGVGSTTLS----VHLADVLQLRKSAQHKDY 191

Query: 193 ETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAM 252
           +  L DL LP G   +  +     S  D +    R+D+  +          + +++ P M
Sbjct: 192 QIGLLDLGLPAGDGQLYLNVAGTYSFIDTLRNRHRLDRTLIQTALTNSHNGIKVISLPRM 251

Query: 253 LSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLT-LSDKVVITTSLDLAGL 311
           L          ++ +L  L   F +++LD+  + +    E +   SD+V+  T      L
Sbjct: 252 LKEMSGISHDDVLSLLTQLRLYFDVLVLDLGGLADMELVECMANASDQVLFVTDQSAGSL 311

Query: 312 RNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFG 371
            +  +++    K         LV+N+     +  +S        G+  +A++P       
Sbjct: 312 VSLSSMLKDFNKRGGDASRRQLVVNRYDI--RYGMSAPQIAERFGLPLAAVLPECTLRLM 369

Query: 372 MSANSGKMIHEVDPKSAIANLLVDFSRVLM 401
            SAN GK++HEV+   A    + D +  L+
Sbjct: 370 SSANQGKLLHEVNKHDAYVREIQDLAEKLL 399


>gi|313895970|ref|ZP_07829524.1| putative sporulation initiation inhibitor protein Soj [Selenomonas
           sp. oral taxon 137 str. F0430]
 gi|312975395|gb|EFR40856.1| putative sporulation initiation inhibitor protein Soj [Selenomonas
           sp. oral taxon 137 str. F0430]
          Length = 249

 Score = 57.0 bits (136), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 88/174 (50%), Gaps = 5/174 (2%)

Query: 163 SISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAI 222
           +IS I  +GGVG +TI  N A+++A    +  L+ D D   G A   FD  P  +++D +
Sbjct: 3   TISLINKKGGVGKTTITVNLAYALAESCDLRVLVVDND-DQGNATQFFDVTPDFTLADVL 61

Query: 223 YPVGRIDKAFVSRLPVFY--AENLSILTAP-AMLSRTYDFDEKMIVPVLDILEQIFPLVI 279
             +        +R P+ +    +  +L A  A++       + ++   L  ++ ++ + +
Sbjct: 62  TGMDIRSCISRTRYPLIHLLPSDERLLDANVAVIKDETIVQQSILKDALASVQDLYDVCL 121

Query: 280 LDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYL 333
           +D P   N+     LT SD+V+I T+ DL G+R  + +I  ++ ++ AD  P+L
Sbjct: 122 IDNPPTINASVINALTASDEVIIVTTPDLYGIRGVEQMISYIESIQ-ADYNPHL 174


>gi|300692333|ref|YP_003753328.1| Flp pilus assembly protein, ATPase [Ralstonia solanacearum PSI07]
 gi|299079393|emb|CBJ52064.1| Flp pilus assembly protein, ATPase [Ralstonia solanacearum PSI07]
          Length = 397

 Score = 56.6 bits (135), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 56/265 (21%), Positives = 111/265 (41%), Gaps = 8/265 (3%)

Query: 159 SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINS 217
           S G  +SF+  +GG G++  A N A  +++ +    LL DL   YG A  +  D+ P  +
Sbjct: 129 SEGQVLSFLSCKGGSGTTFTAANLAHVLSARYGKRVLLVDLCQQYGDAAFLVTDQTPPAT 188

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
           +      + R+D A         A +  +L       +  +     +  ++ +   ++ +
Sbjct: 189 LLTVCQQIDRMDAALFDTCLTHVAHDFDVLAGAGDPVKAGEIKAAHLERIVSLAASLYDV 248

Query: 278 VILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQ 337
           V+ D+    N  +  VL  S  +     ++L  LR  + L+++ + L       + V+NQ
Sbjct: 249 VVFDIGQDINPASIVVLDHSKLIFPVLQMNLTYLRAGRRLMELCQSLGYHADRLHPVINQ 308

Query: 338 VKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFS 397
               K   +         G+  + ++P+D      ++N G  + ++   S IA  L D +
Sbjct: 309 HD--KHDPVDRRTMENAFGMAIAHVLPYDPGPVRDASNQGVPLLQLAENSPIARALYDMA 366

Query: 398 RVLMGRVTVSKPQSAMYTKIKKIFN 422
           R L      S+PQ      ++K+F 
Sbjct: 367 RQL---YPDSRPQRDGL--LRKLFG 386


>gi|114764948|ref|ZP_01444121.1| ATPase, putative [Pelagibaca bermudensis HTCC2601]
 gi|114542660|gb|EAU45684.1| ATPase, putative [Roseovarius sp. HTCC2601]
          Length = 410

 Score = 56.6 bits (135), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 73/337 (21%), Positives = 138/337 (40%), Gaps = 28/337 (8%)

Query: 64  SIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGT----KVIVIGDTNDVS 119
              EA++      + DL  V   +D  E    L  ++EV  +      KV++I +    +
Sbjct: 45  GFGEALAFLGQPDSQDLEFVAMAIDE-EDEEDLGLISEVIGAAKARDIKVVLIAEDVTPA 103

Query: 120 LYRALISNHVSEYLIEPLSVADIINSIS----------AIFTPQEEGKGSSGCSISFIGS 169
               L+     E++  PL   ++  ++           A   P +      G  I+  G 
Sbjct: 104 ALHQLLRRGADEFVPYPLPEGELAAAVDRMRRASVVADAAEPPVKLSGDGDGVLIAVQGM 163

Query: 170 RGGVGSSTIAHNCAFSIASV---FAMETLLADLDLPYGTANINFDKDPINSISDAIYPVG 226
            GG G++  A N A+ +A++    A    L D  L +G+     D     ++ + +  V 
Sbjct: 164 CGGCGATNFAVNLAWELANISKGRAPRVCLLDFSLQFGSVATYLDLPRREAVLEMLGDVE 223

Query: 227 RIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVW 286
            +D    ++  V + + L +LT+PA L        + +  VLD+  + F  V++D+P   
Sbjct: 224 SMDGESFAQALVSFEDKLQVLTSPADLVPLDLIGPEDVKQVLDVAREHFDYVVVDMPTTL 283

Query: 287 NSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY--LVLNQVKTPKKP 344
             WT  VLT +        LD   +R+++N +  LK+   A++ P+  L     + PK  
Sbjct: 284 VQWTDTVLTEAQVYFALLELD---MRSAQNTLR-LKRAMQAEELPFDKLRFTLNRAPKFT 339

Query: 345 EIS----ISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
           ++     +      LGI  +  +   G + G + + G
Sbjct: 340 DLQGKSRVRRMAESLGIRINVQLSDGGRLVGQANDHG 376


>gi|300694110|ref|YP_003750083.1| response receiver involved in pilum assembly [Ralstonia
           solanacearum PSI07]
 gi|299076147|emb|CBJ35460.1| putative response receiver involved in pilum assembly [Ralstonia
           solanacearum PSI07]
          Length = 439

 Score = 56.6 bits (135), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 67/328 (20%), Positives = 136/328 (41%), Gaps = 10/328 (3%)

Query: 106 GTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSS-GCSI 164
           G  ++ +G  +D     A +   V +++    + A+ +  +  +   +   + +  G  +
Sbjct: 98  GLPLVAVGSASDGRAMLAALRAGVKDFIDVDGAPAEAVRVVRRLLAERASTEPTRRGRVL 157

Query: 165 SFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYP 224
           + +G+R GVG++T+A N A  +      + +L DL  P     +  +        +A+  
Sbjct: 158 AILGARPGVGATTLAANLATLVRRTSGGDVMLLDLGQPLRDGALYLNVPAHFHFVEAVRN 217

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH 284
           + R D+ FV      +   L++L  P  L+   D      + +L+ L   F L ++D+  
Sbjct: 218 LRRFDQVFVQTALSRHPNGLAVLPLPVSLAEMRDISFSEALGLLNRLRTFFDLQVVDLGG 277

Query: 285 VWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKK 343
             N  +  +++  +D V++ T   +  + ++  L+  LKK R  D+   L L   K   +
Sbjct: 278 FNNIDFIAQLVKAADDVMLVTEQSVGAIVSAAELMQELKK-REVDR-DRLHLTISKFDSR 335

Query: 344 PEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMI---HEVDPK-SAIANLLVDFSRV 399
             +        L I     +P   A   +++N G M+   H +DP   AIA ++      
Sbjct: 336 LSLDAEQIAERLEIPSVLTVPSRRAALVVASNQGAMLAETHPIDPYVRAIAGIVQTLGYT 395

Query: 400 LMGRVT--VSKPQSAMYTKIKKIFNMKC 425
             G     V+   + M T++   F  K 
Sbjct: 396 QPGERAPGVAGWMAGMRTRLGDRFRRKS 423


>gi|254440846|ref|ZP_05054339.1| hypothetical protein OA307_261 [Octadecabacter antarcticus 307]
 gi|198250924|gb|EDY75239.1| hypothetical protein OA307_261 [Octadecabacter antarcticus 307]
          Length = 409

 Score = 56.6 bits (135), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 107/230 (46%), Gaps = 19/230 (8%)

Query: 160 SGCSISFIGSRGGVGSSTIAHNCAFSIASVFA---METLLADLDLPYGTANINFDKDPIN 216
           +G  I   G  GG G++T+A N A+ +A++         + DLD  +G+ +   D     
Sbjct: 152 NGVVIPVQGMAGGTGATTLAVNLAWELATLDKENPQRVCILDLDFQFGSVSTYLDLPRRE 211

Query: 217 SISDAIYPVGRID-KAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIF 275
           S+ + +     +D ++F+  L + Y + L +LTAP  L          I  ++++    F
Sbjct: 212 SVLEMLQNTESMDSESFMHSL-LSYEQKLQVLTAPTDLIPMDLIGPADIQRIIEMARTNF 270

Query: 276 PLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR----PADKPP 331
             V++D+P     W++ VL  +   ++T  LD   +R+++N + V + L+    P +K  
Sbjct: 271 DYVVIDLPKTMVEWSETVLHAAHVYLVTLELD---MRSAQNTLRVKRALQGEQLPLEKLR 327

Query: 332 YLVLNQVKTPKKPEIS----ISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
           + VLN  + P+  +++    +      LGI+    +P  G     + + G
Sbjct: 328 F-VLN--RAPRFTDLNGKSRVKRLSESLGISIEVQLPDGGKAVSQTTDHG 374


>gi|88999671|emb|CAJ75591.1| minD protein [Geobacillus thermoleovorans]
          Length = 270

 Score = 56.6 bits (135), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 60/275 (21%), Positives = 127/275 (46%), Gaps = 20/275 (7%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN----FDKDPIN 216
           G +I     +GGVG +T   N   ++A +      L D D+  G  N++     +   I 
Sbjct: 4   GEAIVITSGKGGVGKTTTTANLGTALA-ILGKRVCLVDTDI--GLRNLDVVLGLENRIIY 60

Query: 217 SISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFP 276
            + D +     + KA V      +  +L +L A A  S     +   +  +++ L+Q + 
Sbjct: 61  DLVDVVEGRCTVQKALVK--DKRFDNHLYLLPA-AQTSDKSAVNPAQMKQLIEELKQEYD 117

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            V++D P       +  +  +D+ ++ T+ +++ +R++  +I +L+      KPP L++N
Sbjct: 118 YVLIDCPAGIEQGYRNAVAGADEAIVVTTPEVSAVRDADRIIGLLEAEEHV-KPPRLIIN 176

Query: 337 QVKT---PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
           ++++        + + +  + L I    II  D  V   S N G+ I  +DP S  +   
Sbjct: 177 RIRSHMVKNGDMLDVDEIISHLSIELLGIIADDENVIKAS-NRGEPIV-LDPNSKASIAF 234

Query: 394 VDFSRVLMGRVT----VSKPQSAMYTKIKKIFNMK 424
            + +R ++G       + + +  +++KI+KIF++K
Sbjct: 235 RNIARRILGESVPLPPLEEEEKGLFSKIRKIFSLK 269


>gi|56421148|ref|YP_148466.1| chromosome partitioning ATPase [Geobacillus kaustophilus HTA426]
 gi|56380990|dbj|BAD76898.1| ATPase involved in chromosome partitioning [Geobacillus
           kaustophilus HTA426]
          Length = 267

 Score = 56.6 bits (135), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 60/275 (21%), Positives = 127/275 (46%), Gaps = 20/275 (7%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN----FDKDPIN 216
           G +I     +GGVG +T   N   ++A +      L D D+  G  N++     +   I 
Sbjct: 2   GEAIVITSGKGGVGKTTTTANLGTALA-ILGKRVCLVDTDI--GLRNLDVVLGLENRIIY 58

Query: 217 SISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFP 276
            + D +     + KA V      +  +L +L A A  S     +   +  +++ L+Q + 
Sbjct: 59  DLVDVVEGRCTVQKALVK--DKRFDNHLYLLPA-AQTSDKSAVNPAQMKQLIEELKQEYD 115

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            V++D P       +  +  +D+ ++ T+ +++ +R++  +I +L+      KPP L++N
Sbjct: 116 YVLIDCPAGIEQGYRNAVAGADEAIVVTTPEVSAVRDADRIIGLLEAEEHV-KPPRLIIN 174

Query: 337 QVKT---PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
           ++++        + + +  + L I    II  D  V   S N G+ I  +DP S  +   
Sbjct: 175 RIRSHMVKNGDMLDVDEIISHLSIELLGIIADDENVIKAS-NRGEPIV-LDPNSKASIAF 232

Query: 394 VDFSRVLMGRVT----VSKPQSAMYTKIKKIFNMK 424
            + +R ++G       + + +  +++KI+KIF++K
Sbjct: 233 RNIARRILGESVPLPPLEEEEKGLFSKIRKIFSLK 267


>gi|169827142|ref|YP_001697300.1| hypothetical protein Bsph_1572 [Lysinibacillus sphaericus C3-41]
 gi|168991630|gb|ACA39170.1| Hypothetical ylxH protein [Lysinibacillus sphaericus C3-41]
          Length = 291

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/207 (18%), Positives = 102/207 (49%), Gaps = 19/207 (9%)

Query: 157 KGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPIN 216
           +G  G +I+ +  +GGVG S    N A S+A     + ++ D+D+  G  NI   K   N
Sbjct: 16  QGDLGRAIAVVSGKGGVGKSNFTMNFALSLAQK-GKKVVIVDMDIGMGNINILIGKSASN 74

Query: 217 SISDAIYPVGRIDKAFVSRLPVFYA-ENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI- 274
           S+ D +     +++       +F     L  ++  + ++  +++ E M   ++   EQ+ 
Sbjct: 75  SLKDFLEGNKLLEEV------IFEGPHGLRYISGGSGMTNIFNWSEMMFEQLIQAFEQLQ 128

Query: 275 --FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY 332
             +  ++ D+     +W+ ++LT  D++++ ++ +   + ++ +++  +  +R ADK  +
Sbjct: 129 KNYDYILFDMGAGATNWSLDLLTSIDEIIVISTAEPTAITDAYSMMKYI-HMRDADKQFF 187

Query: 333 LVLNQ-------VKTPKKPEISISDFC 352
           ++ N+       ++T ++ ++++  F 
Sbjct: 188 VLCNRAFSKEEGIETNERLKLAMKRFL 214


>gi|54302284|ref|YP_132277.1| hypothetical protein PBPRB0604 [Photobacterium profundum SS9]
 gi|46915706|emb|CAG22477.1| hypothetical protein PBPRB0604 [Photobacterium profundum SS9]
          Length = 412

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 73/357 (20%), Positives = 149/357 (41%), Gaps = 26/357 (7%)

Query: 60  ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS 119
           +T   + +++S   +S+TPDLI++  K D + ++++L+   +       ++++ D  D  
Sbjct: 52  MTNSEVEQSLSQLKESTTPDLILIDGKNDWQTLIASLKQALKENSRIPDIVLLVDHADTV 111

Query: 120 LYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSS---GCSISFIGSRGGVGSS 176
           + R  +   V + L  P    +    +  +F      K S    G    FI ++GG+G+S
Sbjct: 112 IMRQALKFGVKDVLTIPFGEEE----LDQVFFDCAALKKSDVKLGDISVFINAKGGMGAS 167

Query: 177 TIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRL 236
            IA   A  +        +L D D  +G        +P   +SDA+     +D+  +  L
Sbjct: 168 IIATTVAHMVTLQHTSPPVLIDTDAQFGCIPNLLSTNPKFILSDALEQTDDLDEYALQGL 227

Query: 237 PVFYAENLSILTAPAMLSRTYD---------FDEKMIVPVLDILEQIFPLVILDVPHVWN 287
              +   L  + +     + +D         F++      L  L   F  +I+D+     
Sbjct: 228 LSKHESGLRFIASRK--DKLFDTIPTHSPLAFNQ-----FLTKLRANFEHIIIDMSRGIE 280

Query: 288 SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY-LVLNQVKTPKKPEI 346
            +T   L+ ++ + I    ++  +R + NLI  LK L   +   + +++N  +  KK EI
Sbjct: 281 KFTLPALSEAEYIFIVVQQNVPAIREAANLIKQLKHLLGINDIKFKIIVN--RYSKKIEI 338

Query: 347 SISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGR 403
           +  +    L I    ++P D      S N G+++     K  I   +   S +++ +
Sbjct: 339 TPEEIKKSLHIDELLLVPNDFQSVSASTNLGELLATHSSKQPIIKGMRTISNIILNK 395


>gi|261418371|ref|YP_003252053.1| septum site-determining protein MinD [Geobacillus sp. Y412MC61]
 gi|297529223|ref|YP_003670498.1| septum site-determining protein MinD [Geobacillus sp. C56-T3]
 gi|319767670|ref|YP_004133171.1| septum site-determining protein MinD [Geobacillus sp. Y412MC52]
 gi|261374828|gb|ACX77571.1| septum site-determining protein MinD [Geobacillus sp. Y412MC61]
 gi|297252475|gb|ADI25921.1| septum site-determining protein MinD [Geobacillus sp. C56-T3]
 gi|317112536|gb|ADU95028.1| septum site-determining protein MinD [Geobacillus sp. Y412MC52]
          Length = 267

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/275 (21%), Positives = 124/275 (45%), Gaps = 20/275 (7%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN----FDKDPIN 216
           G +I     +GGVG +T   N   ++A +      L D D+  G  N++     +   I 
Sbjct: 2   GEAIVITSGKGGVGKTTTTANLGTALA-ILGKRVCLVDTDI--GLRNLDVVLGLENRIIY 58

Query: 217 SISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFP 276
            + D +     + KA V        +N   L   A  S     +   +  +++ L+Q + 
Sbjct: 59  DLVDVVEGRCTVQKALVKDKRF---DNYLYLLPAAQTSDKSAVNPAQMKQLIEELKQEYD 115

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            V++D P       +  +  +D+ ++ T+ +++ +R++  +I +L+      KPP L++N
Sbjct: 116 YVLIDCPAGIEQGYRNAVAGADEAIVVTTPEVSAVRDADRIIGLLEAEEHV-KPPRLIIN 174

Query: 337 QVKT---PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
           ++++        + + +  + L I    II  D  V   S N G+ I  +DP S  +   
Sbjct: 175 RIRSHMVKNGDMLDVDEIISHLSIELLGIIADDENVIKAS-NRGEPIV-LDPNSKASIAF 232

Query: 394 VDFSRVLMGRVT----VSKPQSAMYTKIKKIFNMK 424
            + +R ++G       + + +  +++KI+KIF++K
Sbjct: 233 RNIARRILGESVPLPPLEEEEKGLFSKIRKIFSLK 267


>gi|56750653|ref|YP_171354.1| septum site-determining protein MinD [Synechococcus elongatus PCC
           6301]
 gi|81299705|ref|YP_399913.1| septum site-determining protein MinD [Synechococcus elongatus PCC
           7942]
 gi|56685612|dbj|BAD78834.1| septum site-determining protein MinD [Synechococcus elongatus PCC
           6301]
 gi|81168586|gb|ABB56926.1| septum site-determining protein MinD [Synechococcus elongatus PCC
           7942]
          Length = 268

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 63/269 (23%), Positives = 124/269 (46%), Gaps = 21/269 (7%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLL-ADLDLPYGTANINFDKDPINSISDAIYPVGR 227
            +GGVG +T + N   ++A +     L+ AD  L      +  +   + +  D +    R
Sbjct: 10  GKGGVGKTTSSANLGMALAQLGKRLVLIDADFGLRNLDLLLGLENRIVYTAQDVLAGNCR 69

Query: 228 IDKAFVS--RLPVFYAENLSILTAPAMLSRTYD-FDEKMIVPVLDILEQIFPLVILDVPH 284
           +++A V   R P     NL +L  PA  +R  +    + +  ++ +L+  F ++++D P 
Sbjct: 70  LEQALVKDKRQP-----NLCLL--PAANNRMKESVTPQQMEQLVTLLDGQFDVILIDSPA 122

Query: 285 VWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVK---TP 341
              +  Q  +  + + VI T+ ++A +R++  +I +L+          L+LN+++     
Sbjct: 123 GIEAGFQNAIAAAREAVIVTTPEIAAVRDADRVIGLLEA--HGITEIRLILNRLRPAMVK 180

Query: 342 KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLM 401
               +S+ D    L I    IIP D  V  +S N G+ +   +  S  A   ++ +R L 
Sbjct: 181 ANDMMSVEDVQEILAIPLVGIIPDDEQVI-ISTNRGEPLVLAEAPSLAAKAFINVARRLS 239

Query: 402 GR----VTVSKPQSAMYTKIKKIFNMKCF 426
           G     + + +PQS + +KI++I N K  
Sbjct: 240 GESIDFLNLEEPQSGVLSKIRRILNKKIL 268


>gi|167562914|ref|ZP_02355830.1| hypothetical protein BoklE_10165 [Burkholderia oklahomensis EO147]
 gi|167570104|ref|ZP_02362978.1| hypothetical protein BoklC_09686 [Burkholderia oklahomensis C6786]
          Length = 412

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 104/232 (44%), Gaps = 10/232 (4%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSI---ASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  I+ +G+R G+G+ST+A N +  +   ++    +T L DL LP G   +  +      
Sbjct: 142 GKLIALLGARAGMGASTLAANLSVLLQKRSATQGRQTALVDLGLPAGDGALYLNTRCEVD 201

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
             +A+  + R D+ FV+     ++  +++ + P  L+   D      V +L+ L   F  
Sbjct: 202 FVEAVRNLRRFDRTFVNTALARHSSGVALTSLPPNLAGLRDVSYASCVGLLNRLRAFFDY 261

Query: 278 VILDVPHVWNS-WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            I+D+    N  +  +    +D+  +     +A + ++  L++ L+          LV+N
Sbjct: 262 QIIDLGGFSNRDFVAQTACAADESWLLCDQGVASVVSAVELLESLRDAGVDTGNVRLVVN 321

Query: 337 QVKTPKKPEISIS--DFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPK 386
           Q      P + +S       LG+  +A +P      G +AN GK+I +V  +
Sbjct: 322 QY----DPALGLSPAQIAERLGLGLAATLPSRRVPIGHAANQGKLIVDVAER 369


>gi|138896180|ref|YP_001126633.1| cell division inhibitor MinD [Geobacillus thermodenitrificans
           NG80-2]
 gi|196250134|ref|ZP_03148828.1| septum site-determining protein MinD [Geobacillus sp. G11MC16]
 gi|134267693|gb|ABO67888.1| Cell division inhibitor MinD [Geobacillus thermodenitrificans
           NG80-2]
 gi|196210318|gb|EDY05083.1| septum site-determining protein MinD [Geobacillus sp. G11MC16]
          Length = 267

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/275 (21%), Positives = 127/275 (46%), Gaps = 20/275 (7%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN----FDKDPIN 216
           G +I     +GGVG +T   N   ++A +      L D D+  G  N++     +   I 
Sbjct: 2   GEAIVITSGKGGVGKTTTTANLGTALA-ILGKRVCLVDTDI--GLRNLDVVLGLENRIIY 58

Query: 217 SISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFP 276
            + D +     + KA V      +  +L +L A A  S     + + +  +++ L+Q + 
Sbjct: 59  DLVDVVEGRCTVQKALVK--DKRFDNHLYLLPA-AQTSDKSAVNPEQMKEMIEQLKQEYD 115

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            V++D P       +  +  +D+ ++ T+ +++ +R++  +I +L+      KPP L++N
Sbjct: 116 YVLIDCPAGIEQGYRNAVAGADEAIVVTTPEVSAVRDADRIIGLLEAEEHV-KPPRLIIN 174

Query: 337 QVKT---PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
           ++++        + + +    L I    II  D  V   S N G+ I  +DP S  +   
Sbjct: 175 RIRSNMVKNGDMLDVDEIVMHLSIELLGIIVDDENVIKAS-NRGEPIV-LDPNSKASIAY 232

Query: 394 VDFSRVLMGRVT----VSKPQSAMYTKIKKIFNMK 424
            + +R ++G       + + +  +++KI+KIF++K
Sbjct: 233 RNIARRILGESVPLPPLEEEEKGLFSKIRKIFSLK 267


>gi|78066132|ref|YP_368901.1| response regulator receiver domain-containing protein [Burkholderia
           sp. 383]
 gi|77966877|gb|ABB08257.1| response regulator receiver domain protein (CheY-like)
           [Burkholderia sp. 383]
          Length = 412

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 103/241 (42%), Gaps = 28/241 (11%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA---SVFAMETLLADLDLPYGTANINFDKDPINS 217
           G   + +G+R G+G ST+A N +  +    +  A    L DL LP G   +  +      
Sbjct: 141 GKVTALLGARAGMGVSTLAANLSVLMQRRPADPAHAAALLDLGLPAGDGALFLNTRCEFH 200

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
             +A+  + RID+ FV+     +A  +++ T P  L+   +        +L+ L   F  
Sbjct: 201 FVEAVRNLRRIDRTFVTTALARHASGVALTTLPPNLADLREVATASCAALLNRLRAFFDH 260

Query: 278 VILDVPHVWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            I+D+    N  +  +V+ L+D+  +     +A + ++  ++D L+      +   LV+N
Sbjct: 261 QIVDLGGFPNREFIAQVVNLADEAWLVCDQGVASVVSAIEMLDGLRDAGATTERIRLVVN 320

Query: 337 QVKTPKKPEISISDFCAPLGITPS-----------AIIPFDGAVFGMSANSGKMIHEVDP 385
           Q             F A LG+ P+           A +P      G +AN GK+I EV  
Sbjct: 321 Q-------------FDAELGLMPAQIAERLDLSLLATLPSRRVSIGHAANQGKLIAEVAE 367

Query: 386 K 386
           +
Sbjct: 368 R 368


>gi|299069497|emb|CBJ40766.1| putative response receiver involved in pilum assembly [Ralstonia
           solanacearum CMR15]
          Length = 439

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/282 (19%), Positives = 118/282 (41%), Gaps = 4/282 (1%)

Query: 106 GTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSS-GCSI 164
           G  ++ +G  +D     A +   V +++    + A+ +  +  +   +   + +  G  +
Sbjct: 98  GLPLVAVGSASDGRAMLAALRAGVKDFIDVDGAPAEAVRVVRRLLAERASAEPTRRGRVL 157

Query: 165 SFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYP 224
           + +G+R GVG++T+A N A  +      + +L DL  P     +  +        +A+  
Sbjct: 158 AILGARPGVGTTTLAANLATLVRRTSGGDVMLLDLGQPLRDGALYLNVPANFHFVEAVRN 217

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH 284
           + R D+ FV      +   L++L  P  L+   D      + +L+ L   F L ++D+  
Sbjct: 218 LRRFDQVFVQTALSRHPNGLAVLPLPVSLTEMRDISFSEALGLLNRLRTFFDLQVVDLGG 277

Query: 285 VWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKK 343
             N  +  +++  +D V++ T   +  + ++  L+  LKK R  D+   L L   K   +
Sbjct: 278 FNNIDFIAQLVKAADDVMLVTEQSVGAIVSAAELMQELKK-REIDR-ERLHLTLSKFDAR 335

Query: 344 PEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDP 385
             +        L I     +P       +++N G M+ E  P
Sbjct: 336 LSLDAEQIAERLEIASVLTVPSRRRALVVASNQGAMLAETHP 377


>gi|170700847|ref|ZP_02891836.1| response regulator receiver protein [Burkholderia ambifaria
           IOP40-10]
 gi|170134255|gb|EDT02594.1| response regulator receiver protein [Burkholderia ambifaria
           IOP40-10]
          Length = 402

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/265 (20%), Positives = 109/265 (41%), Gaps = 6/265 (2%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSISDAI 222
           +SF+  +GG G+S +A N A+ IA       LL DL+  +  A  +  D+ P +++    
Sbjct: 134 VSFMSCKGGAGTSFVASNVAYEIAEAHKRRVLLVDLNQQFADAAFLVSDETPPSTLPQLC 193

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDV 282
             + R+D AF+            +L       +  +  E  +  +L +    +  V+ D+
Sbjct: 194 AQIERLDGAFLDASVAHVTPTFHVLAGAGDPVKAAEMREDALEWILGVAAPRYDFVVFDI 253

Query: 283 PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL-RPADKPPYLVLNQVKTP 341
               N  +   L  SD++ +     +  +R  + L+++L  L  P D+   +V    +  
Sbjct: 254 GVSINPLSMIALDRSDQIQLVLQPAMPHVRAGRRLLEILVSLGYPVDQLRLVVNRMTRAG 313

Query: 342 KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSR-VL 400
           ++   ++ +    LG+  S  IP D      + + G     V   +A+   L   ++ ++
Sbjct: 314 ERSRAALEEV---LGLHASCTIPDDVDTVREALDLGHPASRVARSAAVTRALQACAKQIV 370

Query: 401 MGRVTVSKPQSAMYTKIKKIFNMKC 425
            G V      S+    + ++F  K 
Sbjct: 371 EGDVRTRHGTSSSEPLMSRLFGRKA 395


>gi|89098974|ref|ZP_01171854.1| ATPase activator of MinC [Bacillus sp. NRRL B-14911]
 gi|89086378|gb|EAR65499.1| ATPase activator of MinC [Bacillus sp. NRRL B-14911]
          Length = 267

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/275 (21%), Positives = 125/275 (45%), Gaps = 20/275 (7%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN----FDKDPIN 216
           G +I     +GGVG +T + N   ++A +      L D D+  G  N++     +   I 
Sbjct: 2   GEAIVITSGKGGVGKTTTSANIGTALA-LQGKRVCLIDTDI--GLRNLDVVMGLENRIIY 58

Query: 217 SISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFP 276
            + D I    ++ +A V        E+L  L   A  S     + + +  +++ L+Q + 
Sbjct: 59  DLVDVIEGRCKVHQALVKDKRF---EDLLYLLPAAQTSDKTAVNPEQMKKLVEELKQDYD 115

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            +I+D P       +  +  +DK ++ T+ +++ +R++  +I +L+K    +  P LV+N
Sbjct: 116 YIIIDCPAGIEQGYKNAVAGADKAIVVTTPEVSAVRDADRIIGLLEKEENVE-APKLVIN 174

Query: 337 QVKT---PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
           ++++        + + +  A L I    I+  D  V   S N G+ I  ++P S  +   
Sbjct: 175 RIRSHMMKNGDMLDVDEITAHLSIDLIGIVADDDEVIKAS-NHGEPI-ALNPNSKASVAY 232

Query: 394 VDFSRVLMGRV----TVSKPQSAMYTKIKKIFNMK 424
            + +R ++G       + +  + M TK+K+ F +K
Sbjct: 233 RNIARRILGEAVPLQQLEQENTGMLTKLKRFFGVK 267


>gi|172065278|ref|YP_001815990.1| response regulator receiver protein [Burkholderia ambifaria MC40-6]
 gi|171997520|gb|ACB68437.1| response regulator receiver protein [Burkholderia ambifaria MC40-6]
          Length = 402

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/265 (20%), Positives = 108/265 (40%), Gaps = 6/265 (2%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSISDAI 222
           +SF+  +GG G+S  A N A+ IA       LL DL+  +  A  +  D+ P +++    
Sbjct: 134 VSFMSCKGGAGTSFAASNVAYEIAEAHKRRVLLVDLNQQFADAAFLVSDETPPSTLPQLC 193

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDV 282
             + R+D AF+            +L       +  +  E  +  +L +    +  VI D+
Sbjct: 194 AQIERLDGAFLDASVAHVTPTFHVLAGAGDPVKAAEMREDALEWILGVAAPRYDFVIFDI 253

Query: 283 PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL-RPADKPPYLVLNQVKTP 341
               N  +   L  SD++ +     +  +R  + L+++L  L  P D+   +V    +  
Sbjct: 254 GVSINPLSMIALDRSDQIHLVLQPAMPHVRAGRRLLEILVSLGYPVDQLRLVVNRMTRAG 313

Query: 342 KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSR-VL 400
           ++   ++ +    LG+  S  IP D      + + G     V   +A+   L   ++ ++
Sbjct: 314 ERSRAALEEV---LGLHASCTIPDDADTVREALDLGHPASRVARGAAVTRALQACAKQIV 370

Query: 401 MGRVTVSKPQSAMYTKIKKIFNMKC 425
            G V      S+    + ++F  K 
Sbjct: 371 EGDVRTRHGTSSSEPLMSRLFGRKA 395


>gi|149200849|ref|ZP_01877824.1| ATPase, putative [Roseovarius sp. TM1035]
 gi|149145182|gb|EDM33208.1| ATPase, putative [Roseovarius sp. TM1035]
          Length = 416

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/288 (21%), Positives = 119/288 (41%), Gaps = 25/288 (8%)

Query: 65  IAEAVSCFSDSSTPDLIIVQTKVDSRE---VLSALEPLAEVCDSGTKVIVIGDTNDVSLY 121
            AEA++ F+      L  V   +D  +   ++   E ++     G KVI+I +    +  
Sbjct: 46  FAEALAFFNQPEANTLEFVAVAIDEADEDDLVMLGEIISLASKKGIKVILIAEDVSPAAL 105

Query: 122 RALISNHVSEYLIEPLSVADIINSISAIF-----TPQEEGKGSS-----------GCSIS 165
             L+     E++  PL   ++  +I  +       PQ +    +           G  ++
Sbjct: 106 HQLLRQGADEFVPYPLPEGELQAAIDRLRHAPPPMPQSQSAAQTHPALANPTAGDGVILA 165

Query: 166 FIGSRGGVGSSTIAHNCAFSIASVFAM---ETLLADLDLPYGTANINFDKDPINSISDAI 222
             G  GG G++T+A N A+ +A+V         L D  L +G+     D    + + +  
Sbjct: 166 VQGLSGGTGATTLAVNLAWELANVEKASPPRVCLLDFGLQFGSVATYLDLPRRDVVFEMW 225

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDV 282
                +D     +  V + + L +LTAPA +        + +  +L +  + F  V++D+
Sbjct: 226 SDTEALDDDIFRQALVAFEDKLWVLTAPADVLPLDMISSEDVNKLLSLARKHFDYVVIDM 285

Query: 283 PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP 330
           P     WT+ VL  S     T  LD   +R+++N + + + ++  D P
Sbjct: 286 PGSLVQWTEAVLHASQIYFATLELD---MRSAQNALRIKRAMQSEDLP 330


>gi|134300382|ref|YP_001113878.1| septum site-determining protein MinD [Desulfotomaculum reducens
           MI-1]
 gi|134053082|gb|ABO51053.1| septum site-determining protein MinD [Desulfotomaculum reducens
           MI-1]
          Length = 264

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/277 (23%), Positives = 122/277 (44%), Gaps = 27/277 (9%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIAS------VFAMETLLADLDLPYGTAN-INFDKD 213
           G  I     +GGVG +T   N    +AS      +   +  L +LD+  G  N I FD  
Sbjct: 2   GEVIVVTSGKGGVGKTTTTANLGTGLASHGKKVCLVDADIGLRNLDVVLGLENRIVFD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
               I D    V R+ +A +        E L +L A     +T    E+M+    D L++
Sbjct: 60  ----IVDVTSGVCRMRQALIKD---KRYEGLHLLPAAQTKDKTAVSPEQMVELTGD-LKK 111

Query: 274 IFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYL 333
            F  VI+D P       +  +  +DK ++ T+ +++ +R++  +I +L+      + P L
Sbjct: 112 EFDYVIIDCPAGIEQGFKNAIAGADKAIVVTTPEVSAVRDADRIIGLLEAAEL--REPKL 169

Query: 334 VLNQVKTP---KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIA 390
           ++N+ +T    +   +SI D    L I    ++P D  V  ++ N G+ +   D  S   
Sbjct: 170 IINRYRTKMVNRGDMMSIDDMNEILAIDLLGVVPEDEQVV-VTTNKGETVVR-DESSQSG 227

Query: 391 NLLVDFSRVLMGR---VTVSKPQSAMYTKIKKIFNMK 424
               + +R ++G    +   + Q+  ++ ++K+  +K
Sbjct: 228 QAYRNITRRILGENIPLMSLEEQAGFFSALRKMIGLK 264


>gi|85705153|ref|ZP_01036253.1| ATPase, putative [Roseovarius sp. 217]
 gi|85670475|gb|EAQ25336.1| ATPase, putative [Roseovarius sp. 217]
          Length = 453

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/290 (21%), Positives = 118/290 (40%), Gaps = 31/290 (10%)

Query: 65  IAEAVSCFSDSSTPDLIIVQTKVDSRE---VLSALEPLAEVCDSGTKVIVIGDTNDVSLY 121
            AEA++ F+      L  V   +D  +   ++   E +      G KVI+I +    +  
Sbjct: 85  FAEALAFFNQPEAESLEFVAVAIDEADEDDLVMLGEIIGLANKKGVKVILIAEDVTPAAL 144

Query: 122 RALISNHVSEYLIEPLSVADIINSI------------------SAIFTPQEEGKGSSGCS 163
             L+     E++  PL   ++  +I                  +A+ TP        G  
Sbjct: 145 HQLLRQGADEFVPYPLPEGELQAAIERLQTAPAPVHLAPALTHAALATP----TAGDGVI 200

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAM---ETLLADLDLPYGTANINFDKDPINSISD 220
            +  G  GG G++T+A N A+ +A++         L D  L +G+ +   D    + + +
Sbjct: 201 FAVQGLAGGTGATTLAVNLAWELANIEKANPPRVCLLDFSLQFGSVSTYLDLPRRDVVFE 260

Query: 221 AIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVIL 280
                  +D     +  V + E L +LTAP+ +        + +  VL +  + F  V++
Sbjct: 261 MWSDTEALDDDIFRQALVAFEEKLWVLTAPSDVLPLDMISSEDVNKVLALARKHFDYVVI 320

Query: 281 DVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP 330
           D+P     WT+ VL  +     T  LD   +R+++N + + + L+  D P
Sbjct: 321 DMPGSLVQWTEAVLHSAQVYFTTLELD---MRSAQNALRIKRALQSEDLP 367


>gi|299822795|ref|ZP_07054681.1| septum site-determining protein MinD [Listeria grayi DSM 20601]
 gi|299816324|gb|EFI83562.1| septum site-determining protein MinD [Listeria grayi DSM 20601]
          Length = 266

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/278 (22%), Positives = 129/278 (46%), Gaps = 27/278 (9%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKD 213
           G +I     +GGVG +T   N   ++A       +  M+  L +LD+  G  N I +D  
Sbjct: 2   GEAIVITSGKGGVGKTTSTANLGTALALQGKKVCLIDMDIGLRNLDVILGLENRIIYD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
               + D +    +I +A +      + + L +L A     ++    E+MI  V + L  
Sbjct: 60  ----LVDVVEGRCKIHQALIK--DKRFDDLLYLLPAAQTTDKSAVSGEQMIALVEE-LRP 112

Query: 274 IFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYL 333
            +  +++D P    +  +  +  +DK ++ T+ +++ +R++  +I +L+K   A +PP L
Sbjct: 113 DYDFILIDCPAGIETGYKNAVAGADKAIVVTTPEISAVRDADRIIGLLEK--EAIEPPKL 170

Query: 334 VLNQVKTPKKPE---ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIA 390
           ++N+++T        + I +  + L I    II  D AV   S+NSG  +  + P +  +
Sbjct: 171 IINRIRTQMMENGDVMDIDEITSHLSIELLGIIIDDDAVI-RSSNSGDPVALL-PNNRAS 228

Query: 391 NLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
               + +R ++G     +++   +   + K+K+ F  K
Sbjct: 229 QGYRNIARRILGESIPLMSIETKKKGFFAKLKRFFGGK 266


>gi|157693200|ref|YP_001487662.1| septum site determining protein [Bacillus pumilus SAFR-032]
 gi|194017217|ref|ZP_03055829.1| septum site-determining protein MinD [Bacillus pumilus ATCC 7061]
 gi|157681958|gb|ABV63102.1| septum site determining protein [Bacillus pumilus SAFR-032]
 gi|194011085|gb|EDW20655.1| septum site-determining protein MinD [Bacillus pumilus ATCC 7061]
          Length = 267

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/274 (20%), Positives = 121/274 (44%), Gaps = 17/274 (6%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI--NFDKDPINSI 218
           G +I     +GGVG +T + N   ++A +   +  L D D+     ++    +   I  +
Sbjct: 2   GEAIVITSGKGGVGKTTTSANLGTALA-IQGKKVCLVDTDIGLRNLDVVMGLENRIIYDL 60

Query: 219 SDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLV 278
            D +    +I +A V        E+L  L   A  S     + + I  ++  L+Q F  V
Sbjct: 61  VDVVEGRCKIHQALVKDKRF---EDLLYLLPAAQTSDKTAVEPEQIKELIQSLKQDFDYV 117

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQV 338
           ++D P       +  ++ +DK ++ T+ +++ +R++  +I +L++     +PP L++N++
Sbjct: 118 VIDCPAGIEQGFKNAVSGADKAIVVTTPEISAVRDADRIIGLLEQ--EDIEPPRLIVNRI 175

Query: 339 KT---PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVD 395
           +T        + + +    L I    I+  D  V   S N   ++  +D K+ ++    +
Sbjct: 176 RTHMAKSGDSMDVDEVVHHLSIDLLGIVADDDDVIKASNNGEPIV--MDAKNKVSIAYRN 233

Query: 396 FSRVLMGR----VTVSKPQSAMYTKIKKIFNMKC 425
            +R ++G      +       M+ K+K  F ++ 
Sbjct: 234 IARRVLGESVPLQSFEDENKGMFAKLKAFFGVRA 267


>gi|320008848|gb|ADW03698.1| response regulator receiver protein [Streptomyces flavogriseus ATCC
           33331]
          Length = 425

 Score = 54.7 bits (130), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 78/352 (22%), Positives = 143/352 (40%), Gaps = 37/352 (10%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS--LYRALISNHVSEYLIE 135
           P++++V  ++     + ALE + EV      V V+  T D S  L+ A +          
Sbjct: 56  PEVVLVHERIGP---VPALELIREVSLRFPAVGVVLITADASPGLFAASMDAGARGLATL 112

Query: 136 PLSVADIINSISA-----------IFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAF 184
           PLS  ++ N + A           + T  +   G  G  ++  G++GGVG+ T+      
Sbjct: 113 PLSYEELANRVQAAALWSTGVRRHLGTGGDVFTGPGGTVVTVTGAKGGVGA-TVTAVQLA 171

Query: 185 SIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENL 244
             A        L DLDL  G      D     S+ D +  +  I    +S     +   L
Sbjct: 172 LAAQASGYTAALVDLDLQTGDIAAYLDVQFRRSVVD-LAAITDISPRVLSDAVFSHDTGL 230

Query: 245 SILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITT 304
           ++L AP    R  +  ++    ++  L   + +V++D     N      + ++D  V+ T
Sbjct: 231 ALLLAPGEGERGEEVSDRAARQIVSALRSRYEVVVIDCGSQMNGANAAAIEMADTAVLVT 290

Query: 305 SLDLAGLRNSKNLIDVLKKL--RPADKPPYLVLN-----QVKTPKKPEISISDFCAPLGI 357
           + D+  +R +K ++ +  +L  R A++   LV       +++ P    I+ +        
Sbjct: 291 TPDVVAVRGAKRIVRMWDRLQIRKAEETVTLVNRFNRNTEIQPPLIQRITGTRMSGT--A 348

Query: 358 TPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKP 409
            P+      G V     +SG+M HE+DP+S +   L      L G + + KP
Sbjct: 349 VPANFKELQGVV-----DSGRM-HELDPRSTVKQALW----ALAGELGLVKP 390


>gi|167582060|ref|ZP_02374934.1| hypothetical protein BthaT_28212 [Burkholderia thailandensis TXDOH]
          Length = 412

 Score = 54.7 bits (130), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 103/229 (44%), Gaps = 10/229 (4%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSI---ASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  I+ +G+R G+G+ST+A N +  +   ++    +T L DL LP G   +  +      
Sbjct: 142 GRLIALLGARAGMGASTLAANLSVLVQKRSAAQGRQTALVDLGLPAGDGALFLNTRCEFD 201

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
             +A+  + R D+ FV+     ++  +++ + P  L+   D      V +L+ L   F  
Sbjct: 202 FVEAVRNLRRFDRTFVNTALARHSSGVALTSLPPNLAGLRDVSYASCVGLLNRLRAFFDC 261

Query: 278 VILDVPHVWNS-WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            I+D+    N  +  +    +D+  +     +A + ++  L++ L+          LV+N
Sbjct: 262 QIVDLGGFSNRDFVAQTANAADESWLLCDQGVASVVSAVELLESLRDAGVDTDNVRLVVN 321

Query: 337 QVKTPKKPEISI--SDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEV 383
           Q      P + +  +     LG+  +A +P      G +AN GK+I +V
Sbjct: 322 QY----DPALGLAPAQIAERLGLALAATLPSRRVPIGHAANQGKLIVDV 366


>gi|282865300|ref|ZP_06274352.1| response regulator receiver protein [Streptomyces sp. ACTE]
 gi|282559773|gb|EFB65323.1| response regulator receiver protein [Streptomyces sp. ACTE]
          Length = 415

 Score = 54.7 bits (130), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/261 (21%), Positives = 116/261 (44%), Gaps = 18/261 (6%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS--LYRALISNHVSEYLIE 135
           P++++V  ++     + ALE + EV      V V+  T D S  LY A + +     +  
Sbjct: 56  PEVVLVHERIGP---VPALELIREVALRFPAVGVVLVTADASPGLYSAAMDSGARGLVGL 112

Query: 136 PLSVADIINSISA-----IFTPQEEGKGS------SGCSISFIGSRGGVGSSTIAHNCAF 184
           PLS  ++   + A     +   +  G+G+       G  ++  G++GGVG++ +A   A 
Sbjct: 113 PLSYEELAQRVQAAAGWSVGVRRHLGQGAEVFTGPGGTVVTVSGAKGGVGTTVVAVQLAL 172

Query: 185 SIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENL 244
           + A+       L DLDL  G      D     SI D +  +  I    +      +   +
Sbjct: 173 A-ANASGHSVALVDLDLQSGDIASYLDVQFRRSIVD-LSTIQDISPRVLQDALFEHDTGM 230

Query: 245 SILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITT 304
           ++L AP    R  +  ++++   +  L   F +V++D     NS     + ++D+ ++ T
Sbjct: 231 ALLLAPGDGERGEEVSDRVVRQTVSALRHRFEVVVVDCGTHMNSANAAAIEMADRTLLVT 290

Query: 305 SLDLAGLRNSKNLIDVLKKLR 325
           + D+  +R +K ++ +  +L+
Sbjct: 291 TPDVVTVRAAKRMVRLWNRLQ 311


>gi|291485212|dbj|BAI86287.1| ATPase activator of MinC [Bacillus subtilis subsp. natto BEST195]
          Length = 268

 Score = 54.7 bits (130), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/275 (22%), Positives = 121/275 (44%), Gaps = 20/275 (7%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN----FDKDPIN 216
           G +I     +GGVG +T + N   ++A +      L D D+  G  N++     +   I 
Sbjct: 2   GEAIVITSGKGGVGKTTTSANLGTALA-ILGKRVCLVDTDI--GLRNLDVVMGLENRIIY 58

Query: 217 SISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFP 276
            + D +    ++ +A V        ++L  L   A  S       + I  ++  L+Q F 
Sbjct: 59  DLVDVVEGRCKMHQALVKDKRF---DDLLYLMPAAQTSDKTAVAPEQIKNMVQELKQEFD 115

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            VI+D P       +  ++ +DK ++ T+ +++ +R++  +I +L++    + PP LV+N
Sbjct: 116 YVIIDCPAGIEQGYKNAVSGADKAIVVTTPEISAVRDADRIIGLLEQEENVE-PPRLVVN 174

Query: 337 QVKT---PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
           +++         + I +    L I    I+  D  V   S N G+ I  +DPK+  +   
Sbjct: 175 RIRNHLMKNGDTMDIDEIVQHLSIDLLGIVADDDEVIKAS-NHGEPI-AMDPKNRASIAY 232

Query: 394 VDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
            + +R ++G       + +    M  KIK  F ++
Sbjct: 233 RNIARRILGESVPLQVLEEQNKGMMAKIKSFFGVR 267


>gi|83721217|ref|YP_443058.1| hypothetical protein BTH_I2541 [Burkholderia thailandensis E264]
 gi|167620223|ref|ZP_02388854.1| hypothetical protein BthaB_28210 [Burkholderia thailandensis Bt4]
 gi|257139288|ref|ZP_05587550.1| hypothetical protein BthaA_08799 [Burkholderia thailandensis E264]
 gi|83655042|gb|ABC39105.1| conserved hypothetical protein [Burkholderia thailandensis E264]
          Length = 412

 Score = 54.7 bits (130), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 103/229 (44%), Gaps = 10/229 (4%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSI---ASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  I+ +G+R G+G+ST+A N +  +   ++    +T L DL LP G   +  +      
Sbjct: 142 GRLIALLGARAGMGASTLAANLSVLVQKRSAAQGRQTALVDLGLPAGDGALFLNTRCEFD 201

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
             +A+  + R D+ FV+     ++  +++ + P  L+   D      V +L+ L   F  
Sbjct: 202 FVEAVRNLRRFDRTFVNTALARHSSGVALTSLPPNLAGLRDVSYASCVGLLNRLRAFFDC 261

Query: 278 VILDVPHVWNS-WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            I+D+    N  +  +    +D+  +     +A + ++  L++ L+          LV+N
Sbjct: 262 QIVDLGGFSNRDFVAQTANAADESWLLCDQGVASVVSAVELLESLRDAGVDTDNVRLVVN 321

Query: 337 QVKTPKKPEISI--SDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEV 383
           Q      P + +  +     LG+  +A +P      G +AN GK+I +V
Sbjct: 322 QY----DPALGLAPAQIAERLGLALAATLPSRRVPIGHAANQGKLIVDV 366


>gi|296131922|ref|YP_003639169.1| hypothetical protein TherJR_0382 [Thermincola sp. JR]
 gi|296030500|gb|ADG81268.1| conserved hypothetical protein [Thermincola potens JR]
          Length = 386

 Score = 54.7 bits (130), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 108/247 (43%), Gaps = 13/247 (5%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           ISF   +GG G + +A N A +I        LL DL L +G      +     SI+D   
Sbjct: 145 ISFYSVKGGCGKTFLAANVAQAIRLSTDKRVLLIDLCLQFGGVQRMLNLQGQRSIADLDP 204

Query: 224 PVGRIDKAFVSRLPVFYAEN--LSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILD 281
            +  +D++ ++ + +F  E+  L++L  PA         +  I  +L    + F  +ILD
Sbjct: 205 VIHELDESHINNI-LFTLEHSGLNVLLGPAKPDIAELLTDHHIELLLSACRRYFDYIILD 263

Query: 282 VPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKK--LRPADKPPYLVLNQVK 339
           +P   N  +   L  SD+++   + D   L   K  +D  ++  L   DK   LV    K
Sbjct: 264 LPAELNKVSITALNESDQIIYIVTPDSPALFGLKAAMDFFERYGLIEGDKFKILV---NK 320

Query: 340 TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPK----SAIANLLVD 395
             KK +++  D     GI   A I  D      + N+GK + E  PK    + +A  +V 
Sbjct: 321 VSKKSDLTTKDIEKITGIPILAGIRSDYKAIKNAVNTGKPLLE-KPKERVWNGVAKDVVK 379

Query: 396 FSRVLMG 402
            S+ L+G
Sbjct: 380 LSKQLVG 386


>gi|312883756|ref|ZP_07743475.1| hypothetical protein VIBC2010_14184 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368505|gb|EFP96038.1| hypothetical protein VIBC2010_14184 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 387

 Score = 54.7 bits (130), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 67/272 (24%), Positives = 129/272 (47%), Gaps = 22/272 (8%)

Query: 105 SGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSI 164
           +G +V+ +GD  +++ YRA++S    EYL+ P+     I++ +      ++ + ++G  I
Sbjct: 78  TGAQVVAVGDNREIAFYRAMVSAGACEYLLNPVE----ISAFNETEFQVDKAETTAGKVI 133

Query: 165 SFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYP 224
           + +G++GGVG STIA N A  +A    + T +AD+D   G  ++ +D     ++ + +  
Sbjct: 134 AVVGAKGGVGVSTIAANLARELAERGEVLT-VADMDFATGDLDLQYDVQGNTALVEMLQY 192

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL-----VI 279
             R++     R  +  ++ +++ T    L     + EK     LD   + F L     ++
Sbjct: 193 PERLEPVVYERSGIKVSDRVTLFTGYLSLDSPPFWPEK---SALDHFRK-FSLQHSDTLV 248

Query: 280 LDVPHVWNSWTQEV----LTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR--PADKPPYL 333
           LD+P    S   ++    L  +D  V+     L+ +RN   ++ +L  L    +DK   +
Sbjct: 249 LDLPSF--SMRDQIGFSSLAEADVRVLVLEPTLSSIRNIGQILALLDSLANGQSDKINLI 306

Query: 334 VLNQVKTPKKPEISISDFCAPLGITPSAIIPF 365
           VLN  K+ K   I+       LG     I+P+
Sbjct: 307 VLNHTKSDKASLINCHGVQRALGCEVDVILPY 338


>gi|311744545|ref|ZP_07718345.1| septum site determining protein [Aeromicrobium marinum DSM 15272]
 gi|311312164|gb|EFQ82081.1| septum site determining protein [Aeromicrobium marinum DSM 15272]
          Length = 375

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 100/221 (45%), Gaps = 18/221 (8%)

Query: 108 KVIVIGDTNDVSLYRALISNHV-SEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISF 166
           +V ++   +D +++RA +  H+ +  ++EP S  D ++ +        +G+G + C ++ 
Sbjct: 99  RVYLVAAGDDPAVWRAAV--HLGAAAVLEPTSEQDAVDVLGGAV----DGRGEA-CLVAV 151

Query: 167 IGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSI--SDAIYP 224
           +G+ GGVG+ST A   A    +   + +LL D D   G  ++    + ++ +  SD  + 
Sbjct: 152 VGACGGVGASTFAAGLAVR-GTRRGLRSLLVDADPCAGGIDLLMGAEHVDGVRWSDLGHT 210

Query: 225 VGRID-KAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVP 283
            GR+  +A    +P      L         +R     +    PVLD   + F LV+ DVP
Sbjct: 211 AGRVSAEALAEVVPTHRGVGL------VTWAREASIGDVRPGPVLDAAARGFDLVVADVP 264

Query: 284 HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL 324
                   +VL  +   V+  + D+ GL  ++  +  L  L
Sbjct: 265 RDPGRLGTDVLARAVLTVLVVTDDVRGLAAAERTMSHLAAL 305


>gi|17549307|ref|NP_522647.1| pilus assembly protein [Ralstonia solanacearum GMI1000]
 gi|17431559|emb|CAD18237.1| probable pilus assembly protein [Ralstonia solanacearum GMI1000]
          Length = 439

 Score = 54.3 bits (129), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 63/327 (19%), Positives = 136/327 (41%), Gaps = 10/327 (3%)

Query: 106 GTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSS-GCSI 164
           G  ++ +G  +D     A +   V +++    + A+ +  +  +   +   + +  G  +
Sbjct: 98  GLPLVAVGSASDGRAMLAALRAGVKDFIDVDGAPAEAVRVVRRLLAERASAEPTRRGRVL 157

Query: 165 SFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYP 224
           + +G+R GVG++T+A N A  +      + +L DL  P     +  +        +A+  
Sbjct: 158 AILGARPGVGTTTLASNLATLVRRTSGGDVMLLDLGQPLRDGALYLNVPANFHFVEAVRN 217

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH 284
           + R D+ FV      +   L++L  P  L+   D      + +L+ L   F L ++D+  
Sbjct: 218 LRRFDQVFVQTALSRHPNGLAVLPLPVSLAEMRDISFSEALGLLNRLRTFFDLQVVDLGG 277

Query: 285 VWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKK 343
             N  +  +++  +D V++ T   +  + ++  L+  LKK     +  +L+L+  K   +
Sbjct: 278 FNNIDFIAQLVKAADDVMLVTEQSVGAIVSAAELMQELKKREIDRERLHLILS--KFDAR 335

Query: 344 PEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMI---HEVDPK-SAIANLLVDFSRV 399
             +        L I     +P       +++N G M+   H +DP   AIA ++      
Sbjct: 336 LSLDAEQIGVRLEIPSVLTVPSRRRALVVASNQGAMLAETHPIDPYVRAIAGIVQTLGYT 395

Query: 400 LMGRVT--VSKPQSAMYTKIKKIFNMK 424
             G     V+   + M  ++ + F  K
Sbjct: 396 QPGERAPGVAGWMAGMRARLGERFRRK 422


>gi|83950068|ref|ZP_00958801.1| ATPase, putative [Roseovarius nubinhibens ISM]
 gi|83837967|gb|EAP77263.1| ATPase, putative [Roseovarius nubinhibens ISM]
          Length = 388

 Score = 53.9 bits (128), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 100/236 (42%), Gaps = 16/236 (6%)

Query: 108 KVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQE----------EGK 157
           +VI+I D        +L+     E++  PL   ++  +I  +  P E             
Sbjct: 70  QVILIADDVSPIALHSLLRQGADEFVPYPLPENELQAAIERLRKPAEPAPSATNNAPTAS 129

Query: 158 GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAM---ETLLADLDLPYGTANINFDKDP 214
           G  G  I   G  GG G++T+A N A+ +         +  + D  L  G+ +   D   
Sbjct: 130 GRDGVVIGVQGIAGGTGATTLAVNLAWELTLTDKKNPPKVCILDFSLQQGSVSTFLDLPR 189

Query: 215 INSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI 274
             ++ +       +D+         + ++L +LTAP  +        + +  VL++ + +
Sbjct: 190 REAVYEMWSDTETMDEDIFRSALQSHEDSLWVLTAPPDILPLDLISPEDVSRVLELAQSL 249

Query: 275 FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP 330
           F  VI+D+P     WT+ VLT S    +T  +D   +R+++N I + + L+  + P
Sbjct: 250 FDYVIIDMPTTLVQWTETVLTASQIYFVTIEMD---MRSAQNTIRLKRALQAEELP 302


>gi|163845611|ref|YP_001633655.1| septum site-determining protein MinD [Chloroflexus aurantiacus
           J-10-fl]
 gi|222523310|ref|YP_002567780.1| septum site-determining protein MinD [Chloroflexus sp. Y-400-fl]
 gi|163666900|gb|ABY33266.1| septum site-determining protein MinD [Chloroflexus aurantiacus
           J-10-fl]
 gi|222447189|gb|ACM51455.1| septum site-determining protein MinD [Chloroflexus sp. Y-400-fl]
          Length = 266

 Score = 53.9 bits (128), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 64/283 (22%), Positives = 128/283 (45%), Gaps = 39/283 (13%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKD 213
           G  I+    +GGVG +T   N   ++A      +V   +  L +LD+  G  N I +D  
Sbjct: 2   GRVITVTSGKGGVGKTTTTANLGTALAMRGARVAVVDADIGLRNLDVVMGLENRIVYD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVS--RLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDIL 271
               + D +    R+ +A +   RLP      L +L A    ++T D D      ++D+ 
Sbjct: 60  ----LVDVVEGRARLRQALIKDKRLP-----ELCLLPA----AQTRDKDAVSAQQMIDLT 106

Query: 272 EQI---FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPAD 328
            Q+   F  V++D P    +  +  +  +D+V+I T+ +++ +R++  ++ +++    A+
Sbjct: 107 RQLRAEFDFVLIDSPAGIEAGFRNAIAGADEVIIVTTPEVSAVRDADRIVGLIE---AAE 163

Query: 329 K-PPYLVLNQVK---TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVD 384
           K P  L++N++K     +   +S+ D    L I+   I+P D  +  ++ N G+     D
Sbjct: 164 KGPASLIINRIKPRLVSRGEMLSVEDVLELLAISLLGIVPEDETIV-IATNRGEA-AVYD 221

Query: 385 PKSAIANLLVDFSRVLMGR---VTVSKPQSAMYTKIKKIFNMK 424
           P S      ++ ++ L G    V     Q  M  ++  +F  +
Sbjct: 222 PNSLAGRAYINIAQRLAGEDVPVMAIPDQQGMLDRLLSLFGRR 264


>gi|16079851|ref|NP_390677.1| ATPase activator of MinC [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221310739|ref|ZP_03592586.1| ATPase activator of MinC [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221315064|ref|ZP_03596869.1| ATPase activator of MinC [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221319983|ref|ZP_03601277.1| ATPase activator of MinC [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221324265|ref|ZP_03605559.1| ATPase activator of MinC [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|400260|sp|Q01464|MIND_BACSU RecName: Full=Septum site-determining protein minD; AltName:
           Full=Cell division inhibitor minD
 gi|142859|gb|AAA22401.1| MinD protein [Bacillus subtilis]
 gi|143216|gb|AAA22609.1| putative [Bacillus subtilis]
 gi|580893|emb|CAA78818.1| MinD [Bacillus subtilis subsp. subtilis str. 168]
 gi|2635264|emb|CAB14759.1| ATPase activator of MinC [Bacillus subtilis subsp. subtilis str.
           168]
          Length = 268

 Score = 53.9 bits (128), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 61/275 (22%), Positives = 121/275 (44%), Gaps = 20/275 (7%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN----FDKDPIN 216
           G +I     +GGVG +T + N   ++A +      L D D+  G  N++     +   I 
Sbjct: 2   GEAIVITSGKGGVGKTTTSANLGTALA-ILGKRVCLVDTDI--GLRNLDVVMGLENRIIY 58

Query: 217 SISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFP 276
            + D +    ++ +A V        ++L  L   A  S       + I  ++  L+Q F 
Sbjct: 59  DLVDVVEGRCKMHQALVKDKRF---DDLLYLMPAAQTSDKTAVAPEQIKNMVQELKQEFD 115

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            VI+D P       +  ++ +DK ++ T+ +++ +R++  +I +L++    + PP LV+N
Sbjct: 116 YVIIDCPAGIEQGYKNAVSGADKAIVVTTPEISAVRDADRIIGLLEQEENIE-PPRLVVN 174

Query: 337 QVKT---PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
           +++         + I +    L I    I+  D  V   S N G+ I  +DPK+  +   
Sbjct: 175 RIRNHLMKNGDTMDIDEIVQHLSIDLLGIVADDDEVIKAS-NHGEPI-AMDPKNRASIAY 232

Query: 394 VDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
            + +R ++G       + +    M  KIK  F ++
Sbjct: 233 RNIARRILGESVPLQVLEEQNKGMMAKIKSFFGVR 267


>gi|115361038|ref|YP_778175.1| response regulator receiver protein [Burkholderia ambifaria AMMD]
 gi|115286366|gb|ABI91841.1| response regulator receiver protein [Burkholderia ambifaria AMMD]
          Length = 402

 Score = 53.5 bits (127), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 86/205 (41%), Gaps = 5/205 (2%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN-INFDKDPINSISDAI 222
           +SF+  +GG G+S  A N A+ IA       LL DL+  +  A  +  D+ P +++    
Sbjct: 134 VSFMSCKGGAGTSFAASNVAYEIAEAHKRRVLLVDLNQQFADAAFLVSDETPPSTLPQLC 193

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDV 282
             + R+D AF+            +L       +  +  E  +  +L +    +  VI D+
Sbjct: 194 AQIERLDGAFLDASVAHVTPTFHVLAGAGDPVKAAEMREDALEWILGVAAPRYDFVIFDI 253

Query: 283 PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL-RPADKPPYLVLNQVKTP 341
               N  +   L  SD++ +     +  +R  + L+++L  L  P D+   +V    +  
Sbjct: 254 GVSINPLSMIALDRSDQIQLVLQPAMPHVRAGRRLLEILVSLGYPVDQLRLVVNRMTRAG 313

Query: 342 KKPEISISDFCAPLGITPSAIIPFD 366
            +   ++ +    LG+  S  IP D
Sbjct: 314 DRSRAALEEV---LGLHASCTIPDD 335


>gi|319651720|ref|ZP_08005846.1| hypothetical protein HMPREF1013_02458 [Bacillus sp. 2_A_57_CT2]
 gi|317396539|gb|EFV77251.1| hypothetical protein HMPREF1013_02458 [Bacillus sp. 2_A_57_CT2]
          Length = 267

 Score = 53.5 bits (127), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 60/275 (21%), Positives = 127/275 (46%), Gaps = 20/275 (7%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN----FDKDPIN 216
           G +I     +GGVG +T + N   ++A +      L D D+  G  N++     +   I 
Sbjct: 2   GEAIVITSGKGGVGKTTTSANVGTALA-LQGKRVCLVDTDI--GLRNLDVVMGLENRIIY 58

Query: 217 SISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFP 276
            + D +    +I +A V      + + L +L A     +T    E+M   ++D L+Q + 
Sbjct: 59  DLVDVVEGRCKIHQAVVK--DKRFDDLLYLLPAAQTSDKTAVTPEQM-KKLVDELKQDYD 115

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            +++D P       +  +  +DK ++ T+ +++ +R++  +I +L+K    +  P L++N
Sbjct: 116 YIVIDCPAGIEQGYKNAVAGADKAIVVTTPEVSAVRDADRIIGLLEKEENVE-APKLIIN 174

Query: 337 QVKT---PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
           ++++        + + +  A L I    I+  D  V   S N G+ I  ++P S  +   
Sbjct: 175 RIRSHMMKNGDMLDVDEITAHLSIDLIGIVADDDEVIKAS-NHGEPI-ALNPNSKASIAY 232

Query: 394 VDFSRVLMGRVTVSKP----QSAMYTKIKKIFNMK 424
            + +R ++G     +P       +++K+KK F +K
Sbjct: 233 RNIARRILGEAVPLQPLEEENKGVFSKLKKFFGVK 267


>gi|163745844|ref|ZP_02153203.1| ATPase, putative [Oceanibulbus indolifex HEL-45]
 gi|161380589|gb|EDQ04999.1| ATPase, putative [Oceanibulbus indolifex HEL-45]
          Length = 416

 Score = 53.5 bits (127), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 65/306 (21%), Positives = 126/306 (41%), Gaps = 30/306 (9%)

Query: 108 KVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAI----------------FT 151
           +VI+I +    +   +L+     E++  PL   ++  +I+ +                  
Sbjct: 91  RVILIAEDMTPAALHSLLRQGADEFVPYPLPEGELAQAIARVRAGENAPPAPAAETESAA 150

Query: 152 PQ-EEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASV---FAMETLLADLDLPYGTAN 207
           PQ + G    G  I   G  GG G++T+A N A+ +A+     A    L D DL  G+  
Sbjct: 151 PQLKAGARKDGALIVVHGLAGGTGATTLAVNLAWELANADKKNAPSVCLLDFDLQSGSVA 210

Query: 208 INFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPV 267
              D     ++ + +     +D+    +    + + L +LTAPA +        + +  +
Sbjct: 211 TFLDLQRREAVYEMMSDTQSMDEEIFGQALQTFEDKLHVLTAPAEMLPLDIITNEDVERI 270

Query: 268 LDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPA 327
           L +    F  VI+D+P     W++ VLT +        LD   +R+++N +   + L+ +
Sbjct: 271 LSMACNQFDYVIVDMPSTLVQWSETVLTSAHIYFAMLELD---MRSAQNALRFKRALQ-S 326

Query: 328 DKPPYLVLNQV--KTPKKPEIS----ISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIH 381
           ++ P+  L  V  + PK  ++S    +      L I+    +P  G     + + G  + 
Sbjct: 327 EELPFEKLRYVMNRAPKFTDLSAKSRVKRMAESLSISIDVQLPDGGKAVTQANDHGLPLA 386

Query: 382 EVDPKS 387
              PKS
Sbjct: 387 NSAPKS 392


>gi|168187578|ref|ZP_02622213.1| septum site-determining protein MinD [Clostridium botulinum C str.
           Eklund]
 gi|169294502|gb|EDS76635.1| septum site-determining protein MinD [Clostridium botulinum C str.
           Eklund]
          Length = 265

 Score = 53.1 bits (126), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 123/279 (44%), Gaps = 34/279 (12%)

Query: 163 SISFIGSRGGVGSSTIAHNCAFSIAS------VFAMETLLADLDLPYGTAN-INFDKDPI 215
           +I     +GGVG +T   N   ++AS      V   +T L +LD+  G  N I F     
Sbjct: 4   AIVITSGKGGVGKTTTTANIGTALASLGKKVVVVDGDTGLRNLDVLMGLENRIVF----- 58

Query: 216 NSISDAIYPVGRIDKAFVS--RLPVFYAENLSILTAPAMLSR-TYDFDEKMIVPVLDILE 272
            ++ D I    RI +A +   R P     NL +L  P   +R   D   + ++ ++ IL+
Sbjct: 59  -TLLDVIEERCRIKQALIKDKRFP-----NLCLL--PTAQTRDKNDVSSEQMLSLVKILK 110

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY 332
           + F  VI+D P       +  +  +DK ++  + ++  +R++  +I  L      D   +
Sbjct: 111 EEFDYVIIDSPAGIEQGFENAIIGADKALVVVNPEVTSVRDADRVIGKLDAKGIDDH--H 168

Query: 333 LVLNQVK---TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAI 389
           LV+N++      K   + ++D    L I    ++P D  +  ++ N G+ +  ++ K+  
Sbjct: 169 LVVNRLSYDMVKKGDMLDVNDILDSLAIKLMGVVPIDEEIT-VATNKGEPVV-LNTKAIS 226

Query: 390 ANLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
                + +R + G      T    QS     +KKIFN+K
Sbjct: 227 GKAFTNIARRITGENVPIETFDNHQSGFLASLKKIFNLK 265


>gi|332295528|ref|YP_004437451.1| septum site-determining protein MinD [Thermodesulfobium narugense
           DSM 14796]
 gi|332178631|gb|AEE14320.1| septum site-determining protein MinD [Thermodesulfobium narugense
           DSM 14796]
          Length = 269

 Score = 53.1 bits (126), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 116/276 (42%), Gaps = 23/276 (8%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI--NFDKDPINSI 218
           G  I     +GGVG +T + N    +AS+     LLAD+D+     +I    +K  +  +
Sbjct: 2   GKCIVVTSGKGGVGKTTTSANLGGGLASL-GKSVLLADVDIGLRNLDIIMGLEKRIVYDV 60

Query: 219 SDAIYPVGRIDKAFV--SRLPVFYAENLSILTAPAMLSRTYD-FDEKMIVPVLDILEQIF 275
            D +    +I +A V   RL   Y    S +   + L+   D F E     ++  L++ F
Sbjct: 61  MDVMEGRCKIQQAIVRDKRLNSLYLLAASQIHDKSDLAELIDRFGE-----IIKGLKKEF 115

Query: 276 PLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVL 335
             VILD P             +D+ ++ T+ ++  +R++  +I +L+      K  YL+L
Sbjct: 116 DYVILDSPAGIEQGFMAASNFADEAIVVTTPEVTAVRDADRVIGLLEA--KGIKDHYLIL 173

Query: 336 NQVK---TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANL 392
           N+ +         + + D    LGI    I+P D  +    AN G+++   D   +    
Sbjct: 174 NRYRYAMVKSGNMLDVEDVLHILGIQLLGIVPEDPEIITF-ANRGELVVTSDLTIS-GKA 231

Query: 393 LVDFSRVLMGRVTVSKP----QSAMYTKIKKIFNMK 424
               SR L+G   V  P       ++ KIK  F  K
Sbjct: 232 FQRISRRLIGE-KVDFPSFEEDKGLFNKIKNFFKAK 266


>gi|300697741|ref|YP_003748402.1| response receiver involved in pilum assembly [Ralstonia
           solanacearum CFBP2957]
 gi|299074465|emb|CBJ54015.1| putative response receiver involved in pilum assembly [Ralstonia
           solanacearum CFBP2957]
          Length = 439

 Score = 53.1 bits (126), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 59/272 (21%), Positives = 111/272 (40%), Gaps = 9/272 (3%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISD 220
           G  ++ +G+R GVG++T+A N A  +      + +L DL  P     +  +        +
Sbjct: 154 GRVLAILGARPGVGTTTLAANLATLVRRTAGSDVMLLDLGQPLRDGALYLNVPANFHFVE 213

Query: 221 AIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVIL 280
           A+  + R D+ FV      +   L +L  P  L+   D      + +L+ L   F L ++
Sbjct: 214 AVRNLRRFDQVFVQTALSRHPNGLVVLPLPVSLAEMRDISFSEALGLLNRLRTFFDLQVV 273

Query: 281 DVPHVWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVK 339
           D+    N  +  +++  +D V++ T   +  + ++  L+  LKK R  D+   L L   K
Sbjct: 274 DLGGFNNIDFIAQLVKAADDVMLVTEQSVGAIVSAAELVQELKK-REIDR-DQLHLTISK 331

Query: 340 TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDP----KSAIANLLVD 395
              +  +        LGI     +P       +++N G  + E  P      AIA ++  
Sbjct: 332 FDARLSLDAEQIAERLGIPSVMTVPSRRQALVVASNQGATLAETRPIDPYVRAIAGIVQT 391

Query: 396 FSRVLMGRV--TVSKPQSAMYTKIKKIFNMKC 425
                 G     V+   + M T++ + F  K 
Sbjct: 392 LGYTQPGERPPGVAGWMAGMRTRLGERFRRKS 423


>gi|220922533|ref|YP_002497835.1| Flp pilus assembly protein ATPase CpaE-like protein
           [Methylobacterium nodulans ORS 2060]
 gi|219947140|gb|ACL57532.1| Flp pilus assembly protein ATPase CpaE-like protein
           [Methylobacterium nodulans ORS 2060]
          Length = 421

 Score = 53.1 bits (126), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/242 (21%), Positives = 107/242 (44%), Gaps = 6/242 (2%)

Query: 87  VDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSI 146
           +D   +   +E ++   D G  +IV  D     +YR L+ +   E++       DI  ++
Sbjct: 83  IDQSHLRGMIEAISRKPD-GPFLIVASDLLPAEIYRDLVRSATGEWVRWQSLAPDIDEAL 141

Query: 147 SAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAME---TLLADLDLPY 203
             +   +   +  +   +SF+ + GGVG++T A   A ++AS    +     + DL+L +
Sbjct: 142 RRLTRGRAPAEAHAAAIVSFLPAGGGVGNTTHAAETAIALASRKGHQRRRVAVLDLNLDH 201

Query: 204 GTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSIL-TAPAMLSRTYDFDEK 262
            +     D +P   +++      R+D   +  L   ++  +    +AP+ +       E 
Sbjct: 202 SSIPDFLDIEPRFDLAEITADPNRLDSHLIELLKTTHSSGVDFFCSAPSEIDLAGQ-GEV 260

Query: 263 MIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK 322
            +  +LD L   + L+ +D+P +W SW   +L  SD VV++    +  ++ +   +  L 
Sbjct: 261 AVFTLLDALSLRYDLIHIDLPWIWFSWLGNLLGGSDAVVVSARQTVPSIKRAAERVRRLT 320

Query: 323 KL 324
            L
Sbjct: 321 AL 322


>gi|323702232|ref|ZP_08113898.1| ATPase-like protein, involved in chromosome partitioning
           [Desulfotomaculum nigrificans DSM 574]
 gi|323532722|gb|EGB22595.1| ATPase-like protein, involved in chromosome partitioning
           [Desulfotomaculum nigrificans DSM 574]
          Length = 499

 Score = 53.1 bits (126), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 68/151 (45%), Gaps = 7/151 (4%)

Query: 151 TPQEEGKGSSGCSISF-IGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN 209
           TP +E  G     ++F + ++GGVG +T  HN   ++++   ++T+L DLD         
Sbjct: 214 TPTDEWYGGRKGLMTFTVANKGGVGKTTTNHNLGIALSNS-KIKTVLWDLDFEGPDLGTF 272

Query: 210 FDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLD 269
           F  D  N +        RI  A V  +     ENL IL  P M     DF    +  + D
Sbjct: 273 FKID--NGLGIEYLANKRITPAMVEDVLFEVNENLYILPGP-MKPGIPDFRPGQLTQIAD 329

Query: 270 ILEQIFPLVILDVPHVWNS--WTQEVLTLSD 298
           IL   F +VI D P  +    W +E+  L+D
Sbjct: 330 ILRNRFDVVIGDTPPGFTDKWWLKELFKLTD 360


>gi|296331656|ref|ZP_06874125.1| ATPase activator of MinC [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305675385|ref|YP_003867057.1| ATPase activator of MinC [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|296151251|gb|EFG92131.1| ATPase activator of MinC [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305413629|gb|ADM38748.1| ATPase activator of MinC [Bacillus subtilis subsp. spizizenii str.
           W23]
          Length = 268

 Score = 53.1 bits (126), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 61/275 (22%), Positives = 124/275 (45%), Gaps = 20/275 (7%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN----FDKDPIN 216
           G +I     +GGVG +T + N   ++A +      L D D+  G  N++     +   I 
Sbjct: 2   GEAIVITSGKGGVGKTTTSANLGTALA-ILGKRVCLLDTDI--GLRNLDVVMGLENRIIY 58

Query: 217 SISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFP 276
            + D +    ++ +A V      + + L ++ A     +T    E+ I  ++  L+Q F 
Sbjct: 59  DLVDVVEGRCKMHQALVK--DKRFDDLLYLMPAAQTSDKTAVVPEQ-IKNMVQQLKQEFD 115

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            VI+D P       +  ++ +DK ++ T+ +++ +R++  +I +L++    + PP LV+N
Sbjct: 116 YVIIDCPAGIEQGYKNAVSGADKAIVVTTPEISAVRDADRIIGLLEQEENIE-PPRLVVN 174

Query: 337 QVKT---PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
           +++         + I +    L I    I+  D  V   S N G+ I  +DPK+  +   
Sbjct: 175 RIRNHLMKNGDTMDIDEIVQHLSIDLLGIVADDDEVIKAS-NHGEPI-AMDPKNRASIAY 232

Query: 394 VDFSRVLMGRVT----VSKPQSAMYTKIKKIFNMK 424
            + +R ++G       + +    M  KIK  F ++
Sbjct: 233 RNIARRILGESVPLQLLEEQNKGMMAKIKSFFGVR 267


>gi|167624200|ref|YP_001674494.1| Flp pilus assembly protein ATPase CpaE-like protein [Shewanella
           halifaxensis HAW-EB4]
 gi|167354222|gb|ABZ76835.1| Flp pilus assembly protein ATPase CpaE-like protein [Shewanella
           halifaxensis HAW-EB4]
          Length = 408

 Score = 53.1 bits (126), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 105/229 (45%), Gaps = 7/229 (3%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           ++ I  + G G+S ++ + A  ++     +  L D+DL +GT       D   SI D + 
Sbjct: 152 VAIINGKAGSGASFLSASLADVVSQREGSDLALLDMDLHHGTLAHILGCDAKYSICDVLG 211

Query: 224 PVGRIDKAFVSRLPVFYAENLSILTAP--AMLSRTYDFDEKMIVPVLDILEQIFPLVILD 281
            +  +D+  + +  +    NLS+L A    +L+   + D   I  ++    Q +  VILD
Sbjct: 212 TIEDLDEIAL-KSTMTKNGNLSLLAAKPFELLTLDEEVDFNRIKELIWKYRQFYKQVILD 270

Query: 282 VPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLI-DVLKKLRPADKPPYLVLNQVKT 340
                  W  ++L L+  ++I T  ++  LR +K+LI  + K +  A +   LV+N+   
Sbjct: 271 FSRGPEDWNCDLL-LNATILIVTQQNIMHLRQTKDLIFQLTKNMGIASEQINLVVNRYN- 328

Query: 341 PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAI 389
            K   I +SD    LGI+  + +  D  +     + GK + EV  K  I
Sbjct: 329 -KNSNIKLSDIKEALGISSISTVINDYKLSNECVDLGKPLTEVARKQKI 376


>gi|171317114|ref|ZP_02906317.1| response regulator receiver protein [Burkholderia ambifaria MEX-5]
 gi|171097748|gb|EDT42575.1| response regulator receiver protein [Burkholderia ambifaria MEX-5]
          Length = 421

 Score = 53.1 bits (126), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 59/299 (19%), Positives = 116/299 (38%), Gaps = 21/299 (7%)

Query: 106 GTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSIS 165
           G  ++ +G         A +   V +++       D + +   +     E     G  ++
Sbjct: 86  GLPIVALGSLAQPESTLAALRAGVRDFIDVSAPAEDALRTTRGLLEHVGEPASRHGKLVA 145

Query: 166 FIGSRGGVGSSTIAHNCAFSIA---------------SVFAMETLLADLDLPYGTANINF 210
            +G+R G+G ST+A N A  +                +    +T L DL LP G   +  
Sbjct: 146 LLGARAGMGVSTLAANLAVWLQKRAAGPGAGAIPNSETAAGRQTALIDLGLPAGDGALFL 205

Query: 211 DKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDI 270
           +        DA++ + RID+ FV+     +   +++ T P  L    D      V +L+ 
Sbjct: 206 NTRCEFHFVDAVHNLRRIDRTFVNTALTRHHSGVALTTLPPDLGGLRDMSYASCVGLLNR 265

Query: 271 LEQIFPLVILDVPHVWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADK 329
               F   ++D+    N  +  ++   +D+  +     +A +  + +L+  L+       
Sbjct: 266 FRAFFDQQVVDLGGFSNHEFVAQIAASADEAWLVCDQGVASIVAAADLLASLRDASVDTD 325

Query: 330 PPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMI---HEVDP 385
              LV+NQ       +++ S     LG+  +  +P      G +AN G++I    E DP
Sbjct: 326 RTQLVVNQYD--PALDLTPSQIAERLGLPLAGTLPSRRVPIGHAANQGRLIVDMAERDP 382


>gi|284048525|ref|YP_003398864.1| response regulator receiver protein [Acidaminococcus fermentans DSM
           20731]
 gi|283952746|gb|ADB47549.1| response regulator receiver protein [Acidaminococcus fermentans DSM
           20731]
          Length = 272

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 96/219 (43%), Gaps = 16/219 (7%)

Query: 157 KGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPIN 216
           +G  G   +   +   VG + +A N A  +A    ++  LADLDL +G        +P  
Sbjct: 2   EGRKGTLFTVFSTAYAVGKTLLAINIAAELARQ-GLKVCLADLDLQFGDVCYYLKLNPER 60

Query: 217 SISDA-----IYPVGRIDKAFVSRLPVFYAE---NLSILTAPAMLSRTYDFDEKMIVPVL 268
           +I+DA      +P   +   +++R    Y E      +L  P +L   Y+ D  +I  ++
Sbjct: 61  TIADAQKSMEQHPKDTVAVEYLTR----YQEGNTGFDVLANPKLLEEAYNMDNNIIKSLV 116

Query: 269 DILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLD-LAGLRNSKNLIDVLKKLRPA 327
             L+  +  VILD    +++    ++ +S  +     +D +  ++N K   D LK+L   
Sbjct: 117 LQLQLEYDYVILDTTSTFSALNLLLMDMSTLINFVGIVDFIPTIKNMKRGSDTLKELGYD 176

Query: 328 DKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFD 366
           D     VLN  ++  K  I + D  + LG     ++P D
Sbjct: 177 DSKIRYVLN--RSNAKTRIDVEDVESILGKHFDFVLPND 213


>gi|325190593|emb|CCA25090.1| septum sitedetermining protein minD putative [Albugo laibachii
           Nc14]
          Length = 296

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 108/238 (45%), Gaps = 31/238 (13%)

Query: 159 SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF--DKDPIN 216
            SG  +     +GGVG +T+  +  + +A      T L D D+     +++   ++  I 
Sbjct: 27  QSGRVVVVTSGKGGVGKTTVTASIGYGLAER-GYRTCLIDFDIGLRNLDLHLGCERRVIF 85

Query: 217 SISDAIYPVGRIDKAFVS--RLPVFYAENLSILTAPAMLSRTYD---FDEKMIVPVLDIL 271
                I    R+++A +   RL     ENLS+L A    S+T D     E  +  VLD L
Sbjct: 86  DFIHVIERNCRLNQALIKDKRL-----ENLSLLAA----SQTRDKEALTETGVEEVLDDL 136

Query: 272 EQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL--KKLRPAD- 328
           +Q F  +I D P    S  +  +  +D+ +I T+ +++  R+S  ++  +    LR  + 
Sbjct: 137 KQQFDYIICDSPAGIESGARHAMYFADEAIIVTNPEISSCRDSDKMVGYISSSSLRAIEN 196

Query: 329 -KPPYLVL-------NQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
            +P +  L       N+VK+ +   +S+ D    LG++   +IP    V   S+N G+
Sbjct: 197 RQPVHQTLLINRYDANRVKSDEC--LSVDDIEEMLGLSVLGVIPESAQVL-TSSNMGQ 251


>gi|325518466|gb|EGC98165.1| pilus assembly protein [Burkholderia sp. TJI49]
          Length = 424

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 73/373 (19%), Positives = 144/373 (38%), Gaps = 36/373 (9%)

Query: 32  HVFCVTDTLYSV--VERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDS 89
           HV  + DTL S   VE + ++P           G +A+ ++  +    P L+ +     S
Sbjct: 26  HVRWLADTLVSAGAVEAASLEP-----------GVLAQRITGIN----PALVFIDFSEGS 70

Query: 90  REVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAI 149
            E  S    +      G  ++ +G         A +   V +++       + + +   +
Sbjct: 71  -EAASVAAAMVRAAHPGLPIVALGSLAQPESTLAALRAGVRDFIDVSAPAEEALRTTRGL 129

Query: 150 FTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSI--------------ASVFA-MET 194
                E     G  ++ +G+R G+G ST+A N A  +               SV A  +T
Sbjct: 130 LANVGEPASRHGKVVALLGARAGMGVSTLAANLAVWLQKRALGPGAAAADGGSVPAGRQT 189

Query: 195 LLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLS 254
            L DL LP G A +  +        DA+  + RID+ FV+     +   +++ T P  L 
Sbjct: 190 ALVDLGLPAGDATLFLNTRCEFHFVDAVQNLRRIDRTFVNTALTRHQSGVALTTLPPDLG 249

Query: 255 RTYDFDEKMIVPVLDILEQIFPLVILDVPHVWN-SWTQEVLTLSDKVVITTSLDLAGLRN 313
              +      + +L+     F   ++D+    N  +  ++   +D+  +     +A + +
Sbjct: 250 GLREVSYASCIGLLNRFRAFFDQQVVDLGGFSNREFVTQIAASADEAWLVCDQGVASIVS 309

Query: 314 SKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMS 373
           + +L+  L+          LV+NQ        +        LG++    +P      G +
Sbjct: 310 AADLVTGLRDAGIDTDRVKLVVNQYDA--DLNLMPGQIAERLGLSLVGTLPARRVAIGQA 367

Query: 374 ANSGKMIHEVDPK 386
           AN G++I +V  +
Sbjct: 368 ANQGRLIIDVAER 380


>gi|328884724|emb|CCA57963.1| putative septum site-determining protein [Streptomyces venezuelae
           ATCC 10712]
          Length = 422

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 74/341 (21%), Positives = 142/341 (41%), Gaps = 43/341 (12%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS--LYRALISNHVSEYLIE 135
           P++++V  ++     + ALE + EV      V V+  T D S  L+ A + +     +  
Sbjct: 56  PEVVLVHERIGP---VPALELVREVALRFPAVGVVLITADASPVLFSAAMDSGARGLVTL 112

Query: 136 PLSVADIINSISA-----------IFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAF 184
           PL   ++ + + A           +    E+  G  G  ++  G++GGVG++  A + A 
Sbjct: 113 PLGYEELASRVQAAAQWSVGVRRHLGAGAEQITGPGGTVVTVSGAKGGVGATVTAVHLAL 172

Query: 185 SIASVFAMETLLADLDLPYGTANINFDKDPINSISDA-----IYPVGRIDKAFVSRLPVF 239
           + A        L D+DL  G      D     S++D      I P    D  FV      
Sbjct: 173 A-ARASGRTVALVDMDLQSGDIASYLDVQFRRSVADLATIADISPRVLQDAVFV------ 225

Query: 240 YAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDK 299
           +   LS+L APA   R  +  ++    ++  L     +V++D     NS     + ++D 
Sbjct: 226 HETGLSLLLAPAEGERGEEVTDRAARQIVSALRGRHEVVVVDCGSQLNSANAAAIEMADT 285

Query: 300 VVITTSLDLAGLRNSKNLIDVLKKL--RPADKPPYLV-----LNQVKTPKKPEISISDFC 352
            V+  + D+  +R +K  + + ++L  R A++   LV       +++ P   +I+ +   
Sbjct: 286 AVLVATPDVVAVRAAKRTVRMWERLQVRKAEETVTLVNRHHRATEIQPPLVQKITGTRIA 345

Query: 353 APLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
              G+     +P          ++G++ HE+D KS +   L
Sbjct: 346 ---GVA----VPAHFKELQAVVDAGRL-HELDAKSTVKQAL 378


>gi|157961839|ref|YP_001501873.1| Flp pilus assembly protein ATPase CpaE-like protein [Shewanella
           pealeana ATCC 700345]
 gi|157846839|gb|ABV87338.1| Flp pilus assembly protein ATPase CpaE-like protein [Shewanella
           pealeana ATCC 700345]
          Length = 408

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 103/232 (44%), Gaps = 13/232 (5%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           ++ I  + G G+S I+ + A   +     +  L D+DL +GT +     D   SI D I 
Sbjct: 152 VAVINGKAGSGASFISASLADVASQREGSDLALLDMDLHHGTLSHILGYDAKYSICDVIE 211

Query: 224 PVGRIDKAFVSRLPVFYAENLSILTAP--AMLSRTYDFDEKMIVPVLDILEQIFPLVILD 281
            +  +D+  + +  +    NLS+L A    +L+   D D   I  ++    Q +  VILD
Sbjct: 212 TIEDLDEIAL-KSTMTKKGNLSLLAAKPFELLTLDQDVDFSRINELMWKYRQFYKQVILD 270

Query: 282 V---PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL-KKLRPADKPPYLVLNQ 337
               P  WN      L LS  +++ T  ++  LR +K+LI+ L  ++        LV+N+
Sbjct: 271 FSRGPEDWNC----NLLLSATILVVTQQNIMHLRQTKDLINQLTTRMGINSNQITLVVNR 326

Query: 338 VKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAI 389
               K   I +SD    +GI+    +  D  +     + GK I +V  K  I
Sbjct: 327 YN--KNSNIKLSDIEEAIGISSINTVVNDYKLSNECVDLGKPITQVAKKHRI 376


>gi|161524904|ref|YP_001579916.1| response regulator receiver protein [Burkholderia multivorans ATCC
           17616]
 gi|189350346|ref|YP_001945974.1| pilus assembly protein [Burkholderia multivorans ATCC 17616]
 gi|160342333|gb|ABX15419.1| response regulator receiver protein [Burkholderia multivorans ATCC
           17616]
 gi|189334368|dbj|BAG43438.1| pilus assembly protein [Burkholderia multivorans ATCC 17616]
          Length = 424

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 73/373 (19%), Positives = 144/373 (38%), Gaps = 36/373 (9%)

Query: 32  HVFCVTDTLYSV--VERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDS 89
           HV  + DTL S   VE + ++P           G +A+ ++  +    P L+ +     S
Sbjct: 26  HVRWLADTLVSAGAVEAASLEP-----------GVLAQRITGIN----PALVFIDFSEGS 70

Query: 90  REVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAI 149
            E  S    +      G  ++ +G         A +   V +++       + + +   +
Sbjct: 71  -EAASVAAAMVRAAHPGLPIVALGSLAQPESTLAALRAGVRDFIDVSAPAEEALRTTRGL 129

Query: 150 FTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSI--------------ASVFA-MET 194
                E     G  ++ +G+R G+G ST+A N A  +               SV A  +T
Sbjct: 130 LANVGEPASRHGKVVALLGARAGMGVSTLAANLAVWLQKRALGPGAAAADGGSVPAGRQT 189

Query: 195 LLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLS 254
            L DL LP G A +  +        DA+  + RID+ FV+     +   +++ T P  L 
Sbjct: 190 ALVDLGLPAGDATLFLNTRCEFHFVDAVQNLRRIDRTFVNTALTRHQSGVALTTLPPDLG 249

Query: 255 RTYDFDEKMIVPVLDILEQIFPLVILDVPHVWN-SWTQEVLTLSDKVVITTSLDLAGLRN 313
              +      + +L+     F   ++D+    N  +  ++   +D+  +     +A + +
Sbjct: 250 GLREVSYASCIGLLNRFRAFFDQQVVDLGGFSNREFVTQIAASADEAWLVCDQGVASIVS 309

Query: 314 SKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMS 373
           + +L+  L+          LV+NQ        +        LG++    +P      G +
Sbjct: 310 AADLVTGLRDAGIDTDRVKLVVNQYDA--DLNLMPGQIAERLGLSLVGTLPARRVAIGQA 367

Query: 374 ANSGKMIHEVDPK 386
           AN G++I +V  +
Sbjct: 368 ANQGRLIIDVAER 380


>gi|86360585|ref|YP_472473.1| putative pilus assembly protein [Rhizobium etli CFN 42]
 gi|86284687|gb|ABC93746.1| putative pilus assembly protein [Rhizobium etli CFN 42]
          Length = 380

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 119/260 (45%), Gaps = 13/260 (5%)

Query: 87  VDSREVLSALEPLA-EVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINS 145
           VD+ E+L  LE  A         ++V+ +     L R L   + +++L +PL    +I+ 
Sbjct: 64  VDNGELLQQLELFAFRTSYRDIPLVVVSEDLPDDLMRLLFRLNGNDWLKKPLERRALIDM 123

Query: 146 ISAIFTPQEEGKGSSGCSI-SFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADL-DLPY 203
           IS        G G+S   + + + + GG G+S IA + A  +A      T   DL D  +
Sbjct: 124 IST----HAPGTGASDSRVHAVVSAVGGAGASMIASSLAHVLAQPTKNSTPRIDLFDTDF 179

Query: 204 GTANINFDKDPINS--ISDAIYPVGRIDKAFVSRLPVFYAENLSILT--APAMLSRTYDF 259
            +  + +  + +N   +   I    R+D  F+  +   +    S+L+   P++L      
Sbjct: 180 CSGALGYYLNLVNDYDLKPVIANPSRVDLEFIDLVRKRHPGGFSLLSFKQPSVLLAPKG- 238

Query: 260 DEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLID 319
             ++++ +LD+        I+D+P+    W  EVLT  + + I T + +  L  +K+L  
Sbjct: 239 -GELVLRMLDVAAFESDHTIVDMPYYDTPWKYEVLTSVNSIYIVTEMTIPALSQAKDLFT 297

Query: 320 VLKKLRPADKPPYLVLNQVK 339
            L +LR +    ++V+N+ +
Sbjct: 298 NLVRLRGSSDQIFVVINKYR 317


>gi|221213138|ref|ZP_03586114.1| response regulator receiver protein [Burkholderia multivorans CGD1]
 gi|221167351|gb|EED99821.1| response regulator receiver protein [Burkholderia multivorans CGD1]
          Length = 412

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/301 (20%), Positives = 119/301 (39%), Gaps = 25/301 (8%)

Query: 106 GTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSIS 165
           G  ++ +G         A +   V +++    S  D + +   +     E     G  ++
Sbjct: 74  GLPIVALGSLAQPESTLAALRAGVRDFIDVSASAEDALRTTRGLLANVGEPASRHGKVVA 133

Query: 166 FIGSRGGVGSSTIAHNCAF----------SIASVFA-----METLLADLDLPYGTANINF 210
            +G+R G+G ST+A N A           ++A + A      +T L DL LP G   +  
Sbjct: 134 LLGARAGMGVSTLAANLAVWLQKHALGPGAVAKLDAGVPAGRQTALLDLGLPAGDGALFL 193

Query: 211 DKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDI 270
           +        DA+  + RID+ FV+     +   +++ T P  L    D      + +L+ 
Sbjct: 194 NTRCEFHFVDAVQNLRRIDRTFVNTALTRHRSGVALTTLPPDLGGLRDVSYASCIGLLNR 253

Query: 271 LEQIFPLVILDVPHVWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADK 329
               F   ++D+    N  +  ++ + +D+  +     +A + ++ +L+  L+       
Sbjct: 254 FRAFFDQQVVDLGGFSNREFVTQIASSADEAWLVCDQGVASIVSAADLLTGLRDAGVDTD 313

Query: 330 PPYLVLNQVKTPKKPEISI--SDFCAPLGITPSAIIPFDGAVFGMSANSGKMI---HEVD 384
              LV+NQ      P + +        LGI     +P      G +AN G++I    E D
Sbjct: 314 RLRLVVNQY----DPALDLLPGQIADRLGIALVGTLPSRRVALGRAANQGRLIVDEAERD 369

Query: 385 P 385
           P
Sbjct: 370 P 370


>gi|260881317|ref|ZP_05404114.2| putative flp pilus assembly protein CpaE [Mitsuokella multacida DSM
           20544]
 gi|260849092|gb|EEX69099.1| putative flp pilus assembly protein CpaE [Mitsuokella multacida DSM
           20544]
          Length = 280

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 104/252 (41%), Gaps = 12/252 (4%)

Query: 159 SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSI 218
           ++G  I+F  +   VG + +A N A  +A        L D DL +G         P  ++
Sbjct: 12  ANGIVITFFSTASAVGKTLVACNMASELARE-GYRVCLVDFDLQFGDVCHYLQLQPTKTL 70

Query: 219 SDAIYPVG-RIDKAFVSRLPVFYAE---NLSILTAPAMLSRTYDFDEKMIVPVLDILEQI 274
           +D    +    D   V      Y     + S+L AP +L   Y+      V  +  L++ 
Sbjct: 71  ADLQRTMQVEGDSCRVQEFLTPYEREGVHFSVLAAPKLLEEAYNIHHDYAVRAVRALQRQ 130

Query: 275 FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLD-LAGLRNSKNLIDVLKKLRPADKPPYL 333
           F  +++D+  ++++    +L  S  V     +D L  ++N K  +D LK L        L
Sbjct: 131 FDYILIDMASMFSTLNLAMLDQSTIVTFLGIVDFLPTIKNMKIGMDTLKTLGYDKNKIRL 190

Query: 334 VLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
           VLN  ++  K  IS++D    LG     ++P D      S   G  +     ++A+ + L
Sbjct: 191 VLN--RSDAKTRISLADVQKLLGEPFYHVLPNDFRAASTSIRDGIPLVLAPQRTALGDAL 248

Query: 394 VDFSRVLMGRVT 405
               R L+ R T
Sbjct: 249 ----RALVDRYT 256


>gi|152976864|ref|YP_001376381.1| septum site-determining protein MinD [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152025616|gb|ABS23386.1| septum site-determining protein MinD [Bacillus cytotoxicus NVH
           391-98]
          Length = 265

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/282 (21%), Positives = 129/282 (45%), Gaps = 36/282 (12%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDK- 212
           G +I     +GGVG +T + N   ++A       +   +  L +LD+  G  N I FD  
Sbjct: 2   GEAIVITSGKGGVGKTTTSANIGTALALSGKKVCLIDTDIGLRNLDVVMGLENRIVFDLV 61

Query: 213 DPINS---ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLD 269
           D +     +  A+    R D+ ++  LP     + S +T   M       DE     ++ 
Sbjct: 62  DVVEGRCRLPQALIKDKRFDELYL--LPAAQTSDKSAVTPEQM-------DE-----LIQ 107

Query: 270 ILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADK 329
           +L Q +  +++D P       +  +  +DK ++ T+ +++ +R++  +I +L+K     +
Sbjct: 108 VLRQDYDYILIDCPAGIEQGFKNAVAGADKAIVVTTPEVSSMRDADRIIGLLEK--EDIE 165

Query: 330 PPYLVLNQVKTPKKPE---ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPK 386
           PP L++N+V++    E   + + +    L I    ++  D  V   + N+G+ +  + P 
Sbjct: 166 PPKLIINRVRSHMLHEQDMLDVDEIVRMLSIELLGVVADDDDVI-RATNTGEPVA-LQPN 223

Query: 387 SAIANLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
              A    + +R L+G      T+ + + +++TK+K  F ++
Sbjct: 224 GKAALAYRNIARRLLGENVPLQTLEQEKVSVFTKVKNFFGIR 265


>gi|301055956|ref|YP_003794167.1| septum site-determining protein; cell division inhibitor [Bacillus
           anthracis CI]
 gi|300378125|gb|ADK07029.1| septum site-determining protein; cell division inhibitor [Bacillus
           cereus biovar anthracis str. CI]
          Length = 265

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/275 (20%), Positives = 128/275 (46%), Gaps = 22/275 (8%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN----FDKDPIN 216
           G +I     +GGVG +T + N   ++A +F  +  L D D+  G  N++     +   + 
Sbjct: 2   GEAIVITSGKGGVGKTTTSANIGTALA-LFGKKVCLIDTDI--GLRNLDVVMGLENRIVF 58

Query: 217 SISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFP 276
            + D +    R+ +A +        ++L +L A     ++    E+M   ++ +L Q + 
Sbjct: 59  DLVDVVEGRCRLPQALIKDKRF---DDLYLLPAAQTSDKSAVTPEQMD-ELIQVLRQDYD 114

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            +++D P       +  +  +DK ++ T+ +++ +R++  +I +L+K     +PP LV+N
Sbjct: 115 YILIDCPAGIEQGFKNAVAGADKAIVVTTPEVSSMRDADRIIGLLEK--EDIEPPKLVIN 172

Query: 337 QVKTPKKPE---ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
           +V++    E   + + +    L I    ++  D  V   + N+G+ +  + P    A   
Sbjct: 173 RVRSHMLHEQDMLDVDEIVRTLSIELLGVVEDDDEVI-RATNTGEPVA-LQPSGKAALAY 230

Query: 394 VDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
            + +R L+G         + + +++TK+K  F ++
Sbjct: 231 RNIARRLLGENVPLQAFEQEKVSVFTKMKNFFGIR 265


>gi|163751749|ref|ZP_02158967.1| Flp pilus assembly protein, ATPase CpaE [Shewanella benthica KT99]
 gi|161328401|gb|EDP99560.1| Flp pilus assembly protein, ATPase CpaE [Shewanella benthica KT99]
          Length = 428

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 79/350 (22%), Positives = 150/350 (42%), Gaps = 37/350 (10%)

Query: 67  EAVSCFSDSSTP----DLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYR 122
           E V+ F+ SST     +L+++    D     SA++ L      G  +I++G      + R
Sbjct: 72  ETVNSFAASSTNARPYNLVLLVLPNDEA---SAVQALKSAAAYGVDIIILGQNTPQGVLR 128

Query: 123 ALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNC 182
                 VS+++      A+++ S+  I   +   K      ++ + ++GG G+S IA + 
Sbjct: 129 LAFQQGVSDFVSPQELAAELLQSLEKI-AHKLADKADLAPVLAVVNAKGGSGASFIAASI 187

Query: 183 AFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDK-------AFVSR 235
           A   +     E  L D DL  GT       +P   I+DAI  +  +D+         +  
Sbjct: 188 AMITSIRDEGEVSLLDTDLLQGTLAHMLGLEPHYFITDAIQELDSLDEMALKGAMTNLGH 247

Query: 236 LPVFYAENLSILTA--PAMLSRTYDFDEKMIVPVLDILEQIFPLVILDV---PHVWNSWT 290
           L +  AE  ++L A  P  L  T +   K          Q +  V++D+   P +WN   
Sbjct: 248 LHLLAAEPFAVLNASEPIELRNTNELLLKC--------RQYYQQVVIDLSRGPEIWNV-- 297

Query: 291 QEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPAD-KPPYLVLNQVKTPKKPEISIS 349
            ++LT ++ +++    ++  +R +K +++ L +    D +  +L++N+ +      IS+ 
Sbjct: 298 -DMLTNAN-ILLVMQQNVMSIREAKAVVNQLVRFMGIDIERIHLLINRYQKTSSG-ISLK 354

Query: 350 DFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRV 399
           D     GI    ++  D  +     + G  I EV  +  I   L D S+V
Sbjct: 355 DIRETTGIESHFVVANDFKLASQCTDLGSPITEVANREQI---LKDLSQV 401


>gi|315303306|ref|ZP_07873939.1| septum site-determining protein MinD [Listeria ivanovii FSL F6-596]
 gi|313628321|gb|EFR96821.1| septum site-determining protein MinD [Listeria ivanovii FSL F6-596]
          Length = 266

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/281 (21%), Positives = 129/281 (45%), Gaps = 33/281 (11%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKD 213
           G +I     +GGVG +T   N   ++A       +  M+  L +LD+  G  N I +D  
Sbjct: 2   GEAIVITSGKGGVGKTTSTANLGTALALQGKKVCLIDMDIGLRNLDVVLGLENRIIYD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
               + D +    +I +A +      + + L +L A     +     E+MI    D++ Q
Sbjct: 60  ----LVDVVEGRCKIHQAMIK--DKRFDDLLFLLPAAQTTDKNAVSAEQMI----DLINQ 109

Query: 274 IFP---LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP 330
           + P    +++D P    +  +  +  +DK ++ T+ +++ +R++  +I +L+K   A +P
Sbjct: 110 LRPDYDFILIDCPAGIETGYKNAVAGADKAIVVTTPEISAVRDADRIIGLLEK--EAIEP 167

Query: 331 PYLVLNQVKTP---KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS 387
           P L++N+++T        + I +    L I    II  D  V   S+NSG  +  + P +
Sbjct: 168 PKLIINRIRTQMMVNGDVMDIDEITTHLSIELLGIIIDDDEVI-RSSNSGDPVAML-PNN 225

Query: 388 AIANLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
             +    + +R ++G     +++   +   + ++K++F  K
Sbjct: 226 RASQGYRNIARRILGESIPLMSIEAKKPGFFARLKQLFGGK 266


>gi|223984392|ref|ZP_03634531.1| hypothetical protein HOLDEFILI_01825 [Holdemania filiformis DSM
           12042]
 gi|223963634|gb|EEF68007.1| hypothetical protein HOLDEFILI_01825 [Holdemania filiformis DSM
           12042]
          Length = 253

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 86/190 (45%), Gaps = 24/190 (12%)

Query: 169 SRGGVGSSTIAHNCAFSIASV------FAMETLLADLDLPYGTANINFDKDPINSISDAI 222
            +GGVG +T+  N   ++AS+        M+  L +LD+  G  N  F       + DA+
Sbjct: 5   GKGGVGKTTVCANLGIALASLGKKVCMIDMDLGLKNLDVMMGLENRVF-----YDLKDAV 59

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDE---KMIVPVLDILEQIFPLVI 279
                + +A +        ENL ++ A     RT +      + +  V+D L+  F  ++
Sbjct: 60  EGRCPLSRAMIQDKR---CENLFLMAA----CRTVNIGRLKLEDLTTVIDQLQDQFDFIL 112

Query: 280 LDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVK 339
           LD P       Q  +  +D+ ++   LD+A L++S  +I +L  L+       LV+N+V 
Sbjct: 113 LDSPAGIERGFQYAMCCADEALVVVQLDIAALQDSDRVIGIL--LKEGKTTIRLVMNRV- 169

Query: 340 TPKKPEISIS 349
            P+  E  IS
Sbjct: 170 NPRYIEKGIS 179


>gi|193213112|ref|YP_001999065.1| Flp pilus assembly protein ATPase CpaE-like protein [Chlorobaculum
           parvum NCIB 8327]
 gi|193086589|gb|ACF11865.1| Flp pilus assembly protein ATPase CpaE-like protein [Chlorobaculum
           parvum NCIB 8327]
          Length = 381

 Score = 51.6 bits (122), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/258 (20%), Positives = 115/258 (44%), Gaps = 14/258 (5%)

Query: 166 FIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPI-NSISDAIYP 224
           F+ S+GG GSS I  N A++++ V     L  D+ LP+G  ++    +   + ++D    
Sbjct: 131 FVSSKGGDGSSCIVANLAYALSQVPNTRVLAVDVSLPFGDLDMYLTGETHPDDLADISSQ 190

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH 284
             R+D++ +  +    +  L ++  P    +    + + +  ++ I    +  +++D   
Sbjct: 191 SERLDQSLLDSMVQHVSPTLDLIPMPTTFEKIITIEPERVSELIHIASNFYDYILVDFGI 250

Query: 285 VWNS---WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQV-KT 340
             +    W  E L   D++ I ++  L  LR +     VLK  +  +KP   + N + + 
Sbjct: 251 SLDRIGIWVAEYL---DELCIVSTPSLPSLRGAGQ---VLKLCKEFEKPIARIENILNRF 304

Query: 341 PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL 400
                IS ++    +G   +  +P D      +   G+   +  PKS ++  + D++  L
Sbjct: 305 DNNARISGAEIEKVIGRPINKSLPSDTDAVEAALLIGQPFVKEAPKSKLSQSIFDWAADL 364

Query: 401 MGRVTVSKPQSAMYTKIK 418
            G    S+P+ +++ ++K
Sbjct: 365 TGN---SQPKRSLWERLK 379


>gi|221197782|ref|ZP_03570828.1| response regulator receiver protein [Burkholderia multivorans
           CGD2M]
 gi|221204660|ref|ZP_03577677.1| response regulator receiver protein [Burkholderia multivorans CGD2]
 gi|221175517|gb|EEE07947.1| response regulator receiver protein [Burkholderia multivorans CGD2]
 gi|221181714|gb|EEE14115.1| response regulator receiver protein [Burkholderia multivorans
           CGD2M]
          Length = 412

 Score = 51.6 bits (122), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 63/301 (20%), Positives = 118/301 (39%), Gaps = 25/301 (8%)

Query: 106 GTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSIS 165
           G  ++ +G         A +   V +++    S  D + +   +     E     G  ++
Sbjct: 74  GLPIVALGSLAQPESTLAALRAGVRDFIDVSASAEDALRTTRGLLANVGEPASRHGKVVA 133

Query: 166 FIGSRGGVGSSTIAHNCAFSI--------------ASVFA-METLLADLDLPYGTANINF 210
            +G+R G+G ST+A N A  +              A V A  +T L DL LP G   +  
Sbjct: 134 LLGARAGMGVSTLAANLAVWLQKHALGPGAVAKPDAGVPAGRQTALLDLGLPAGDGALFL 193

Query: 211 DKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDI 270
           +        DA+  + RID+ FV+     +   +++ T P  L    D      + +L+ 
Sbjct: 194 NTRCEFHFVDAVQNLRRIDRTFVNTALTRHRSGVALTTLPPDLGGLRDVSYASCIGLLNR 253

Query: 271 LEQIFPLVILDVPHVWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADK 329
               F   ++D+    N  +  ++ + +D+  +     +A + ++ +L+  L+       
Sbjct: 254 FRAFFDQQVVDLGGFSNREFVTQIASSADEAWLVCDQGVASIVSAADLLTGLRDAGVDTD 313

Query: 330 PPYLVLNQVKTPKKPEISI--SDFCAPLGITPSAIIPFDGAVFGMSANSGKMI---HEVD 384
              LV+NQ      P + +        LGI     +P      G +AN G++I    E D
Sbjct: 314 RLRLVVNQY----DPALDLLPGQIADRLGIALVGTLPSRRVALGRAANQGRLIVDEAERD 369

Query: 385 P 385
           P
Sbjct: 370 P 370


>gi|182436323|ref|YP_001824042.1| putative septum site-determining protein [Streptomyces griseus
           subsp. griseus NBRC 13350]
 gi|178464839|dbj|BAG19359.1| putative septum site-determining protein [Streptomyces griseus
           subsp. griseus NBRC 13350]
          Length = 437

 Score = 51.6 bits (122), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 68/310 (21%), Positives = 129/310 (41%), Gaps = 44/310 (14%)

Query: 99  LAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKG 158
            A+  DSG + +V      + L    ++N V         V   + S S +FT      G
Sbjct: 98  FADAMDSGARGLVT-----LPLSYEELANRVQAAAQWSSGVRRHLTSASDVFT------G 146

Query: 159 SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSI 218
             G  ++  G++GGVG+ T+        A        L D+DL  G          I S 
Sbjct: 147 PGGTVVTVTGAKGGVGA-TVTAIQLALAAQASGNTVALVDMDLQTGD---------IASF 196

Query: 219 SDAIYPVGRIDKAFVSRL-------PVF-YAENLSILTAPAMLSRTYDFDEKMIVPVLDI 270
            D  +    +D A ++ +        VF ++  L++L AP    R  +  ++    ++  
Sbjct: 197 LDVQFRRSLVDLALITDISPRVLSDAVFSHSTGLALLLAPGEGERGEEVSDRSARQIVSA 256

Query: 271 LEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL--RPAD 328
           L   + +V++D     N      + ++D  ++ T+ D+  +R +K ++ + ++L  R A+
Sbjct: 257 LRTRYEIVVIDCGGQMNGANAAAIEMADVALLVTTPDVIAVRGAKRIVRMWERLQIRKAE 316

Query: 329 KPPYLVLN-----QVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEV 383
           +   LV       +++ P   +I+ +          SA IP +      S +SG++ HE+
Sbjct: 317 ETVTLVNRFTRNTEIQPPLIQKITGTRVA-------SAAIPANFKELQASIDSGRL-HEL 368

Query: 384 DPKSAIANLL 393
           D KS +   L
Sbjct: 369 DAKSTVKQAL 378


>gi|326776953|ref|ZP_08236218.1| response regulator receiver protein [Streptomyces cf. griseus
           XylebKG-1]
 gi|326657286|gb|EGE42132.1| response regulator receiver protein [Streptomyces cf. griseus
           XylebKG-1]
          Length = 437

 Score = 51.2 bits (121), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 68/310 (21%), Positives = 129/310 (41%), Gaps = 44/310 (14%)

Query: 99  LAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKG 158
            A+  DSG + +V      + L    ++N V         V   + S S +FT      G
Sbjct: 98  FADAMDSGARGLVT-----LPLSYEELANRVQAAAQWSSGVRRHLTSASDVFT------G 146

Query: 159 SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSI 218
             G  ++  G++GGVG+ T+        A        L D+DL  G          I S 
Sbjct: 147 PGGTVVTVTGAKGGVGA-TVTAIQLALAAQASGNTVALVDMDLQTGD---------IASF 196

Query: 219 SDAIYPVGRIDKAFVSRL-------PVF-YAENLSILTAPAMLSRTYDFDEKMIVPVLDI 270
            D  +    +D A ++ +        VF ++  L++L AP    R  +  ++    ++  
Sbjct: 197 LDVQFRRSLVDLALITDISPRVLSDAVFSHSTGLALLLAPGEGERGEEVSDRSARQIVSA 256

Query: 271 LEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL--RPAD 328
           L   + +V++D     N      + ++D  ++ T+ D+  +R +K ++ + ++L  R A+
Sbjct: 257 LRTRYEIVVIDCGGQMNGANAAAIEMADVALLVTTPDVIAVRGAKRIVRMWERLQIRKAE 316

Query: 329 KPPYLVLN-----QVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEV 383
           +   LV       +++ P   +I+ +          SA IP +      S +SG++ HE+
Sbjct: 317 ETVTLVNRFTRNTEIQPPLIQKITGTRVA-------SAAIPANFKELQASIDSGRL-HEL 368

Query: 384 DPKSAIANLL 393
           D KS +   L
Sbjct: 369 DAKSTVKQAL 378


>gi|321312330|ref|YP_004204617.1| ATPase activator of MinC [Bacillus subtilis BSn5]
 gi|320018604|gb|ADV93590.1| ATPase activator of MinC [Bacillus subtilis BSn5]
          Length = 268

 Score = 51.2 bits (121), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/273 (21%), Positives = 118/273 (43%), Gaps = 16/273 (5%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI--NFDKDPINSI 218
           G +I     +GGVG +T + N   ++A +      L D D+     ++    +   I  +
Sbjct: 2   GEAIVITSGKGGVGKTTTSANLGTALA-ILGKRVCLVDTDIGLRNLDVVMGLENRIIYDL 60

Query: 219 SDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLV 278
            D +    ++ +A V        ++L  L   A  S       + I  ++  L+Q F  V
Sbjct: 61  VDVVEGRCKMHQALVKDKRF---DDLLYLMPAAQTSDKTAVAPEQIKNMVQELKQEFDYV 117

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQV 338
           I+D P       +  ++ +DK ++ T+ +++ +R++  +I +L++    +  P LV+N++
Sbjct: 118 IIDCPAGIEQGYKNAVSGADKAIVVTTPEISAVRDADRIIGLLEQEENVE-SPRLVVNRI 176

Query: 339 KT---PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVD 395
           +         + I +    L I    I+  D  V   S N G+ I  +DPK+  +    +
Sbjct: 177 RNHLMKNGDTMDIDEIVQHLSIDLLGIVADDDEVIKAS-NHGEPI-AMDPKNRASIAYRN 234

Query: 396 FSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
            +R ++G       + +    M  KIK  F ++
Sbjct: 235 IARRILGESVPLQVLEEQNKGMMAKIKSFFGVR 267


>gi|309790814|ref|ZP_07685358.1| response regulator receiver [Oscillochloris trichoides DG6]
 gi|308227101|gb|EFO80785.1| response regulator receiver [Oscillochloris trichoides DG6]
          Length = 406

 Score = 51.2 bits (121), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/253 (22%), Positives = 106/253 (41%), Gaps = 8/253 (3%)

Query: 131 EYLIEPLSVADIINSISAIFT----PQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSI 186
           +Y+ +P    ++   + A+      P      + G  ++F   RGGVG S+++ N A  +
Sbjct: 101 DYMAKPFEAEELQARVKALLRRANPPPVITATAQGKMVAFFSLRGGVGLSSLSVNLAAGL 160

Query: 187 ASVFAM-ETLLADLDLPYGTANINFDKDPINSISD-AIYPVGRIDKAFVSRLPVFYAENL 244
             ++   +  LAD+    G + +  +     S SD A      ID+  V ++ + +A  L
Sbjct: 161 NQIWGGGKVALADMVFTGGHSALMLNLPLRTSWSDLASTEPDHIDEEVVQQVMLNHACGL 220

Query: 245 SILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITT 304
            +L A     +        +  V+ +L   +   I+D PH +N  T   L   D++V+  
Sbjct: 221 RVLPAAPRPDQNERITPAQVSRVMQVLRAKYDYTIIDAPHNFNETTLAALDAVDQIVLVL 280

Query: 305 SLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIP 364
           + ++  +  +   +DV  +L        L+LN   T ++  I+  D    L      IIP
Sbjct: 281 APEIGSIVATTCALDVFDQLGYRSDKITLLLN--ATFERGAIARKDIETALRRPLGMIIP 338

Query: 365 FDGAVFGMSANSG 377
           +    F  + N G
Sbjct: 339 YASEFFTNALNRG 351


>gi|149927032|ref|ZP_01915290.1| response regulator receiver domain protein (CheY-like) [Limnobacter
           sp. MED105]
 gi|149824253|gb|EDM83473.1| response regulator receiver domain protein (CheY-like) [Limnobacter
           sp. MED105]
          Length = 399

 Score = 51.2 bits (121), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 114/275 (41%), Gaps = 23/275 (8%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF---DKDPINS 217
           G ++  +G R GVGS+T+A N A  +A      TLL D  LP G   ++    DK     
Sbjct: 134 GYALVVLGGRQGVGSTTLAVNLAVQLAKQNKDSTLLLDFGLPLGDGLVHLPAEDKQGAMD 193

Query: 218 ISDAIYPVGRIDKAFV-SRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFP 276
             + +  + R D     +      A  ++IL+ P  L+   D      +  L++++  F 
Sbjct: 194 FVECVRNLKRFDATLAKTAFRRNNATGVAILSLPRNLADLRDISASDALKFLNLIKSFFE 253

Query: 277 LVILDVPHVWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVL 335
            +++D+    N  +   +L  +D  ++ T   + G+  +  LI  L     A +   LV+
Sbjct: 254 NIVIDLCGFSNIEFVASLLRSADATMVLTPQSVPGIVTAAELIKSLNDKGIATQTFDLVV 313

Query: 336 NQVKTPKKPEISI--SDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPK----SAI 389
               TP   ++++        L I     +P   A    + N G+++   D K     A+
Sbjct: 314 ----TPYHKDVALDAESIAKKLNIETVHTLPDRRAPLINAVNGGQVLSAADSKDPYAKAV 369

Query: 390 ANLL--VDFSRVLMGRVTVSKPQSAMYTKIKKIFN 422
           A LL  V+ +R  M        Q  + +  KK FN
Sbjct: 370 AQLLDKVNANRKHM------DGQGGLASTFKKWFN 398


>gi|317154603|ref|YP_004122651.1| response regulator receiver protein [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316944854|gb|ADU63905.1| response regulator receiver protein [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 399

 Score = 51.2 bits (121), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 71/313 (22%), Positives = 131/313 (41%), Gaps = 21/313 (6%)

Query: 120 LYRALISNHVSEYLIEPLSVADIINSI--SAIFTPQEEGKGSSGCSISFIGSRGGVGSST 177
           L RA+ S  + E+L  P++  D   +I  +A+   Q    G  G  ++  G + GVG ST
Sbjct: 83  LIRAMRSG-IREFLPFPVAEEDFRAAIMRTAMRRSQHCDDGERGRIVTLAGCKAGVGVST 141

Query: 178 IAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLP 237
           +A + A+S+       TLL DL  P G      D     +    +  + R+D  ++  + 
Sbjct: 142 LAASLAWSLNRRAPGRTLLLDLRQPVGEIPYFLDLKYEYTWGHLMEDISRLDATYLHSVV 201

Query: 238 VFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH------VWNSWTQ 291
             +   L++L  P   +     D   +  +L+ L   +  +++D           +    
Sbjct: 202 TGHESGLAVLPGP---TDNTAPDRGALSQILEQLRFGYDFIVVDTAFPEDASLAGDGLPA 258

Query: 292 EVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPA-DKPPYLVLNQVKTPKKPEISISD 350
           E+ T +D + +   L L  L  +  L++ +++  PA +    LV N+V   +   I +++
Sbjct: 259 EMDT-ADTLYLPLHLTLPCLSRTTRLLEAVRRHSPALEAKVRLVANRVI--RDSTIGVAE 315

Query: 351 FCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS----AIANLLVDF-SRVLMGRVT 405
               LG   + ++P D A    S N G  +    PKS    AI  +  D   R + G   
Sbjct: 316 AAEVLGRDIAWVVPEDFASALSSLNQGTPLTGACPKSPAARAIERMAADLDHRQMAGPAR 375

Query: 406 VSKPQSAMYTKIK 418
            S    A++ + +
Sbjct: 376 ASFSLGALFGRRR 388


>gi|238027561|ref|YP_002911792.1| response regulator receiver protein [Burkholderia glumae BGR1]
 gi|237876755|gb|ACR29088.1| Response regulator receiver protein [Burkholderia glumae BGR1]
          Length = 415

 Score = 51.2 bits (121), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/241 (21%), Positives = 102/241 (42%), Gaps = 28/241 (11%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAME---TLLADLDLPYGTANINFDKDPINS 217
           G  ++ +G+R G+G ST+A N +  +    A +   T L DL LP G + +  +      
Sbjct: 141 GKVLALLGARAGMGVSTLAANLSVLLQRKVAAQSRRTALVDLGLPAGDSALFLNTRCELH 200

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
             +A+  + R D+ FV+     +A  +++ T P  L+   +        + + L      
Sbjct: 201 FVEAVRNLRRFDRTFVNTAFAHHASGVALTTLPPNLADLREVSAAACAGLFNRLRAFVDQ 260

Query: 278 VILDVPHVWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            I+D+    N  +  +++ L D+  +     +A + ++  L+D L++   +     LV+N
Sbjct: 261 QIVDLGGFTNREFIAQIVALGDETWLVCDQGVASVVSAVELLDELREKGVSLARVRLVVN 320

Query: 337 QVKTPKKPEISISDFCAPLGITPS-----------AIIPFDGAVFGMSANSGKMIHEVDP 385
           Q             + A LG+ P+           A +P      G +AN G++I E   
Sbjct: 321 Q-------------YDAALGLLPAQIAERLELPLVATLPARRVPIGHAANQGRLIVEAAE 367

Query: 386 K 386
           +
Sbjct: 368 R 368


>gi|194305944|dbj|BAG55669.1| septum site-determining protein homologue [Streptomyces lavendulae]
          Length = 424

 Score = 50.8 bits (120), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 158 GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  G  ++  G++GGVG++  A   A + A+     T L DLDL  G      D     S
Sbjct: 146 GPGGRVVTVTGAKGGVGTTFTAVQFALAAAA-SGRRTALVDLDLQAGDVGSYLDVQFRRS 204

Query: 218 ISDA-----IYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILE 272
           I+D      I P    D  +  R        L++L APA   R  D DE+    VL  L 
Sbjct: 205 IADLAGIQDISPRVLQDAVYEDRT------GLALLLAPAEGERGEDLDERATRQVLSALR 258

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
             + LV++D            +  +D  V+ T+ D+  +R +K ++ + ++L+
Sbjct: 259 APYELVVVDCGTQVTGANATAVEQADVAVLVTTPDVVAVRAAKRMVRMWERLQ 311


>gi|325661594|ref|ZP_08150218.1| septum site-determining protein MinD [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325472121|gb|EGC75335.1| septum site-determining protein MinD [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 262

 Score = 50.8 bits (120), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 60/278 (21%), Positives = 120/278 (43%), Gaps = 34/278 (12%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI--NFDKDPINSI 218
           G  I     +GGVG +T   N    +A     + ++ D DL     ++    +   + ++
Sbjct: 2   GEVIVITSGKGGVGKTTTTANIGVGLAQ-MGKKVIVIDTDLGLRNLDVVLGLENRIVYNL 60

Query: 219 SDAIYPVGRIDKAFVS--RLPVFY------AENLSILTAPAMLSRTYDFDEKMIVPVLDI 270
            D I    R+ +A +   R P  Y       ++ S +T   M   T +            
Sbjct: 61  VDVITGSCRLKQALIKDKRYPELYLLPSAQTKDKSAVTPEQMKKLTAE------------ 108

Query: 271 LEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP 330
           L+++F  VILD P       Q  +  +D+ V+ T+ +++ +R++  +I +L++   A   
Sbjct: 109 LKELFDYVILDCPAGIEQGFQNAIAGADRAVVVTTPEVSAIRDADRIIGLLEQGGIAQSE 168

Query: 331 PYLVLNQVKTP--KKPE-ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS 387
             L++N+++    K+ E +S+ D    LGI    +IP D  V  +  N G+ +  +  K+
Sbjct: 169 --LIINRLRMDMVKRGEMMSVEDVTEILGIRLIGVIPDDEQVV-IGTNQGEPVISLSSKA 225

Query: 388 AIANLLVDFSRVLMGR---VTVSKPQSAMYTKIKKIFN 422
             A    +  + L G        + Q  +++++ K+F 
Sbjct: 226 GAA--YKNICKRLTGEEVPFLNFEKQDGLFSRLTKVFK 261


>gi|299889216|dbj|BAJ10316.1| cell division inhibitor MinD1 [Streptomyces lavendulae subsp.
           lavendulae]
          Length = 424

 Score = 50.8 bits (120), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 158 GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  G  ++  G++GGVG++  A   A + A+     T L DLDL  G      D     S
Sbjct: 146 GPGGRVVTVTGAKGGVGTTFTAVQFALAAAA-SGRRTALVDLDLQAGDVGSYLDVQFRRS 204

Query: 218 ISDA-----IYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILE 272
           I+D      I P    D  +  R        L++L APA   R  D DE+    VL  L 
Sbjct: 205 IADLAGIQDISPRVLQDAVYEDRT------GLALLLAPAEGERGEDLDERATRQVLSALR 258

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
             + LV++D            +  +D  V+ T+ D+  +R +K ++ + ++L+
Sbjct: 259 APYELVVVDCGTQVTGANATAVEQADVAVLVTTPDVVAVRAAKRMVRMWERLQ 311


>gi|209546478|ref|YP_002278396.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537722|gb|ACI57656.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 380

 Score = 50.8 bits (120), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 111/238 (46%), Gaps = 13/238 (5%)

Query: 109 VIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSI-SFI 167
           V+V  D  D  + R L   + +++L +PL    +I+ IS        G G+S   + + +
Sbjct: 88  VVVSEDLPD-DMLRLLFRLNGNDWLKKPLERRALIDMIST----HAPGTGASDSRVHAVV 142

Query: 168 GSRGGVGSSTIAHNCAFSIASVFAMETLLADL-DLPYGTANINFDKDPINS--ISDAIYP 224
            + GG G+S IA + A  +A      T   DL D  + +  + +  + +N   +   I  
Sbjct: 143 SAVGGAGASVIASSLAHVLAQPTKNSTPRIDLFDTDFCSGTLGYYLNLVNDYDLKPVIAN 202

Query: 225 VGRIDKAFVSRLPVFYAENLSILT--APAMLSRTYDFDEKMIVPVLDILEQIFPLVILDV 282
             R+D  F+  +   ++   S+L+   P++L        ++++ +LD+        I+DV
Sbjct: 203 PSRVDLEFIDLVRKRHSGGFSLLSFKQPSVLLAPKG--RELVLRMLDVAAFESDHTIIDV 260

Query: 283 PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKT 340
           P+    W  E+LT  + V I T + +  L  +K+L   L +LR      ++V+N+ ++
Sbjct: 261 PYYDTPWKYEILTSVNSVCIVTEMTVPALSQAKDLFANLVRLRGNADQIFIVINKYRS 318


>gi|41410124|ref|NP_962960.1| hypothetical protein MAP4026 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41398957|gb|AAS06576.1| hypothetical protein MAP_4026 [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 434

 Score = 50.8 bits (120), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 82/164 (50%), Gaps = 10/164 (6%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           ++F+  +GGVG +TIA     + AS+     +  D +   GT +     +   ++   ++
Sbjct: 183 VAFLSLKGGVGKTTIAATLGATFASIRGDRVVAVDANPDRGTLSQKIPLETAATVRQLLH 242

Query: 224 PVGRID-----KAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLV 278
             G I+     + + S+ P    E L+  T PA +S  +  D+   V +LDILE+ + LV
Sbjct: 243 DAGTIERYSDVRRYTSKGPSGL-EVLASETDPA-VSEAFSADD--YVRILDILERFYGLV 298

Query: 279 ILDV-PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL 321
           + D  P + +S  + VL  +D +V+ +S  + G R++   +D L
Sbjct: 299 LTDCGPGLLHSVMKSVLEKADALVVVSSASIDGARSASATLDWL 342


>gi|159043676|ref|YP_001532470.1| response regulator receiver protein [Dinoroseobacter shibae DFL 12]
 gi|157911436|gb|ABV92869.1| response regulator receiver protein [Dinoroseobacter shibae DFL 12]
          Length = 435

 Score = 50.8 bits (120), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 98/203 (48%), Gaps = 15/203 (7%)

Query: 136 PLSVADIINSISAIFTPQEEG----KGSSGCSISFI-GSRGGVGSSTIAHNCAFSIASVF 190
           P+ +AD +N ++ I  P  E     + + GC+I  + G  GGVG++T A N A+ +A++ 
Sbjct: 153 PIPLADAVN-VAEI--PATEATLPTRTAGGCTIFAVQGLAGGVGATTFAVNLAWELATLK 209

Query: 191 AM--ETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDK-AFVSRLPVFYAENLSIL 247
                  L D+D  +G+     D    + I + +  V  +D  AF   L +   + LS+ 
Sbjct: 210 GTTPRVGLMDMDQQFGSVATYLDLPRKDLIFELMSDVDSLDDDAFRQALQIVDGK-LSVF 268

Query: 248 TAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLD 307
           T+PA +        + +  ++     +F  +++D+P    +WT+  L ++D       LD
Sbjct: 269 TSPAEILPLDLLPPEDMDKLISTAAGMFDYLVIDMPSALVNWTETALRMADVFFPVIELD 328

Query: 308 LAGLRNSKNLIDVLKKLRPADKP 330
              LR+++N +  +K L+  D P
Sbjct: 329 ---LRSAQNALRFVKTLKFEDLP 348


>gi|315645756|ref|ZP_07898880.1| septum site-determining protein MinD [Paenibacillus vortex V453]
 gi|315279234|gb|EFU42544.1| septum site-determining protein MinD [Paenibacillus vortex V453]
          Length = 264

 Score = 50.8 bits (120), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 66/279 (23%), Positives = 120/279 (43%), Gaps = 33/279 (11%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI--NFDKDPINSI 218
           G +I     +GGVG +T + N   ++A +   +  L D D+     ++    +   I  +
Sbjct: 2   GEAIVVTSGKGGVGKTTTSANIGTALA-LLGKKVCLVDTDIGLRNLDVVMGLENRIIYDL 60

Query: 219 SDAIYPVGRIDKAFVS--RLPVFYAENLSILTAPAMLSRTYDFDEKMIVP--VLDI---L 271
            D      R+++A +   R    Y           ML      D+  + P  V DI   L
Sbjct: 61  CDVAEGRCRLNQALIKDKRFDELY-----------MLPAAQTKDKNAVSPDQVKDIVLEL 109

Query: 272 EQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPP 331
           ++ F  VI+D P       +  +  +DK ++ T+ + A +R++  +I +L+      + P
Sbjct: 110 KKEFEYVIIDCPAGIEQGFKNAIAGADKAIVVTTPENAAVRDADRIIGLLESSHV--ESP 167

Query: 332 YLVLNQVK---TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK-MIHEVDPKS 387
            LV+N+++         + I D    L I    I+P D  V   +AN G+  +   D ++
Sbjct: 168 KLVVNRIRPNMVKSGDMLEIEDVLQVLNIDLIGIVPDDEMVI-KAANMGEPTVMNPDSQA 226

Query: 388 AIANLLVDFSRVLMGR---VTVSKPQSAMYTKIKKIFNM 423
           AIA    + +R ++G    +     +  M+TK KK F M
Sbjct: 227 AIA--YRNIARRILGDTVPLMQIHQKKGMFTKFKKFFGM 263


>gi|229087012|ref|ZP_04219166.1| Septum site-determining protein minD [Bacillus cereus Rock3-44]
 gi|228696275|gb|EEL49106.1| Septum site-determining protein minD [Bacillus cereus Rock3-44]
          Length = 265

 Score = 50.8 bits (120), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 61/282 (21%), Positives = 127/282 (45%), Gaps = 36/282 (12%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDK- 212
           G +I     +GGVG +T + N   ++A       +   +  L +LD+  G  N I FD  
Sbjct: 2   GEAIVITSGKGGVGKTTTSANIGTALALSGKKICLIDTDIGLRNLDVVMGLENRIVFDLV 61

Query: 213 DPINS---ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLD 269
           D +     +  A+    R D+ ++  LP     + S +T   M       DE     ++ 
Sbjct: 62  DVVEGRCRLPQALIKDKRFDELYL--LPAAQTSDKSAVTPEQM-------DE-----LIQ 107

Query: 270 ILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADK 329
           +L Q +  +++D P       +  +  +DK ++ T+ +++ +R++  +I +L+K     +
Sbjct: 108 VLRQDYDYILIDCPAGIEQGFKNAVAGADKAIVVTTPEVSSMRDADRIIGLLEK--EDIE 165

Query: 330 PPYLVLNQVKTPKKPE---ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPK 386
           PP LV+N+V++    E   + + +    L I    ++  D  V   + N+G+ +  + P 
Sbjct: 166 PPKLVINRVRSHMLHEQDMLDVDEIVRTLSIDLLGVVEDDDEVI-RATNTGEPVA-LQPS 223

Query: 387 SAIANLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
              A    + +R L+G         + + +++TK+K  F ++
Sbjct: 224 GKAALAYRNIARRLLGESVPLQAFGQEKVSVFTKVKNFFGIR 265


>gi|331084847|ref|ZP_08333935.1| septum site-determining protein MinD [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330410941|gb|EGG90363.1| septum site-determining protein MinD [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 262

 Score = 50.8 bits (120), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 60/278 (21%), Positives = 120/278 (43%), Gaps = 34/278 (12%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI--NFDKDPINSI 218
           G  I     +GGVG +T   N    +A     + ++ D DL     ++    +   + ++
Sbjct: 2   GEVIVITSGKGGVGKTTTTANIGVGLAQ-MGKKVIVIDTDLGLRNLDVVLGLENRIVYNL 60

Query: 219 SDAIYPVGRIDKAFVS--RLPVFY------AENLSILTAPAMLSRTYDFDEKMIVPVLDI 270
            D I    R+ +A +   R P  Y       ++ S +T   M   T +            
Sbjct: 61  VDVITGSCRLKQALIKDKRYPELYLLPSAQTKDKSAVTPEQMKKLTAE------------ 108

Query: 271 LEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP 330
           L+++F  VILD P       Q  +  +D+ V+ T+ +++ +R++  +I +L++   A   
Sbjct: 109 LKELFDYVILDCPAGIEQGFQNAIAGADRAVVVTTPEVSAIRDADRIIGLLEQGGIAQSE 168

Query: 331 PYLVLNQVKTP--KKPE-ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS 387
             L++N+++    K+ E +S+ D    LGI    +IP D  V  +  N G+ +  +  K+
Sbjct: 169 --LIINRLRMDMVKRGEMMSVEDVTEILGIHLIGVIPDDEQVV-IGTNQGEPVISLSSKA 225

Query: 388 AIANLLVDFSRVLMGR---VTVSKPQSAMYTKIKKIFN 422
             A    +  + L G        + Q  +++++ K+F 
Sbjct: 226 GAA--YKNICKRLTGEEVPFLNFEKQDGLFSRLTKVFK 261


>gi|116626775|ref|YP_828931.1| response regulator receiver protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116229937|gb|ABJ88646.1| response regulator receiver protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 396

 Score = 50.4 bits (119), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 96/204 (47%), Gaps = 15/204 (7%)

Query: 130 SEYLIEPLSVADIINSISAI-FTPQEEGKGSS--GCSISFIGSRGGVGSSTIAHNCAFSI 186
           +E+L++P+  ++  +++  +   P+    G S  G   +FIG++GGVG++T+A N A S+
Sbjct: 106 NEFLLQPIKRSEFRDAMGRLERAPRHGTPGESKLGKIYTFIGTKGGVGATTMAVNFA-SV 164

Query: 187 ASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKA----FVSRLPV-FYA 241
            +   + T+  DLD       +     P  ++++    + R+D+A    FV+R P+ FY 
Sbjct: 165 LAQRKIPTVAIDLDTVGNDVAMQLGASPQYTLTEVGENLERMDQALFEGFVTRDPLGFY- 223

Query: 242 ENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH-VWNSWTQEVLTLSDKV 300
               ++  P  L +   F +  +      L + +  +++D    + N        +S  V
Sbjct: 224 ----LVGPPDALEQHAQFSDHQLREFATFLVEKYEAIVIDGGRAISNDLVMAAAQVSAAV 279

Query: 301 VITTSLDLAGLRNSKNLIDVLKKL 324
            +    +   +RN++  I  L ++
Sbjct: 280 FLVVDQEFPSIRNAQRYITYLMRM 303


>gi|239943894|ref|ZP_04695831.1| putative septum site-determining protein [Streptomyces roseosporus
           NRRL 15998]
 gi|239990348|ref|ZP_04711012.1| putative septum site-determining protein [Streptomyces roseosporus
           NRRL 11379]
 gi|291447357|ref|ZP_06586747.1| septum site-determining protein [Streptomyces roseosporus NRRL
           15998]
 gi|291350304|gb|EFE77208.1| septum site-determining protein [Streptomyces roseosporus NRRL
           15998]
          Length = 438

 Score = 50.4 bits (119), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 73/344 (21%), Positives = 145/344 (42%), Gaps = 49/344 (14%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS--LYRALISNHVSEYLIE 135
           P++++V  ++     + ALE + EV      V V+  T D S  L+   + +     +  
Sbjct: 56  PEVVLVHERIGP---VPALELIREVSLRFPSVGVVLITADASPNLFANAMDSGARGLVTL 112

Query: 136 PLSVADIINSISA-----------IFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAF 184
           PLS  ++ N + A           + +  E   G  G  ++  G++GGVG+ T+      
Sbjct: 113 PLSYEELANRVQAAAQWSAGVRRHLTSGNEVFTGPGGTVVTVTGAKGGVGA-TVTAIQLA 171

Query: 185 SIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRL-------P 237
             A        L D+DL  G          I S  D  +    +D A ++ +        
Sbjct: 172 LAAQASGSTVALVDMDLQTGD---------IASFLDVQFRRSLVDLAMITDISPRVLSDA 222

Query: 238 VF-YAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTL 296
           VF ++  L++L AP    R  +  ++    ++  L   + +V++D     N      + +
Sbjct: 223 VFSHSTGLALLLAPGEGERGEEVSDRSARQIVSALRTRYEIVVIDCGAQMNGANAAAVEM 282

Query: 297 SDKVVITTSLDLAGLRNSKNLIDVLKKL--RPADKPPYLVLN-----QVKTPKKPEISIS 349
           +D  ++ T+ D+  +R +K ++ + ++L  R A++   LV       +++ P   +I+ +
Sbjct: 283 ADVALLVTTPDVVAVRGAKRVVRMWERLQIRKAEETITLVNRFTRNTEIQPPLIQKITGT 342

Query: 350 DFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
                     SA +P +      S +SG++ HE+D KS +   L
Sbjct: 343 RVA-------SAAVPANFKELQASIDSGRL-HELDAKSTVKQAL 378


>gi|42783586|ref|NP_980833.1| septum site-determining protein MinD [Bacillus cereus ATCC 10987]
 gi|229198578|ref|ZP_04325280.1| Septum site-determining protein minD [Bacillus cereus m1293]
 gi|42739515|gb|AAS43441.1| septum site-determining protein MinD [Bacillus cereus ATCC 10987]
 gi|228584860|gb|EEK42976.1| Septum site-determining protein minD [Bacillus cereus m1293]
 gi|324328352|gb|ADY23612.1| septum site-determining protein MinD [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 265

 Score = 50.4 bits (119), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 58/278 (20%), Positives = 127/278 (45%), Gaps = 28/278 (10%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKD 213
           G +I     +GGVG +T + N   ++A       +   +  L +LD+  G  N I FD  
Sbjct: 2   GEAIVITSGKGGVGKTTTSANIGTALALSGKKVCLIDTDIGLRNLDVVMGLENRIVFD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
               + D +    R+ +A +        ++L +L A     ++    E+M   ++ +L Q
Sbjct: 60  ----LVDVVEGRCRLPQALIKDKRF---DDLYLLPAAQTSDKSAVTPEQMD-ELIQVLRQ 111

Query: 274 IFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYL 333
            +  +++D P       +  +  +DK ++ T+ +++ +R++  +I +L+K     +PP L
Sbjct: 112 DYDYILIDCPAGIEQGFKNAVAGADKAIVVTTPEVSSMRDADRIIGLLEK--EDIEPPKL 169

Query: 334 VLNQVKTPKKPE---ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIA 390
           V+N+V++    E   + + +    L I    ++  D  V   + N+G+ +  + P    A
Sbjct: 170 VINRVRSHMLHEQDMLDVDEIVRTLSIELLGVVEDDDEVI-RATNTGEPVA-LQPSGKAA 227

Query: 391 NLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
               + +R L+G         + + +++TK+K  F ++
Sbjct: 228 LAYRNIARRLLGENVPLQAFEQEKVSVFTKVKNFFGIR 265


>gi|219850623|ref|YP_002465056.1| septum site-determining protein MinD [Chloroflexus aggregans DSM
           9485]
 gi|219544882|gb|ACL26620.1| septum site-determining protein MinD [Chloroflexus aggregans DSM
           9485]
          Length = 266

 Score = 50.4 bits (119), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 111/232 (47%), Gaps = 31/232 (13%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKD 213
           G  I+    +GGVG +T   N   ++A      +V   +  L +LD+  G  N I +D  
Sbjct: 2   GRVITITSGKGGVGKTTTTANLGTALAMRGARVAVVDADIGLRNLDVVMGLENRIVYD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVS--RLPVFYAENLSILTAPAMLSRTYD-FDEKMIVPVLDI 270
               + D +    R+ +A +   RLP      L +L  PA  +R  D  + + ++ + + 
Sbjct: 60  ----LVDVVEGRARLRQALIKDKRLP-----ELCLL--PAAQTRDKDAVNAQQMIDLTNQ 108

Query: 271 LEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADK- 329
           L   F  V++D P    +  +  +  +D+V+I T+ +++ +R++  ++ +++    A+K 
Sbjct: 109 LRAEFDFVLIDSPAGIEAGFRNAIAGADEVIIVTTPEVSAVRDADRIVGLVE---AAEKG 165

Query: 330 PPYLVLNQVK---TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
           P  L++N++K     +   +S+ D    L I+   I+P D  +  ++ N G+
Sbjct: 166 PASLIINRIKPRLVSRGEMLSVEDVLELLAISLLGIVPEDETIV-IATNRGE 216


>gi|311743550|ref|ZP_07717356.1| Flp pilus assembly protein ATPase CpaE family protein
           [Aeromicrobium marinum DSM 15272]
 gi|311312680|gb|EFQ82591.1| Flp pilus assembly protein ATPase CpaE family protein
           [Aeromicrobium marinum DSM 15272]
          Length = 401

 Score = 50.4 bits (119), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 99/217 (45%), Gaps = 3/217 (1%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           I  +  +GGVG ++I+ N A  +A     E +L DLDL +G      + +P +++  A+ 
Sbjct: 149 IVVVSPKGGVGKTSISTNLAIGLAEQHPSEVVLVDLDLQFGDVASTLNINPTSTMEHALT 208

Query: 224 PVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVP 283
                D   +  +   +     +L      + T     + I  +++ L   F  V++D  
Sbjct: 209 DEAAEDTFVLKTMLAVHPSGFHVLPGADSPAATEHATGRQIRRLIEQLATQFAYVVVDTA 268

Query: 284 HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKK 343
              +  T   L ++D V++ +++D++ +R  +  I++L +L        +VLN     ++
Sbjct: 269 AGLDEPTLAALEVADDVIVVSTMDVSCVRGVRKEIELLLQLELLPASRMVVLNLAD--RQ 326

Query: 344 PEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMI 380
             + + D  A +G+    +IP    V  +++N G+ I
Sbjct: 327 SGMRVKDVEAVIGLPVDVVIPRAPEV-QLASNHGEPI 362


>gi|329928484|ref|ZP_08282352.1| septum site-determining protein MinD [Paenibacillus sp. HGF5]
 gi|328937743|gb|EGG34151.1| septum site-determining protein MinD [Paenibacillus sp. HGF5]
          Length = 264

 Score = 50.4 bits (119), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 66/279 (23%), Positives = 120/279 (43%), Gaps = 33/279 (11%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI--NFDKDPINSI 218
           G +I     +GGVG +T + N   ++A +   +  L D D+     ++    +   I  +
Sbjct: 2   GEAIVVTSGKGGVGKTTTSANIGTALA-LLGKKVCLVDTDIGLRNLDVVMGLENRIIYDL 60

Query: 219 SDAIYPVGRIDKAFVS--RLPVFYAENLSILTAPAMLSRTYDFDEKMIVP--VLDI---L 271
            D      R+++A +   R    Y           ML      D+  + P  V DI   L
Sbjct: 61  CDVAEGRCRLNQALIKDKRFDELY-----------MLPAAQTKDKNAVSPEQVKDIVLEL 109

Query: 272 EQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPP 331
           ++ F  VI+D P       +  +  +DK ++ T+ + A +R++  +I +L+      + P
Sbjct: 110 KKEFEYVIIDCPAGIEQGFKNAIAGADKAIVVTTPENAAVRDADRIIGLLESSHV--ESP 167

Query: 332 YLVLNQVK---TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK-MIHEVDPKS 387
            LV+N+++         + I D    L I    I+P D  V   +AN G+  +   D ++
Sbjct: 168 KLVVNRIRPNMVKSGDMLEIEDVLQVLNIDLIGIVPDDEMVI-KAANIGEPTVMNPDSQA 226

Query: 388 AIANLLVDFSRVLMGR---VTVSKPQSAMYTKIKKIFNM 423
           AIA    + +R ++G    +     +  M+TK KK F M
Sbjct: 227 AIA--YRNIARRILGDTVPLMQIHQKKGMFTKFKKFFGM 263


>gi|239946445|ref|ZP_04698201.1| chromosome partitioning ParA family protein [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239920721|gb|EER20748.1| chromosome partitioning ParA family protein [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 253

 Score = 50.4 bits (119), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 85/186 (45%), Gaps = 21/186 (11%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKD---------- 213
           I+ I  +GGVG STI+ N A+SIA      TL+ D+D P   +   F  D          
Sbjct: 4   IAIINQKGGVGKSTISANLAYSIAC-LNYSTLIIDMD-PQAHSCEVFKSDLHIKHTIKDL 61

Query: 214 ---PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTY-DFDEKMIVPVLD 269
              P   I   IYP  +I    +  L V ++   +IL + A  S T+ +  EK+++  + 
Sbjct: 62  FSQPSTKIEKIIYP-AKIKDILIKNLDVIHS---NILFSKASESVTFRNHREKILISSIK 117

Query: 270 ILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADK 329
            L + +  VILD P      T   +  ++ ++I  + D A L  + +LI   ++++    
Sbjct: 118 NLHK-YEYVILDCPPNLGVITVNAIYSANIIIIPITYDKAALDGTADLIHTAREIKEVSN 176

Query: 330 PPYLVL 335
             Y ++
Sbjct: 177 INYYIV 182


>gi|254777052|ref|ZP_05218568.1| hypothetical protein MaviaA2_20624 [Mycobacterium avium subsp.
           avium ATCC 25291]
          Length = 432

 Score = 50.4 bits (119), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 82/164 (50%), Gaps = 10/164 (6%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           ++F+  +GGVG +TIA     + AS+     +  D +   GT +     +   ++   ++
Sbjct: 181 VTFLSLKGGVGKTTIAATLGATFASIRGDRVVAVDANPDRGTLSQKIPLETAATVRQLLH 240

Query: 224 PVGRID-----KAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLV 278
             G I+     + + S+ P    E L+  T PA +S  +  D+   V +LDILE+ + LV
Sbjct: 241 DAGTIERYSDVRRYTSKGPSGL-EVLASETDPA-VSEAFSADD--YVRILDILERFYGLV 296

Query: 279 ILDV-PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL 321
           + D  P + +S  + VL  +D +V+ +S  + G R++   +D L
Sbjct: 297 LTDCGPGLLHSVMKSVLDKADALVVVSSASIDGARSASATLDWL 340


>gi|309789727|ref|ZP_07684307.1| septum site-determining protein MinD [Oscillochloris trichoides
           DG6]
 gi|308228213|gb|EFO81861.1| septum site-determining protein MinD [Oscillochloris trichoides
           DG6]
          Length = 266

 Score = 50.4 bits (119), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 64/280 (22%), Positives = 129/280 (46%), Gaps = 44/280 (15%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKDPIN 216
           I+    +GGVG +T   N   ++A      +V   +  L +LD+  G  N I +D     
Sbjct: 5   ITITSGKGGVGKTTTTANLGTALAMQGAKVAVIDADIGLRNLDVVMGLENRIVYD----- 59

Query: 217 SISDAIYPVGRIDKAFVS--RLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI 274
            + D +    R+ +A +   RLP      L +L A    ++T D D      ++D+  Q+
Sbjct: 60  -LVDVVEGRARLRQALIKDKRLP-----ELCLLPA----AQTRDKDAVSADQMIDLTNQL 109

Query: 275 ---FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADK-P 330
              F  V++D P       +  +  +D+V+I T+ +++ +R++  ++ +++    A+K P
Sbjct: 110 RGEFDYVLIDSPAGIEGGFRNAIAGADEVLIVTTPEVSAVRDADRIVGLVE---AAEKGP 166

Query: 331 PYLVLNQVK---TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS 387
           P L++N++K     +   +S+ D    L I    I+P D ++   S N G+ +   D  S
Sbjct: 167 PSLIVNRIKPRLVNRGEMLSVEDVLELLAINLMGIVPDDESIV-TSTNRGEAVV-YDQNS 224

Query: 388 AIANLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNM 423
                 ++ +R + G     +T+S  Q  +    +++F +
Sbjct: 225 LAGKAFLNVARRVAGEDVPFMTLSDQQGVL----ERLFGL 260


>gi|118463940|ref|YP_883744.1| hypothetical protein MAV_4615 [Mycobacterium avium 104]
 gi|118165227|gb|ABK66124.1| conserved hypothetical protein [Mycobacterium avium 104]
          Length = 432

 Score = 50.4 bits (119), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 82/164 (50%), Gaps = 10/164 (6%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           ++F+  +GGVG +TIA     + AS+     +  D +   GT +     +   ++   ++
Sbjct: 181 VAFLSLKGGVGKTTIAATLGATFASIRGDRVVAVDANPDRGTLSQKIPLETAATVRQLLH 240

Query: 224 PVGRID-----KAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLV 278
             G I+     + + S+ P    E L+  T PA +S  +  D+   V +LDILE+ + LV
Sbjct: 241 DAGTIERYSDVRRYTSKGPSGL-EVLASETDPA-VSEAFSADD--YVRILDILERFYGLV 296

Query: 279 ILDV-PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL 321
           + D  P + +S  + VL  +D +V+ +S  + G R++   +D L
Sbjct: 297 LTDCGPGLLHSVMKSVLDKADALVVVSSASIDGARSASATLDWL 340


>gi|16803584|ref|NP_465069.1| hypothetical protein lmo1544 [Listeria monocytogenes EGD-e]
 gi|46907772|ref|YP_014161.1| septum site-determining protein MinD [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|47093079|ref|ZP_00230856.1| septum site-determining protein MinD [Listeria monocytogenes str.
           4b H7858]
 gi|47096707|ref|ZP_00234292.1| septum site-determining protein MinD [Listeria monocytogenes str.
           1/2a F6854]
 gi|226224145|ref|YP_002758252.1| cell division inhibitor (septum placement) protein MinD [Listeria
           monocytogenes Clip81459]
 gi|254824397|ref|ZP_05229398.1| septum site-determining protein MinD [Listeria monocytogenes FSL
           J1-194]
 gi|254828222|ref|ZP_05232909.1| septum site-determining protein MinD [Listeria monocytogenes FSL
           N3-165]
 gi|254829697|ref|ZP_05234352.1| cell division inhibitor (septum placement) protein MinD [Listeria
           monocytogenes 10403S]
 gi|254852168|ref|ZP_05241516.1| septum site-determining protein MinD [Listeria monocytogenes FSL
           R2-503]
 gi|254898290|ref|ZP_05258214.1| cell division inhibitor (septum placement) protein MinD [Listeria
           monocytogenes J0161]
 gi|254912218|ref|ZP_05262230.1| septum site-determining protein MinD [Listeria monocytogenes J2818]
 gi|254931479|ref|ZP_05264838.1| septum site-determining protein MinD [Listeria monocytogenes
           HPB2262]
 gi|254936546|ref|ZP_05268243.1| septum site-determining protein MinD [Listeria monocytogenes F6900]
 gi|255521599|ref|ZP_05388836.1| cell division inhibitor (septum placement) protein MinD [Listeria
           monocytogenes FSL J1-175]
 gi|284801934|ref|YP_003413799.1| hypothetical protein LM5578_1689 [Listeria monocytogenes 08-5578]
 gi|284995076|ref|YP_003416844.1| hypothetical protein LM5923_1641 [Listeria monocytogenes 08-5923]
 gi|300764789|ref|ZP_07074779.1| septum site-determining protein MinD [Listeria monocytogenes FSL
           N1-017]
 gi|16410973|emb|CAC99622.1| minD [Listeria monocytogenes EGD-e]
 gi|46881041|gb|AAT04338.1| septum site-determining protein MinD [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|47014891|gb|EAL05839.1| septum site-determining protein MinD [Listeria monocytogenes str.
           1/2a F6854]
 gi|47018519|gb|EAL09275.1| septum site-determining protein MinD [Listeria monocytogenes str.
           4b H7858]
 gi|225876607|emb|CAS05316.1| Putative cell division inhibitor (septum placement) protein MinD
           [Listeria monocytogenes serotype 4b str. CLIP 80459]
 gi|258600610|gb|EEW13935.1| septum site-determining protein MinD [Listeria monocytogenes FSL
           N3-165]
 gi|258605472|gb|EEW18080.1| septum site-determining protein MinD [Listeria monocytogenes FSL
           R2-503]
 gi|258609140|gb|EEW21748.1| septum site-determining protein MinD [Listeria monocytogenes F6900]
 gi|284057496|gb|ADB68437.1| hypothetical protein LM5578_1689 [Listeria monocytogenes 08-5578]
 gi|284060543|gb|ADB71482.1| hypothetical protein LM5923_1641 [Listeria monocytogenes 08-5923]
 gi|293583031|gb|EFF95063.1| septum site-determining protein MinD [Listeria monocytogenes
           HPB2262]
 gi|293590191|gb|EFF98525.1| septum site-determining protein MinD [Listeria monocytogenes J2818]
 gi|293593632|gb|EFG01393.1| septum site-determining protein MinD [Listeria monocytogenes FSL
           J1-194]
 gi|300514465|gb|EFK41522.1| septum site-determining protein MinD [Listeria monocytogenes FSL
           N1-017]
 gi|328474903|gb|EGF45703.1| septum site-determining protein MinD [Listeria monocytogenes 220]
 gi|332311986|gb|EGJ25081.1| Septum site-determining protein minD [Listeria monocytogenes str.
           Scott A]
          Length = 266

 Score = 50.4 bits (119), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 59/281 (20%), Positives = 130/281 (46%), Gaps = 33/281 (11%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKD 213
           G +I     +GGVG +T   N   ++A       +  M+  L +LD+  G  N I +D  
Sbjct: 2   GEAIVITSGKGGVGKTTSTANLGTALALQGKKVCLIDMDIGLRNLDVVLGLENRIIYD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
               + D +    +I +A +      + + L +L A     +     E+M+    D++ Q
Sbjct: 60  ----LVDVVEGRCKIHQAMIK--DKRFDDLLFLLPAAQTTDKNAVSGEQMV----DLINQ 109

Query: 274 IFP---LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP 330
           + P    +++D P    +  +  +  +DK ++ T+ +++ +R++  +I +L+K     +P
Sbjct: 110 LRPDYDFILIDCPAGIETGYKNAVAGADKAIVVTTPEISAVRDADRIIGLLEK--EDIEP 167

Query: 331 PYLVLNQVKTP---KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS 387
           P L++N+++T        + I +    L I    II  D  V   S+NSG  +  + P +
Sbjct: 168 PKLIINRIRTQMMMNGDVMDIDEITTHLSIELLGIIIDDDEVI-RSSNSGDPVAML-PNN 225

Query: 388 AIANLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
             +    + +R ++G     +++   ++  + ++K++F+ K
Sbjct: 226 RASQGYRNIARRILGESIPLMSIETKKAGFFARLKQLFSGK 266


>gi|91783012|ref|YP_558218.1| putative pilus assembly protein, CpaE-like [Burkholderia xenovorans
           LB400]
 gi|91686966|gb|ABE30166.1| Putative pilus assembly protein, CpaE-like protein [Burkholderia
           xenovorans LB400]
          Length = 413

 Score = 50.4 bits (119), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 76/372 (20%), Positives = 142/372 (38%), Gaps = 45/372 (12%)

Query: 32  HVFCVTDTLYS--VVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDS 89
           HV  + DTL +  VVE + +DP M  +  RI              +  P L+ V      
Sbjct: 26  HVHWLADTLVAAGVVETATLDPSM--LTQRIA-------------TLNPSLVFVDFSCGR 70

Query: 90  REVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAI 149
               SA          G +++ +G   +     A +   V +++       D +     +
Sbjct: 71  AAAASAAASAVRAAYPGMQIVALGSLAEPESALAALRAGVRDFIDLSAPREDALRITRQV 130

Query: 150 FTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIAS---VFAMETLLADLDLPYGTA 206
                E     G   + +G+R G+G ST+A N +  +         +  L DL LP G A
Sbjct: 131 LDNLVEPVSRHGHVTALLGARVGMGVSTLAANLSVMLQRRDVAQGRQAALLDLGLPAGDA 190

Query: 207 NINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVP 266
           ++  +     S  +A+  + R D+ FV      +A  L++ T P  L+   +      + 
Sbjct: 191 SLLLNTRSEFSFVEAVRNLRRFDQTFVHTALSHHASGLALTTLPPNLADMREVSYSSSIG 250

Query: 267 VLDILEQIFPLVILDVPHVWNS-WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
           +L  L   F   I+D+    N  +   V+  +D+  +     +A + ++  ++D L++  
Sbjct: 251 LLTRLRAFFDQQIIDLGGFTNGEFIAHVVQAADETWLLCDQGVASIVSAVGVLDALREEG 310

Query: 326 PADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAI-----------IPFDGAVFGMSA 374
                  L++N+             F A LG+ P+ I           +P      G +A
Sbjct: 311 VDTANVRLIVNK-------------FDADLGLAPAQIAQRLDIALLGTLPERRIALGQAA 357

Query: 375 NSGKMIHEVDPK 386
           N G ++ +V  +
Sbjct: 358 NQGHLLVDVAAR 369


>gi|207724788|ref|YP_002255185.1| pilus assembly protein [Ralstonia solanacearum MolK2]
 gi|206590013|emb|CAQ36974.1| pilus assembly protein [Ralstonia solanacearum MolK2]
          Length = 439

 Score = 50.4 bits (119), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 61/328 (18%), Positives = 130/328 (39%), Gaps = 10/328 (3%)

Query: 106 GTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSS-GCSI 164
           G  ++ +G   D     A +   V +++    + A+ +  +  +   +   + +  G  +
Sbjct: 98  GLPLVAVGAAADGRAMLAALRAGVKDFIDVDGAPAEAVRVVRRLLAERASAEPTRRGRVL 157

Query: 165 SFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYP 224
           + +G+R GVG++T+A N A  +      + +L DL  P     +  +        +A+  
Sbjct: 158 AILGARPGVGTTTLAANLATLVRRTAGSDVMLLDLGQPLRDGALYLNVPANFHFVEAVRN 217

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH 284
           + R D+ FV      +   L++L  P  L+   D      + +L+ L   F L ++D+  
Sbjct: 218 LRRFDQVFVQTALSRHPNGLAVLPLPVSLAEMRDISFSEALGLLNRLRTFFDLQVVDLGG 277

Query: 285 VWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKK 343
             N  +  +++  +D V++ T   +  + ++  L+  LKK R  D+   L L   K   +
Sbjct: 278 FNNIDFIAQLVKAADDVMLVTEQSVGAIVSAAELLQELKK-REIDR-DQLHLTISKFDAR 335

Query: 344 PEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGR 403
             +        L I     +P       +++N G  + E  P       +   ++ L   
Sbjct: 336 LSLDAEQIAERLEIPSVMTVPSRRQALVVASNQGATLAETRPIDPYVRAIAGIAQALGYT 395

Query: 404 VTVSKP------QSAMYTKIKKIFNMKC 425
               +P       + M T++ + F  K 
Sbjct: 396 QPGERPPGMAGWMAGMRTRLGERFRRKS 423


>gi|330816716|ref|YP_004360421.1| Response regulator receiver protein [Burkholderia gladioli BSR3]
 gi|327369109|gb|AEA60465.1| Response regulator receiver protein [Burkholderia gladioli BSR3]
          Length = 417

 Score = 50.1 bits (118), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 113/264 (42%), Gaps = 32/264 (12%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSI---ASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  +S +G+R G+G ST+A N A  +   A+  +  T L DL LP G   +  +      
Sbjct: 141 GKVLSLLGARPGMGVSTLAANLAVLLQRKAAAQSRRTALIDLGLPAGDGALFLNTRCELH 200

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
             +A+  + R D+ FV+     +A  +++ T P  L+   +        + + L      
Sbjct: 201 FVEAVRNLRRFDRTFVNTAFAHHASGVALTTLPPNLADLREVSAAACTGLFNRLRAFVDQ 260

Query: 278 VILDVPHVWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            ++D+    N  +  ++++LSD+V +     +A + ++  L+  L++         + L 
Sbjct: 261 QVVDLGGFTNREFISQIVSLSDEVWLVCDQGVASVVSAVELLGDLRE-------KGINLE 313

Query: 337 QVKTPKKPEISISDFCAPLGITPS-----------AIIPFDGAVFGMSANSGKMIHEVDP 385
           +VK      + ++ + A +G+ P+           A +P      G +AN G++I E   
Sbjct: 314 RVK------LVVNQYDAAIGLLPAQIAERLEIPLLATLPSRRVPIGHAANQGRLIVEAAE 367

Query: 386 KSAIANLLVDFSRVLMGRVTVSKP 409
           +      L   S     R+TV  P
Sbjct: 368 RDPYVKALDALSE----RLTVGVP 387


>gi|258515697|ref|YP_003191919.1| Septum formation inhibitor-activating ATPase- like protein
           [Desulfotomaculum acetoxidans DSM 771]
 gi|257779402|gb|ACV63296.1| Septum formation inhibitor-activating ATPase- like protein
           [Desulfotomaculum acetoxidans DSM 771]
          Length = 416

 Score = 50.1 bits (118), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 89/207 (42%), Gaps = 8/207 (3%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           I F G  GGVG +T+A N   ++A      T+L D D+  G         P  ++ D I 
Sbjct: 162 ICFFGVNGGVGKTTMAINTGIALAKQ-GQSTVLVDFDVFSGDVVTRLKVKPTTTMVDWIR 220

Query: 224 PVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVP 283
             G  D      L   ++  L IL AP         + ++   +L IL + F +VI+D  
Sbjct: 221 --GNSDD-LSQCLADHHSTGLKILPAPLNHEEGELINPEITGKILSILTRRFDVVIVDTA 277

Query: 284 HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR-PADKPPYLVLNQVKTPK 342
            +  + T   +  + +V I    D A +  +  +I  +  +    DK   LV    K PK
Sbjct: 278 PLLIAPTLITIEHATRVFILVPPDSATVAKTNTVIRRMDMINFEKDKFSLLV---TKMPK 334

Query: 343 KPEISISDFCAPLGITPSAIIPFDGAV 369
           K  + ++D  + L +  + IIP+D  V
Sbjct: 335 KQPLRVNDMTSVLNMKLAGIIPYDEGV 361


>gi|327189771|gb|EGE56915.1| response regulator receiver protein [Rhizobium etli CNPAF512]
          Length = 380

 Score = 50.1 bits (118), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 74/333 (22%), Positives = 141/333 (42%), Gaps = 38/333 (11%)

Query: 74  DSSTPDLIIVQTKVDSREVLSALEPLA-EVCDSGTKVIVIGDTNDVSLYRALISNHVSEY 132
           D +  DLI++   VD  E+L   E  A         ++V+ +     + R L   + +++
Sbjct: 53  DPTQFDLIVLD--VDRGELLQRPELFAFRTSHRDIPLVVVSEDLPDDMLRLLFRLNGNDW 110

Query: 133 LIEPLSVADIINSISAIFTPQEEGKGSSGCSI-SFIGSRGGVGSSTIAHNCAFSIASVFA 191
           L +PL    +I+ IS        G G+S   + + + + GG G+S IA     S+A V A
Sbjct: 111 LKKPLERRALIDMIST----HAPGTGASDSRVHAVVSAVGGAGASMIAS----SLAHVLA 162

Query: 192 METL-------LADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENL 244
             T        L D D   GT     +      +   I    R+D  F+  +   ++   
Sbjct: 163 QPTKNSKPRVDLFDTDFCAGTLGYYLNLVNDYDLKPVIANPSRVDLEFIDLVKKRHSGGF 222

Query: 245 SILT--APAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVI 302
           S+L+   P++L        ++++ +LD+        I+D+P+    W  +VLT  + + I
Sbjct: 223 SLLSFKQPSVLLAPKG--GELVLRMLDVAAFESDHTIIDIPYYDTPWKYDVLTSVNSICI 280

Query: 303 TTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTP--------KKPEISISDFCAP 354
            T + +  L  +K+L   L +LR +    ++V+N+ +          ++ E    D    
Sbjct: 281 VTEMTVPALSQAKDLFANLVRLRGSSDQIFIVINKYRAKLFGLGVRRQQTEKIFKDI--- 337

Query: 355 LGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS 387
               P+ +I  D      +AN G +  +V+ ++
Sbjct: 338 ----PTHVIADDWETVSEAANRGVLPFQVNSRA 366


>gi|328952513|ref|YP_004369847.1| response regulator receiver protein [Desulfobacca acetoxidans DSM
           11109]
 gi|328452837|gb|AEB08666.1| response regulator receiver protein [Desulfobacca acetoxidans DSM
           11109]
          Length = 415

 Score = 50.1 bits (118), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 78/168 (46%)

Query: 170 RGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRID 229
           +GG G ST+A N A  +  +   + LL DL+L  G   +  +     S  D    + R+D
Sbjct: 154 KGGQGISTVALNLADHVQRLSGDKVLLIDLNLYLGDIGVRLNLGAPYSPFDLHKDLHRLD 213

Query: 230 KAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSW 289
           +  +    + +     IL+ P  +S         +  +L +L      +I+D+PH +++ 
Sbjct: 214 RDLLFSSLLKHERGFYILSCPDEISDADRLQGDDVTQMLSVLTNYLDYLIIDLPHDFSTR 273

Query: 290 TQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQ 337
           +   L  +D +++    +LA ++ +  ++D  ++L       +L+LN+
Sbjct: 274 SLAALEAADNILLLVQQELAAVKITLRVLDFFRELGYDRNKIHLILNR 321


>gi|325109816|ref|YP_004270884.1| hypothetical protein Plabr_3265 [Planctomyces brasiliensis DSM
           5305]
 gi|324970084|gb|ADY60862.1| hypothetical protein Plabr_3265 [Planctomyces brasiliensis DSM
           5305]
          Length = 411

 Score = 50.1 bits (118), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 61/270 (22%), Positives = 114/270 (42%), Gaps = 12/270 (4%)

Query: 60  ITRGSIAEAVSCFSDSSTP-DLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDV 118
           + R S  + +S  ++ +   DL+IV         L +L+ L     +   ++VIG  +  
Sbjct: 30  VGRQSRQQGISSEAEETQGVDLVIVDCPAGQELDLVSLQGLRR--QTKAWMVVIGRVSSA 87

Query: 119 SLYRALISNHVSEYLIEPL----SVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVG 174
           S    ++ N V  ++         +A I ++ +    PQEE        ++ + + GG G
Sbjct: 88  SQIVEMLQNGVDSFVDRDRESGPQLAAIFDNWTRHAGPQEETPRQI---VAVLSASGGNG 144

Query: 175 SSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVS 234
           +ST+A N +  +A       L+ DLDL         +  P +S+ D       +D   V 
Sbjct: 145 ASTLAANLSVCVAQRTGACGLV-DLDLAQPDQAALLNLKPKHSLVDLCQSSSLVDPNMVR 203

Query: 235 RLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWN-SWTQEV 293
           +  V +   + +L  P  L          +  ++ I  Q FP+ ++D   V   S   ++
Sbjct: 204 QSMVSHECGIKLLAGPDRLDADMYPSADKLNKIVRIAAQQFPVTVVDFGGVREFSRHTDL 263

Query: 294 LTLSDKVVITTSLDLAGLRNSKNLIDVLKK 323
           L    +VVI   LD  GL +++ L+D  ++
Sbjct: 264 LRECGQVVIVARLDFTGLCHARRLLDECER 293


>gi|29829797|ref|NP_824431.1| septum site-determining protein [Streptomyces avermitilis MA-4680]
 gi|29606906|dbj|BAC70966.1| putative septum site-determining protein [Streptomyces avermitilis
           MA-4680]
          Length = 535

 Score = 50.1 bits (118), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 76/168 (45%), Gaps = 2/168 (1%)

Query: 158 GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  G  ++  G++GGVG++  A   A + A        L DLDL  G      D     S
Sbjct: 147 GPGGTVVTVTGAKGGVGATVTAVQLALA-ARASGRTVALLDLDLQSGDVASYLDVQFRRS 205

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
           ++D +  +  I+   +      +   + +L APA   R  +  +++   V+  L     +
Sbjct: 206 VAD-LAGITDINPRVLQDAVYIHDSGIGLLLAPAEGERGEEVTDRVARQVVGTLRSRHDV 264

Query: 278 VILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
           VI+D     NS T   + ++D+ ++  + D+  +R +K ++ +  +L+
Sbjct: 265 VIVDCGSQMNSATAAAVEMADQALLLVTPDVVAIRAAKRMVRMWDRLQ 312


>gi|313608643|gb|EFR84494.1| septum site-determining protein MinD [Listeria monocytogenes FSL
           F2-208]
          Length = 266

 Score = 50.1 bits (118), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 58/278 (20%), Positives = 130/278 (46%), Gaps = 27/278 (9%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKD 213
           G +I     +GGVG +T   N   ++A       +  M+  L +LD+  G  N I +D  
Sbjct: 2   GEAIVITSGKGGVGKTTSTANLGTALALQGKKVCLIDMDIGLRNLDVVLGLENRIIYD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
               + D +    +I +A +      + + L +L A     +     E+M V +++ L  
Sbjct: 60  ----LVDVVEGRCKIHQAMIK--DKRFDDLLFLLPAAQTTDKNAVSGEQM-VELINQLRP 112

Query: 274 IFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYL 333
            +  +++D P    +  +  +  +DK ++ T+ +++ +R++  +I +L+K     +PP L
Sbjct: 113 DYDFILIDCPAGIETGYKNAVAGADKAIVVTTPEISAVRDADRIIGLLEK--EDIEPPKL 170

Query: 334 VLNQVKTP---KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIA 390
           ++N+++T        + I +    L I    II  D  V   S+NSG  +  + P +  +
Sbjct: 171 IINRIRTQMMVNGDVMDIDEITTHLSIELLGIIIDDDEVI-RSSNSGDPVAML-PNNRAS 228

Query: 391 NLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
               + +R ++G     +++   ++  ++++K++F+ K
Sbjct: 229 QGYRNIARRILGESIPLMSIETKKAGFFSRLKQLFSGK 266


>gi|146296876|ref|YP_001180647.1| septum site-determining protein MinD [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145410452|gb|ABP67456.1| septum site-determining protein MinD [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 266

 Score = 50.1 bits (118), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 56/263 (21%), Positives = 116/263 (44%), Gaps = 17/263 (6%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI--NFDKDPINSISDAIYPVG 226
            +GGVG +T   N   +  S+   + LL D D+     ++    +   +  I D +    
Sbjct: 10  GKGGVGKTTTTANVG-TYLSILGKKVLLIDADIGLRNLDVVMGLENRIVFDIVDVVEGRC 68

Query: 227 RIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVW 286
           +  +A V        E L +L A     +T    E+M   + + L + F  +++D P   
Sbjct: 69  KPKQALVKDKRF---EGLYLLPAAQSKDKTAVSPEQM-KTLCNELRKDFDFILIDCPAGI 124

Query: 287 NSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVK---TPKK 343
               +  +  +DK ++ T+ +++ +R++  +I +L+     +  P L++N+++     + 
Sbjct: 125 EQGFKNAIAGADKAIVVTTPEVSAVRDADRIIGLLEAYELHN--PKLIINRIRFDMVKRG 182

Query: 344 PEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGR 403
             + I D    L I+   IIP D  +  +S N G+ I   D KS       + +R ++G 
Sbjct: 183 DMMDIDDILEILSISLLGIIPDDEKII-ISTNKGEPIV-TDEKSKAGQEYRNIARRILGE 240

Query: 404 ---VTVSKPQSAMYTKIKKIFNM 423
              +  ++     + +IKK+F +
Sbjct: 241 DIPIVSNEENLGFFGRIKKLFGL 263


>gi|78357405|ref|YP_388854.1| response regulator receiver domain-containing protein
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
 gi|78219810|gb|ABB39159.1| response regulator receiver domain protein (CheY-like)
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
          Length = 413

 Score = 50.1 bits (118), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 58/281 (20%), Positives = 113/281 (40%), Gaps = 11/281 (3%)

Query: 129 VSEYLIEPLSVADIINSISAIFTPQEEGKGS-------SGCSISFIGSRGGVGSSTIAHN 181
           V+ +L +P S  +I  ++        E + +        G  I  +G++ G G++T+  N
Sbjct: 91  VTGFLEQPFSSDNIAAALEGYAARMRETETAPQPAVQRQGRIIHVLGAKSGSGATTVTVN 150

Query: 182 CAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYA 241
              + A      T + D+ LP G   +  D     + +DA   + R+D  ++  L   + 
Sbjct: 151 LGVNSAR-NGRSTAVMDMRLPQGEVPLFLDMQYARTWADAARELHRLDHMYLQSLMERHE 209

Query: 242 ENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVV 301
             L IL AP          E+ +  +L +L      V++D     +      +  +D+V+
Sbjct: 210 SGLEILAAPDENDAPETLSERSVRSILRLLRTRHDAVLIDGGPYADELALVSMHEADEVL 269

Query: 302 ITTSLDLAGLRNSKNLIDVLKKLRP-ADKPPYLVLNQVKTPKKPEISISDFCAPLGITPS 360
           + + L L  L  ++ L++ + +  P  D    LV+N  +      +S  +    L     
Sbjct: 270 LVSELSLPALAGARRLLNSIAQTAPDLDGKIRLVIN--RHAAGSGLSQEEAETLLERKAC 327

Query: 361 AIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLM 401
            +I  D      + N G  + +  P+S  A  L   + +LM
Sbjct: 328 CLIENDYEAAVSAVNQGVALCDAHPRSPAAKSLTALADILM 368


>gi|290893945|ref|ZP_06556921.1| septum site-determining protein MinD [Listeria monocytogenes FSL
           J2-071]
 gi|290556483|gb|EFD90021.1| septum site-determining protein MinD [Listeria monocytogenes FSL
           J2-071]
          Length = 266

 Score = 49.7 bits (117), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 58/278 (20%), Positives = 129/278 (46%), Gaps = 27/278 (9%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKD 213
           G +I     +GGVG +T   N   ++A       +  M+  L +LD+  G  N I +D  
Sbjct: 2   GEAIVITSGKGGVGKTTSTANLGTALALQGKKVCLIDMDIGLRNLDVVLGLENRIIYD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
               + D +    +I +A +      + + L +L A     +     E+M V +++ L  
Sbjct: 60  ----LVDVVEGRCKIHQAMIK--DKRFDDLLFLLPAAQTTDKNAVSGEQM-VELINQLRP 112

Query: 274 IFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYL 333
            +  +++D P    +  +  +  +DK ++ T+ +++ +R++  +I +L+K     +PP L
Sbjct: 113 DYDFILIDCPAGIETGYKNAVAGADKAIVVTTPEISAVRDADRIIGLLEK--EDIEPPKL 170

Query: 334 VLNQVKTP---KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIA 390
           ++N+++T        + I +    L I    II  D  V   S+NSG  +  + P +  +
Sbjct: 171 IINRIRTQMMVNGDVMDIDEITTHLSIELLGIIIDDDEVI-RSSNSGDPVAML-PNNRAS 228

Query: 391 NLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
               + +R ++G     +++   ++  ++++K++F  K
Sbjct: 229 QGYRNIARRILGESIPLMSIETKKAGFFSRLKQLFGGK 266


>gi|229175122|ref|ZP_04302638.1| Septum site-determining protein minD [Bacillus cereus MM3]
 gi|228608258|gb|EEK65564.1| Septum site-determining protein minD [Bacillus cereus MM3]
          Length = 265

 Score = 49.7 bits (117), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 58/278 (20%), Positives = 127/278 (45%), Gaps = 28/278 (10%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKD 213
           G +I     +GGVG +T + N   ++A       +   +  L +LD+  G  N I FD  
Sbjct: 2   GEAIVITSGKGGVGKTTTSANIGTALALSGKKVCLIDTDIGLRNLDVVMGLENRIVFD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
               + D +    R+ +A +        ++L +L A     ++    E+M   ++ +L Q
Sbjct: 60  ----LVDVVEGRCRLPQALIKDKRF---DDLYLLPAAQTSDKSAVTPEQMD-ELIQVLRQ 111

Query: 274 IFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYL 333
            +  +++D P       +  +  +DK ++ T+ +++ +R++  +I +L+K     +PP L
Sbjct: 112 DYDYILIDCPAGIEQGFKNAVAGADKAIVVTTPEVSSMRDADRIIGLLEK--EDIEPPKL 169

Query: 334 VLNQVKTPKKPE---ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIA 390
           V+N+V++    E   + + +    L I    ++  D  V   + N+G+ +  + P    A
Sbjct: 170 VINRVRSHMLHEQDMLDVDEIVRTLSIELLGVVEDDDEVI-RATNTGEPVA-LQPSGKAA 227

Query: 391 NLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
               + +R L+G         + + +++TK+K  F ++
Sbjct: 228 LAYRNIARRLLGENVPLQAFGQEKVSVFTKMKNFFGIR 265


>gi|217964309|ref|YP_002349987.1| septum site-determining protein MinD [Listeria monocytogenes HCC23]
 gi|217333579|gb|ACK39373.1| septum site-determining protein MinD [Listeria monocytogenes HCC23]
 gi|307571125|emb|CAR84304.1| septum site-determining protein [Listeria monocytogenes L99]
          Length = 266

 Score = 49.7 bits (117), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 58/278 (20%), Positives = 129/278 (46%), Gaps = 27/278 (9%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKD 213
           G +I     +GGVG +T   N   ++A       +  M+  L +LD+  G  N I +D  
Sbjct: 2   GEAIVITSGKGGVGKTTSTANLGTALALQGKKVCLIDMDIGLRNLDVVLGLENRIIYD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
               + D +    +I +A +      + + L +L A     +     E+M V +++ L  
Sbjct: 60  ----LVDVVEGRCKIHQAMIK--DKRFDDLLFLLPAAQTTDKNAVSGEQM-VELINQLRP 112

Query: 274 IFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYL 333
            +  +++D P    +  +  +  +DK ++ T+ +++ +R++  +I +L+K     +PP L
Sbjct: 113 DYDFILIDCPAGIETGYKNAVAGADKAIVVTTPEISAVRDADRIIGLLEK--EDIEPPKL 170

Query: 334 VLNQVKTP---KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIA 390
           ++N+++T        + I +    L I    II  D  V   S+NSG  +  + P +  +
Sbjct: 171 IINRIRTQMMMNGDVMDIDEITTHLSIELLGIIIDDDEVI-RSSNSGDPVAML-PNNRAS 228

Query: 391 NLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
               + +R ++G     +++   ++  ++++K++F  K
Sbjct: 229 QGYRNIARRILGESIPLMSIETKKAGFFSRLKQLFGGK 266


>gi|78212031|ref|YP_380810.1| septum site-determining protein MinD [Synechococcus sp. CC9605]
 gi|78196490|gb|ABB34255.1| septum site-determining protein MinD [Synechococcus sp. CC9605]
          Length = 270

 Score = 49.7 bits (117), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 67/281 (23%), Positives = 125/281 (44%), Gaps = 25/281 (8%)

Query: 159 SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLL-ADLDLPYGTANINFDKDPINS 217
           S+  +I     +GGVG +T   N   ++A   A   +L AD  L      +  +   + +
Sbjct: 2   STTRTILICSGKGGVGKTTTTANLGIALARQGAKTVVLDADFGLRNLDLLLGLENRIVYT 61

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTA--PAMLSRTYDFDEKMIVPVLDILEQIF 275
             + +    R+++A V         NL++L A  P ML      D + IV    +LE+ F
Sbjct: 62  AQEVLAETCRLEQALVKH---KQEPNLALLPAGNPRMLEWLKPKDMQAIVA---LLERQF 115

Query: 276 PLVILDVP-HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLV 334
             V++D P  + + +        + VVITT  ++A +R++  +I +L       +P  LV
Sbjct: 116 DYVLIDCPAGIEDGFKNAAAAAREAVVITTP-EVAAVRDADRVIGLLNT--QGVQPVQLV 172

Query: 335 LNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFG-----MSANSGKMIHEVDPKSAI 389
           LN+V+ PK   +S  +  +   +T    +P  G VF      +S N G+ +   D  S  
Sbjct: 173 LNRVR-PKM--MSNQEMLSVDDVTDILALPLLGLVFEDEQVIVSTNRGEPLTLSDSSSPA 229

Query: 390 ANLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMKCF 426
           A+   + ++ L G     +  S+ +  +  +++K+   + F
Sbjct: 230 AHAYGNIAQRLQGEDIPLMDPSQARRGLRARMRKLMQTRIF 270


>gi|218673835|ref|ZP_03523504.1| response regulator receiver protein [Rhizobium etli GR56]
          Length = 355

 Score = 49.7 bits (117), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 60/274 (21%), Positives = 124/274 (45%), Gaps = 15/274 (5%)

Query: 74  DSSTPDLIIVQTKVDSREVLSALEPLA-EVCDSGTKVIVIGDTNDVSLYRALISNHVSEY 132
           D +  DLI++   +D  E+L   E  A         ++V+ +     + R L   + +++
Sbjct: 28  DPTQFDLIVLD--LDKGELLHHPEVFAFRTSYRDIPLVVVSENLPDDMLRLLFRLNGNDW 85

Query: 133 LIEPLSVADIINSISAIFTPQEEGKGSSGCSI-SFIGSRGGVGSSTIAHNCAFSIASVFA 191
           L +PL    +I+ IS        G G+S   + + + + GG G+S IA + A  +A    
Sbjct: 86  LKKPLERRALIDMIST----HAPGTGASDSRVHAVVSAVGGAGASMIAASLAHVLAQPTK 141

Query: 192 METLLADL-DLPYGTANINFDKDPINS--ISDAIYPVGRIDKAFVSRLPVFYAENLSILT 248
             T   DL D  +    + +  + +N   +   I    R+D  F+  +   +    S+L+
Sbjct: 142 NSTPRVDLFDADFCAGMLGYYLNLVNDYDLKPVIANPSRVDLEFIDLVRKRHPGGFSLLS 201

Query: 249 --APAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSL 306
              P++L        ++++ +LD+        ++D+P+    W  +VLT  + + I T +
Sbjct: 202 FKQPSVLLTPKG--GELVLRMLDVAAFESDHTVIDIPYYDTPWKYDVLTSVNSICIVTEM 259

Query: 307 DLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKT 340
            +  L  +K+L   L +LR + +  ++V+N+ + 
Sbjct: 260 TVPALSQAKDLFATLVRLRGSSEQIFIVINKYRA 293


>gi|163942197|ref|YP_001647081.1| septum site-determining protein MinD [Bacillus weihenstephanensis
           KBAB4]
 gi|229013664|ref|ZP_04170793.1| Septum site-determining protein minD [Bacillus mycoides DSM 2048]
 gi|229019674|ref|ZP_04176481.1| Septum site-determining protein minD [Bacillus cereus AH1273]
 gi|229025911|ref|ZP_04182305.1| Septum site-determining protein minD [Bacillus cereus AH1272]
 gi|229062143|ref|ZP_04199467.1| Septum site-determining protein minD [Bacillus cereus AH603]
 gi|229135274|ref|ZP_04264070.1| Septum site-determining protein minD [Bacillus cereus BDRD-ST196]
 gi|229169191|ref|ZP_04296905.1| Septum site-determining protein minD [Bacillus cereus AH621]
 gi|163864394|gb|ABY45453.1| septum site-determining protein MinD [Bacillus weihenstephanensis
           KBAB4]
 gi|228614257|gb|EEK71368.1| Septum site-determining protein minD [Bacillus cereus AH621]
 gi|228648199|gb|EEL04238.1| Septum site-determining protein minD [Bacillus cereus BDRD-ST196]
 gi|228717126|gb|EEL68802.1| Septum site-determining protein minD [Bacillus cereus AH603]
 gi|228735389|gb|EEL85990.1| Septum site-determining protein minD [Bacillus cereus AH1272]
 gi|228741581|gb|EEL91774.1| Septum site-determining protein minD [Bacillus cereus AH1273]
 gi|228747586|gb|EEL97460.1| Septum site-determining protein minD [Bacillus mycoides DSM 2048]
          Length = 265

 Score = 49.7 bits (117), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 58/278 (20%), Positives = 127/278 (45%), Gaps = 28/278 (10%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKD 213
           G +I     +GGVG +T + N   ++A       +   +  L +LD+  G  N I FD  
Sbjct: 2   GEAIVITSGKGGVGKTTTSANIGTALALSGKKVCLIDTDIGLRNLDVVMGLENRIVFD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
               + D +    R+ +A +        ++L +L A     ++    E+M   ++ +L Q
Sbjct: 60  ----LVDVVEGRCRLPQALIKDKRF---DDLYLLPAAQTSDKSAVTPEQMD-ELIQVLRQ 111

Query: 274 IFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYL 333
            +  +++D P       +  +  +DK ++ T+ +++ +R++  +I +L+K     +PP L
Sbjct: 112 DYDYILIDCPAGIEQGFKNAVAGADKAIVVTTPEVSSMRDADRIIGLLEK--EDIEPPKL 169

Query: 334 VLNQVKTPKKPE---ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIA 390
           V+N+V++    E   + + +    L I    ++  D  V   + N+G+ +  + P    A
Sbjct: 170 VINRVRSHMLHEQDMLDVDEIVRTLSIELLGVVEDDDEVI-RATNTGEPVA-LQPSGKAA 227

Query: 391 NLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
               + +R L+G         + + +++TK+K  F ++
Sbjct: 228 IAYRNIARRLLGENVPLQAFEQEKVSVFTKMKNFFGIR 265


>gi|30264517|ref|NP_846894.1| septum site-determining protein MinD [Bacillus anthracis str. Ames]
 gi|47529979|ref|YP_021328.1| septum site-determining protein MinD [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|47566639|ref|ZP_00237461.1| septum site-determining protein MinD [Bacillus cereus G9241]
 gi|49187341|ref|YP_030593.1| septum site-determining protein MinD [Bacillus anthracis str.
           Sterne]
 gi|49481411|ref|YP_038499.1| septum site-determining protein; cell division inhibitor [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|52141057|ref|YP_085772.1| septum site-determining protein; cell division inhibitor [Bacillus
           cereus E33L]
 gi|65321818|ref|ZP_00394777.1| COG2894: Septum formation inhibitor-activating ATPase [Bacillus
           anthracis str. A2012]
 gi|118479604|ref|YP_896755.1| septum site-determining protein MinD [Bacillus thuringiensis str.
           Al Hakam]
 gi|165871970|ref|ZP_02216611.1| septum site-determining protein MinD [Bacillus anthracis str.
           A0488]
 gi|167636172|ref|ZP_02394476.1| septum site-determining protein MinD [Bacillus anthracis str.
           A0442]
 gi|167640753|ref|ZP_02399013.1| septum site-determining protein MinD [Bacillus anthracis str.
           A0193]
 gi|170688657|ref|ZP_02879862.1| septum site-determining protein MinD [Bacillus anthracis str.
           A0465]
 gi|170708381|ref|ZP_02898825.1| septum site-determining protein MinD [Bacillus anthracis str.
           A0389]
 gi|177653986|ref|ZP_02936027.1| septum site-determining protein MinD [Bacillus anthracis str.
           A0174]
 gi|190566967|ref|ZP_03019883.1| septum site-determining protein MinD [Bacillus anthracis
           Tsiankovskii-I]
 gi|196034297|ref|ZP_03101706.1| septum site-determining protein MinD [Bacillus cereus W]
 gi|196039291|ref|ZP_03106597.1| septum site-determining protein MinD [Bacillus cereus NVH0597-99]
 gi|196044964|ref|ZP_03112198.1| septum site-determining protein MinD [Bacillus cereus 03BB108]
 gi|206975935|ref|ZP_03236845.1| septum site-determining protein MinD [Bacillus cereus H3081.97]
 gi|217961938|ref|YP_002340508.1| septum site-determining protein MinD [Bacillus cereus AH187]
 gi|218905643|ref|YP_002453477.1| septum site-determining protein MinD [Bacillus cereus AH820]
 gi|222097895|ref|YP_002531952.1| septum site-determining protein; cell division inhibitor [Bacillus
           cereus Q1]
 gi|225866430|ref|YP_002751808.1| septum site-determining protein MinD [Bacillus cereus 03BB102]
 gi|227817229|ref|YP_002817238.1| septum site-determining protein MinD [Bacillus anthracis str. CDC
           684]
 gi|228917087|ref|ZP_04080645.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228929494|ref|ZP_04092514.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228935768|ref|ZP_04098580.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228948163|ref|ZP_04110447.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228987701|ref|ZP_04147812.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|229032100|ref|ZP_04188081.1| Septum site-determining protein minD [Bacillus cereus AH1271]
 gi|229093522|ref|ZP_04224624.1| Septum site-determining protein minD [Bacillus cereus Rock3-42]
 gi|229098922|ref|ZP_04229857.1| Septum site-determining protein minD [Bacillus cereus Rock3-29]
 gi|229105087|ref|ZP_04235738.1| Septum site-determining protein minD [Bacillus cereus Rock3-28]
 gi|229117950|ref|ZP_04247311.1| Septum site-determining protein minD [Bacillus cereus Rock1-3]
 gi|229123989|ref|ZP_04253181.1| Septum site-determining protein minD [Bacillus cereus 95/8201]
 gi|229141187|ref|ZP_04269726.1| Septum site-determining protein minD [Bacillus cereus BDRD-ST26]
 gi|229158065|ref|ZP_04286135.1| Septum site-determining protein minD [Bacillus cereus ATCC 4342]
 gi|229163405|ref|ZP_04291356.1| Septum site-determining protein minD [Bacillus cereus R309803]
 gi|229186690|ref|ZP_04313849.1| Septum site-determining protein minD [Bacillus cereus BGSC 6E1]
 gi|229603415|ref|YP_002868733.1| septum site-determining protein MinD [Bacillus anthracis str.
           A0248]
 gi|254687061|ref|ZP_05150919.1| septum site-determining protein MinD [Bacillus anthracis str.
           CNEVA-9066]
 gi|254724623|ref|ZP_05186406.1| septum site-determining protein MinD [Bacillus anthracis str.
           A1055]
 gi|254736553|ref|ZP_05194259.1| septum site-determining protein MinD [Bacillus anthracis str.
           Western North America USA6153]
 gi|254741591|ref|ZP_05199278.1| septum site-determining protein MinD [Bacillus anthracis str.
           Kruger B]
 gi|254754811|ref|ZP_05206846.1| septum site-determining protein MinD [Bacillus anthracis str.
           Vollum]
 gi|254757643|ref|ZP_05209670.1| septum site-determining protein MinD [Bacillus anthracis str.
           Australia 94]
 gi|30259175|gb|AAP28380.1| septum site-determining protein MinD [Bacillus anthracis str. Ames]
 gi|47505127|gb|AAT33803.1| septum site-determining protein MinD [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|47556669|gb|EAL15001.1| septum site-determining protein MinD [Bacillus cereus G9241]
 gi|49181268|gb|AAT56644.1| septum site-determining protein MinD [Bacillus anthracis str.
           Sterne]
 gi|49332967|gb|AAT63613.1| septum site-determining protein; cell division inhibitor [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|51974526|gb|AAU16076.1| septum site-determining protein; cell division inhibitor [Bacillus
           cereus E33L]
 gi|118418829|gb|ABK87248.1| septum site-determining protein MinD [Bacillus thuringiensis str.
           Al Hakam]
 gi|164712260|gb|EDR17796.1| septum site-determining protein MinD [Bacillus anthracis str.
           A0488]
 gi|167511325|gb|EDR86711.1| septum site-determining protein MinD [Bacillus anthracis str.
           A0193]
 gi|167528393|gb|EDR91161.1| septum site-determining protein MinD [Bacillus anthracis str.
           A0442]
 gi|170126756|gb|EDS95639.1| septum site-determining protein MinD [Bacillus anthracis str.
           A0389]
 gi|170667343|gb|EDT18101.1| septum site-determining protein MinD [Bacillus anthracis str.
           A0465]
 gi|172081041|gb|EDT66119.1| septum site-determining protein MinD [Bacillus anthracis str.
           A0174]
 gi|190561958|gb|EDV15927.1| septum site-determining protein MinD [Bacillus anthracis
           Tsiankovskii-I]
 gi|195992839|gb|EDX56798.1| septum site-determining protein MinD [Bacillus cereus W]
 gi|196024452|gb|EDX63125.1| septum site-determining protein MinD [Bacillus cereus 03BB108]
 gi|196029918|gb|EDX68519.1| septum site-determining protein MinD [Bacillus cereus NVH0597-99]
 gi|206745687|gb|EDZ57084.1| septum site-determining protein MinD [Bacillus cereus H3081.97]
 gi|217065910|gb|ACJ80160.1| septum site-determining protein MinD [Bacillus cereus AH187]
 gi|218535711|gb|ACK88109.1| septum site-determining protein MinD [Bacillus cereus AH820]
 gi|221241953|gb|ACM14663.1| septum site-determining protein; cell division inhibitor [Bacillus
           cereus Q1]
 gi|225788584|gb|ACO28801.1| septum site-determining protein MinD [Bacillus cereus 03BB102]
 gi|227002672|gb|ACP12415.1| septum site-determining protein MinD [Bacillus anthracis str. CDC
           684]
 gi|228596793|gb|EEK54454.1| Septum site-determining protein minD [Bacillus cereus BGSC 6E1]
 gi|228619974|gb|EEK76849.1| Septum site-determining protein minD [Bacillus cereus R309803]
 gi|228625384|gb|EEK82141.1| Septum site-determining protein minD [Bacillus cereus ATCC 4342]
 gi|228642228|gb|EEK98520.1| Septum site-determining protein minD [Bacillus cereus BDRD-ST26]
 gi|228659291|gb|EEL14939.1| Septum site-determining protein minD [Bacillus cereus 95/8201]
 gi|228665521|gb|EEL21002.1| Septum site-determining protein minD [Bacillus cereus Rock1-3]
 gi|228678268|gb|EEL32494.1| Septum site-determining protein minD [Bacillus cereus Rock3-28]
 gi|228684420|gb|EEL38363.1| Septum site-determining protein minD [Bacillus cereus Rock3-29]
 gi|228689852|gb|EEL43657.1| Septum site-determining protein minD [Bacillus cereus Rock3-42]
 gi|228729240|gb|EEL80236.1| Septum site-determining protein minD [Bacillus cereus AH1271]
 gi|228771975|gb|EEM20430.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228811521|gb|EEM57858.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228823825|gb|EEM69645.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228830174|gb|EEM75791.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228842505|gb|EEM87595.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|229267823|gb|ACQ49460.1| septum site-determining protein MinD [Bacillus anthracis str.
           A0248]
          Length = 265

 Score = 49.7 bits (117), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 58/278 (20%), Positives = 127/278 (45%), Gaps = 28/278 (10%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKD 213
           G +I     +GGVG +T + N   ++A       +   +  L +LD+  G  N I FD  
Sbjct: 2   GEAIVITSGKGGVGKTTTSANIGTALALSGKKVCLIDTDIGLRNLDVVMGLENRIVFD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
               + D +    R+ +A +        ++L +L A     ++    E+M   ++ +L Q
Sbjct: 60  ----LVDVVEGRCRLPQALIKDKRF---DDLYLLPAAQTSDKSAVTPEQMD-ELIQVLRQ 111

Query: 274 IFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYL 333
            +  +++D P       +  +  +DK ++ T+ +++ +R++  +I +L+K     +PP L
Sbjct: 112 DYDYILIDCPAGIEQGFKNAVAGADKAIVVTTPEVSSMRDADRIIGLLEK--EDIEPPKL 169

Query: 334 VLNQVKTPKKPE---ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIA 390
           V+N+V++    E   + + +    L I    ++  D  V   + N+G+ +  + P    A
Sbjct: 170 VINRVRSHMLHEQDMLDVDEIVRTLSIELLGVVEDDDEVI-RATNTGEPVA-LQPSGKAA 227

Query: 391 NLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
               + +R L+G         + + +++TK+K  F ++
Sbjct: 228 LAYRNIARRLLGENVPLQAFEQEKVSVFTKMKNFFGIR 265


>gi|296282904|ref|ZP_06860902.1| ATPase, ParA family protein [Citromicrobium bathyomarinum JL354]
          Length = 310

 Score = 49.7 bits (117), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 71/145 (48%), Gaps = 10/145 (6%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKD------PINS 217
           I+    +GGVG +T+A + A+  +     ETLL DLD P G A      +       I++
Sbjct: 4   IAVYSMKGGVGKTTMAVDLAWRFSQTGGHETLLYDLD-PQGGAGFLLGHEERKVQKAISA 62

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
              A  P   I+     RL +  A+  S+   P  L+R     +K +  +L+ ++  +P 
Sbjct: 63  FHHARAPRDLIEPTRYDRLSLIGADQ-SLRDLPVQLARI--GAKKRLAQMLNFMKGEYPR 119

Query: 278 VILDVPHVWNSWTQEVLTLSDKVVI 302
           ++LD P + N  +++++  +D +V+
Sbjct: 120 IVLDCPPMINEVSEQIMEAADLIVV 144


>gi|242398732|ref|YP_002994156.1| Soj like protein [Thermococcus sibiricus MM 739]
 gi|242265125|gb|ACS89807.1| Soj like protein [Thermococcus sibiricus MM 739]
          Length = 260

 Score = 49.7 bits (117), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 114/258 (44%), Gaps = 20/258 (7%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLD----LPYGTANINFDKDPINSIS 219
           IS    +GGVG +TI+ N A+++A     +TL+ D D    L +    ++  K   N+I 
Sbjct: 5   ISIANQKGGVGKTTISLNLAYALAKK-GYDTLIIDTDPQFNLTFALIGMDIIKRNDNNIG 63

Query: 220 DAIYPVGRIDKAFVSRLPVFYAENLSIL------TAPAMLSRTYDFDEKMIVPVLDILEQ 273
             +     + K  +    +   ENLS++      +A   L  T    E+ +  VL+ +E 
Sbjct: 64  TLLIE-NAVKKTQIENAIIPIEENLSLIPSHLKVSAIERLLMTAYMREQRLKRVLEKIED 122

Query: 274 IFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYL 333
            +  +I+D P     +    L  SD V+I T L    +   +  +DV+++++  +  P L
Sbjct: 123 EYDFIIIDNPPSLGIFLINSLGASDYVLIPTELGYFSVMGVQLTLDVIREIKSTELNPDL 182

Query: 334 -----VLNQ-VKTPKKPEISISDFCAPLGITP-SAIIPFDGAVFGMSANSGKMIHEVDPK 386
                V N+  +  K P++ +          P  AI+P   AV   S   GK + E DPK
Sbjct: 183 EIMGIVANKFTRQSKVPQVRLDQLKETYPDLPVVAILPRAVAV-EKSQGEGKPVFEFDPK 241

Query: 387 SAIANLLVDFSRVLMGRV 404
           + ++   +  +  ++  V
Sbjct: 242 NKVSKAFLQLAEKVIKNV 259


>gi|218461775|ref|ZP_03501866.1| response regulator receiver protein [Rhizobium etli Kim 5]
          Length = 316

 Score = 49.7 bits (117), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 61/274 (22%), Positives = 124/274 (45%), Gaps = 15/274 (5%)

Query: 74  DSSTPDLIIVQTKVDSREVLSALEPLA-EVCDSGTKVIVIGDTNDVSLYRALISNHVSEY 132
           D +  DLI++   VD  E+L   E  A         ++V+ +     + R L   + +++
Sbjct: 49  DPAQFDLIVLD--VDRGELLQRPELFAFRTSYRDIPLVVVSEDLPDDMLRLLFRLNGNDW 106

Query: 133 LIEPLSVADIINSISAIFTPQEEGKGSSGCSI-SFIGSRGGVGSSTIAHNCAFSIASVFA 191
           L +PL    +I+ IS        G G+S   + + + + GG G+S IA + A  +A    
Sbjct: 107 LKKPLERRALIDMIST----HAPGTGASDSRVHAVVSAVGGAGASMIASSLAHVLAQPTK 162

Query: 192 METLLADL-DLPYGTANINFDKDPINS--ISDAIYPVGRIDKAFVSRLPVFYAENLSILT 248
             T   DL D  +    + +  + +N   +   I    R+D  F+  +   ++   S+L+
Sbjct: 163 NSTPRVDLFDTDFCAGTLGYYLNLVNDYDLKPVIANPSRVDLEFIDLVRKRHSGGFSLLS 222

Query: 249 --APAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSL 306
              P++L        ++++ +LD+        ++D+P+    W  +VLT  + + I T +
Sbjct: 223 FKQPSVLLAPKG--GELVLRMLDVAAFESDHTVIDIPYYDTPWKYDVLTSVNSICIVTEM 280

Query: 307 DLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKT 340
            +  L  +K+L   L +LR +    ++V+N+ + 
Sbjct: 281 TVPALSQAKDLFANLVRLRGSSDQIFIVINKYRA 314


>gi|16800647|ref|NP_470915.1| hypothetical protein lin1579 [Listeria innocua Clip11262]
 gi|16414066|emb|CAC96810.1| minD [Listeria innocua Clip11262]
 gi|313618780|gb|EFR90679.1| septum site-determining protein MinD [Listeria innocua FSL S4-378]
 gi|313623651|gb|EFR93808.1| septum site-determining protein MinD [Listeria innocua FSL J1-023]
          Length = 266

 Score = 49.7 bits (117), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 59/278 (21%), Positives = 128/278 (46%), Gaps = 27/278 (9%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKD 213
           G +I     +GGVG +T   N   ++A       +  M+  L +LD+  G  N I +D  
Sbjct: 2   GEAIVITSGKGGVGKTTSTANLGTALALQGKKVCLIDMDIGLRNLDVVLGLENRIIYD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
               + D +    +I +A +      + + L +L A     +     E+MI  +++ L  
Sbjct: 60  ----LVDVVEGRCKIHQAMIK--DKRFDDLLFLLPAAQTTDKNAVSGEQMI-ELINQLRP 112

Query: 274 IFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYL 333
            +  +++D P    +  +  +  +DK ++ T+ +++ +R++  +I +L+K     +PP L
Sbjct: 113 DYDYILIDCPAGIETGYKNAVAGADKAIVVTTPEISAVRDADRIIGLLEK--EDIEPPKL 170

Query: 334 VLNQVKTP---KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIA 390
           ++N+++T        + I +    L I    II  D  V   S+NSG  +  + P +  +
Sbjct: 171 IINRIRTQMMVNGDVMDIDEITTHLSIELLGIIIDDDEVI-RSSNSGDPVAML-PNNRAS 228

Query: 391 NLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
               + +R ++G     +++   +   +T++K++F  K
Sbjct: 229 QGYRNIARRILGESIPLMSIEAKKPGFFTRLKQLFGGK 266


>gi|289434824|ref|YP_003464696.1| septum site-determining protein MinD [Listeria seeligeri serovar
           1/2b str. SLCC3954]
 gi|289171068|emb|CBH27610.1| septum site-determining protein MinD [Listeria seeligeri serovar
           1/2b str. SLCC3954]
 gi|313633131|gb|EFS00024.1| septum site-determining protein MinD [Listeria seeligeri FSL
           N1-067]
 gi|313637704|gb|EFS03078.1| septum site-determining protein MinD [Listeria seeligeri FSL
           S4-171]
          Length = 266

 Score = 49.7 bits (117), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 60/281 (21%), Positives = 129/281 (45%), Gaps = 33/281 (11%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKD 213
           G +I     +GGVG +T   N   ++A       +  M+  L +LD+  G  N I +D  
Sbjct: 2   GEAIVITSGKGGVGKTTSTANLGTALALQGKKVCLIDMDIGLRNLDVVLGLENRIIYD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
               + D +    +I +A +      + + L +L A     ++    E+MI    D++ Q
Sbjct: 60  ----LVDVVEGRCKIHQAMIK--DKRFDDLLFLLPAAQTTDKSAVSGEQMI----DLINQ 109

Query: 274 IFP---LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP 330
           + P    +++D P    +  +  +  +DK ++ T+ +++ +R++  +I +L+K     +P
Sbjct: 110 LRPDYDYILIDCPAGIETGYKNAVAGADKAIVVTTPEISAVRDADRIIGLLEK--EDIEP 167

Query: 331 PYLVLNQVKTP---KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS 387
           P L++N+++T        + I +    L I    II  D  V   S+NSG  +  + P +
Sbjct: 168 PKLIINRIRTQMMMNGDVMDIDEITTHLSIELLGIIIDDDEVI-RSSNSGDPVAML-PNN 225

Query: 388 AIANLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
             +    + +R ++G     +++   +   + ++K++F  K
Sbjct: 226 RASQGYRNIARRILGESIPLMSIETKKPGFFARLKQLFGGK 266


>gi|218661158|ref|ZP_03517088.1| response regulator receiver protein [Rhizobium etli IE4771]
          Length = 376

 Score = 49.7 bits (117), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 61/274 (22%), Positives = 124/274 (45%), Gaps = 15/274 (5%)

Query: 74  DSSTPDLIIVQTKVDSREVLSALEPLA-EVCDSGTKVIVIGDTNDVSLYRALISNHVSEY 132
           D +  DLI++   VD  E+L   E  A         ++V+ +     + R L   + +++
Sbjct: 49  DPAQFDLIVLD--VDRGELLQRPELFAFRTSYRDIPLVVVSEDLPDDMLRLLFRLNGNDW 106

Query: 133 LIEPLSVADIINSISAIFTPQEEGKGSSGCSI-SFIGSRGGVGSSTIAHNCAFSIASVFA 191
           L +PL    +I+ IS        G G+S   + + + + GG G+S IA + A  +A    
Sbjct: 107 LKKPLERRALIDMIST----HAPGTGASDSRVHAVVSAVGGAGASMIASSLAHVLAQPTK 162

Query: 192 METLLADL-DLPYGTANINFDKDPINS--ISDAIYPVGRIDKAFVSRLPVFYAENLSILT 248
             T   DL D  +    + +  + +N   +   I    R+D  F+  +   ++   S+L+
Sbjct: 163 NSTPRVDLFDTDFCAGTLGYYLNLVNDYDLKPVIANPSRVDLEFIDLVRKRHSGGFSLLS 222

Query: 249 --APAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSL 306
              P++L        ++++ +LD+        ++D+P+    W  +VLT  + + I T +
Sbjct: 223 FKQPSVLLAPKG--GELVLRMLDVAAFESDHTVIDIPYYDTPWKYDVLTSVNSICIVTEM 280

Query: 307 DLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKT 340
            +  L  +K+L   L +LR +    ++V+N+ + 
Sbjct: 281 TVPALSQAKDLFANLVRLRGSSDQIFIVINKYRA 314


>gi|295395661|ref|ZP_06805853.1| possible septum site-determining protein [Brevibacterium
           mcbrellneri ATCC 49030]
 gi|294971477|gb|EFG47360.1| possible septum site-determining protein [Brevibacterium
           mcbrellneri ATCC 49030]
          Length = 517

 Score = 49.7 bits (117), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 87/206 (42%), Gaps = 8/206 (3%)

Query: 147 SAIFTPQEEGKGSS--GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETL-LADLDLPY 203
           + +F    EG   S  G  I+  GS+GGVG STIA + A   A     + + L D DL  
Sbjct: 128 TVVFDRTAEGSSPSKAGRMITLSGSKGGVGVSTIATHLAREAAKADPSKAIVLVDFDLLK 187

Query: 204 GTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKM 263
              +I  +     +++D +  V  + +  +  +     +  S+   P     +    E +
Sbjct: 188 ADLSIVLNVPQSRTVTDILGVVEELSRQQIQDVLYTSPDGFSVFFGPKNGEESELVTELV 247

Query: 264 IVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKK 323
              +   L   F LVI+D     N      + ++D   I  + D+  LR S  L  + K+
Sbjct: 248 TRKIFGQLRSHFDLVIVDAGCHLNEANSAAIEMADDAYIVATSDVLSLRGSHRLAQLWKR 307

Query: 324 L--RPADKPPYLVLNQV--KTPKKPE 345
           L  RP D    ++LN+V  K   +PE
Sbjct: 308 LGIRPTDSSK-VILNKVNKKQDLQPE 332


>gi|291278831|ref|YP_003495666.1| flagellar biosynthesis protein FlhG [Deferribacter desulfuricans
           SSM1]
 gi|290753533|dbj|BAI79910.1| flagellar biosynthesis protein FlhG [Deferribacter desulfuricans
           SSM1]
          Length = 279

 Score = 49.7 bits (117), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 86/189 (45%), Gaps = 8/189 (4%)

Query: 157 KGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPIN 216
           K      IS    +GGVG +  + N A+ + S F  + LL D DL     +I  +  P+ 
Sbjct: 15  KDRKAKYISIASGKGGVGKTNFSVNLAYML-SKFGKKVLLFDADLGLANVDIILNIAPLR 73

Query: 217 SISDAIYPVGRIDKAFVSRLPVF--YAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI 274
           +I D +    ++D   +  +  F  +  +   +   ++ S   DFD+  IV +   L++I
Sbjct: 74  TIKDYLNGDAKVDDVVIPNVKGFDVFPASSGFMELSSLSSD--DFDK--IVDMFLSLDKI 129

Query: 275 FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLV 334
           +  +I D            +T SD  V+ T  +   + ++  LI V+  ++  D  PY+V
Sbjct: 130 YDYIIFDTAAGIAENVLRFITFSDIFVVITLAEPTAITDAYALIKVV-NMKIGDLNPYVV 188

Query: 335 LNQVKTPKK 343
           +N V + K+
Sbjct: 189 VNMVNSEKQ 197


>gi|260434670|ref|ZP_05788640.1| septum site-determining protein MinD [Synechococcus sp. WH 8109]
 gi|260412544|gb|EEX05840.1| septum site-determining protein MinD [Synechococcus sp. WH 8109]
          Length = 270

 Score = 49.7 bits (117), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/281 (23%), Positives = 124/281 (44%), Gaps = 25/281 (8%)

Query: 159 SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLL-ADLDLPYGTANINFDKDPINS 217
           S+  +I     +GGVG +T   N   ++A   A   +L AD  L      +  +   + +
Sbjct: 2   STTRTILICSGKGGVGKTTTTANLGIALARQGAKTVVLDADFGLRNLDLLLGLENRIVYT 61

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTA--PAMLSRTYDFDEKMIVPVLDILEQIF 275
             + +    R+++A V         NL++L A  P ML      D + IV    +LE+ F
Sbjct: 62  AQEVLAETCRLEQALVKH---KQEPNLALLPAGNPRMLEWLKPKDMQAIVA---LLERQF 115

Query: 276 PLVILDVP-HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLV 334
             V++D P  + + +        + VVITT  ++A +R++  +I +L       +P  LV
Sbjct: 116 DYVLIDCPAGIEDGFKNAAAAAREAVVITTP-EVAAVRDADRVIGLLNT--QGVQPVQLV 172

Query: 335 LNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFG-----MSANSGKMIHEVDPKSAI 389
           LN+V+ PK   +S  +  +   +T    +P  G VF      +S N G+ +   D  S  
Sbjct: 173 LNRVR-PKM--MSNQEMLSVDDVTDILALPLLGLVFEDEQVIVSTNRGEPLTLSDSSSPA 229

Query: 390 ANLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMKCF 426
           A    + ++ L G     +  S+ +  +  +++K+   + F
Sbjct: 230 AQAYGNIAQRLQGEDIPLMDPSQARRGLRARMRKLMQTRIF 270


>gi|254506135|ref|ZP_05118279.1| ATPase involved in chromosome partitioning [Vibrio parahaemolyticus
           16]
 gi|219550953|gb|EED27934.1| ATPase involved in chromosome partitioning [Vibrio parahaemolyticus
           16]
          Length = 411

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 83/357 (23%), Positives = 152/357 (42%), Gaps = 42/357 (11%)

Query: 67  EAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALIS 126
           E +  ++ SS  +++IV+   +S  V   +  ++ +  +   VIV+G  + +S  R L  
Sbjct: 56  EVIKKYARSSALEIVIVELN-ESNNVTEDMRRISHLLPNSASVIVVGSEDAISTIRNLKE 114

Query: 127 NHVSEYLIEPLSVADIINSISAIFTPQEE----GKGSSGCSISFIGSRGGVGSSTIAHNC 182
                YL  P+S  ++I+ +  +   ++     GK      ++F G+ GGVG+S +    
Sbjct: 115 MGFY-YLFWPVSKQELIDFVKNVSDNRQRNAGLGKAREAKKVAFWGASGGVGNSLLVAEI 173

Query: 183 AFSIASVFAMETLLADLDLPYGTANI-----NFDKDPINSISDAIYPVGRIDKAFVSRLP 237
           A  ++S      ++ D D   G  +I      F+K  I        P G    A  S L 
Sbjct: 174 ACELSSKKNSSCVVVDHDFVGGNLDILLGLKKFEKKDI--------PPG----ALTSNLD 221

Query: 238 VFYAENLSILTAPAMLS----RTYDFDE---KMIVPVL-DILEQIFPLVILDVPHVWNSW 289
             YA N++    P MLS    ++ D +E   K  V  L D L +    +I D+    N  
Sbjct: 222 TSYALNMTQKITP-MLSILSVQSKDLNEFQMKEYVRTLSDELSEQTNFLIEDLSCSVN-- 278

Query: 290 TQEVLTLS----DKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPE 345
            ++ L  S    D +V+     ++ LR++  ++  LK+L    +   +V+N     K   
Sbjct: 279 CKQDLEYSAKECDAIVLVLKPTVSCLRDASRIVSQLKELETKAR-IIVVINHTSPEKHAT 337

Query: 346 ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMG 402
           ++  +    L        P+DG +   +   GK +HE+  K  I+  +   +  L+G
Sbjct: 338 VTEEEIEKYLRRPIDVTCPYDGQM-SKALLEGKHLHEL--KLPISKSIKQITAALLG 391


>gi|134295596|ref|YP_001119331.1| response regulator receiver protein [Burkholderia vietnamiensis G4]
 gi|134138753|gb|ABO54496.1| response regulator receiver protein [Burkholderia vietnamiensis G4]
          Length = 424

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/246 (21%), Positives = 101/246 (41%), Gaps = 25/246 (10%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSI---------------ASVFAMETLLADLDLPYGT 205
           G  ++ +G+R G+G ST+A N A  +               ++    +T L DL LP G 
Sbjct: 141 GKVVALLGARAGMGVSTLAANLAVWLQKHALGPGAKDQHGGSTPAGRQTALVDLGLPAGD 200

Query: 206 ANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIV 265
             +  +        DA+  + RID+ FV+     +   +++ T P  L    D      V
Sbjct: 201 GALFLNTRCEFHFIDAVQNLRRIDRTFVNTALTRHQSGVALTTLPPDLGGLRDVSYAACV 260

Query: 266 PVLDILEQIFPLVILDVPHVWNS-WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL 324
            +L+     F   ++D+    N  +  ++   +D+  +     +A + ++ +L+  L+  
Sbjct: 261 GLLNRFRAFFDQQVVDLGGFSNRDFVTQIAASADEAWLVCDQGVASIVSAADLLTGLRDA 320

Query: 325 RPADKPPYLVLNQVKTPKKPEISI--SDFCAPLGITPSAIIPFDGAVFGMSANSGKMI-- 380
                   LV+NQ      P + +  +     LG++    +P      G +AN G++I  
Sbjct: 321 GIDTDRVKLVVNQY----DPALDLMPAQIAERLGLSLVGTLPARRVAIGHAANQGRLIVD 376

Query: 381 -HEVDP 385
             E DP
Sbjct: 377 AAERDP 382


>gi|254281613|ref|ZP_04956581.1| cobyrinic Acid a,c-diamide synthase [gamma proteobacterium NOR51-B]
 gi|219677816|gb|EED34165.1| cobyrinic Acid a,c-diamide synthase [gamma proteobacterium NOR51-B]
          Length = 261

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 88/199 (44%), Gaps = 21/199 (10%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           ++    +GGVG +T + N A S+A+    + LL DLD P G A ++   D  + I  + Y
Sbjct: 4   LAVANQKGGVGKTTTSVNLAASLAA-MGRDILLVDLD-PQGNATMSAGIDK-HDIERSSY 60

Query: 224 PVGRIDKAFVSRLP----VFYAENLSI--------LTAPAMLSRTYDFDEKMIVPVLDIL 271
            +       V R+P    V +A+   I        LTA  +   T +  E+ +   L   
Sbjct: 61  DL------LVDRVPLNKVVVHADTSGIDVVPANSDLTAAEVQLITVEGKERRLREALATC 114

Query: 272 EQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPP 331
            + + +VI+D P   N  T   L  +D V+IT   +   L     L+D + ++  +  P 
Sbjct: 115 SKPYDIVIIDCPPSLNMLTLNALVAADSVLITMQCEYFALEGLSALLDTVHQVSESVNPR 174

Query: 332 YLVLNQVKTPKKPEISISD 350
             V   V+T   P  S+++
Sbjct: 175 LRVEGLVRTMYDPRNSLTN 193


>gi|33239815|ref|NP_874757.1| putative septum site-determining protein MinD [Prochlorococcus
           marinus subsp. marinus str. CCMP1375]
 gi|33237341|gb|AAP99409.1| Septum formation inhibitor-activating ATPase [Prochlorococcus
           marinus subsp. marinus str. CCMP1375]
          Length = 271

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 118/269 (43%), Gaps = 21/269 (7%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLL-ADLDLPYGTANINFDKDPINSISDAIYPVGR 227
            +GGVG +T+  N   S+A   +   +L AD  L      +  +   + +  + +    R
Sbjct: 13  GKGGVGKTTLTANLGISLARKGSPTAVLDADFGLRNLDLLLGLENRIVYTAQEVLEETCR 72

Query: 228 IDKAFVSRLPVFYAENLSILTA--PAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHV 285
           +D+A V         NLS+L A  P ML      D K IV   D+L + F  V++D P  
Sbjct: 73  LDQALVKH---KQEPNLSLLPAGNPRMLDWLKPEDMKKIV---DMLTKQFEYVLIDCPAG 126

Query: 286 WNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPE 345
                +  +  S + +I T+ +++ +R++  +I +L       KP  LVLN+V+ PK  E
Sbjct: 127 VEDGFRNAVAASKEAIIVTNPEVSAVRDADRVIGLLNT--HGIKPVQLVLNRVR-PKMME 183

Query: 346 ----ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLM 401
               +SI D    L +    ++  D  V  +S N G+ +     +S  A    + +  L 
Sbjct: 184 SQEMLSIEDVTDILALPLLGLVLEDEQVI-VSTNRGEPLTLSGSQSPAARCYSNIAGRLR 242

Query: 402 GR----VTVSKPQSAMYTKIKKIFNMKCF 426
           G     +  S+  S +  K +++   K F
Sbjct: 243 GEEIPLIDPSQEGSGIADKFRRLMQTKIF 271


>gi|238790282|ref|ZP_04634056.1| Flp pilus assembly protein, ATPase CpaE [Yersinia frederiksenii
           ATCC 33641]
 gi|238721632|gb|EEQ13298.1| Flp pilus assembly protein, ATPase CpaE [Yersinia frederiksenii
           ATCC 33641]
          Length = 346

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/267 (25%), Positives = 112/267 (41%), Gaps = 49/267 (18%)

Query: 110 IVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGS 169
           +V+GD++ + L +  +   V +YL  P  + DI+  + +  T  E     S   IS +G 
Sbjct: 66  LVVGDSDSIVLSQQFVQAGV-DYLHYPSQLTDIVARVKS--TRLELSNKRSAIKISVLGC 122

Query: 170 RGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPI--NSISDAIYPV-- 225
           +GG+G+STI+++ A  IA    +  LL  +    G+ +I+   D I  N +++    +  
Sbjct: 123 KGGIGTSTISYHLAQRIAVNNRVPVLL--VQGHGGSQDIDIISDHILDNDVTEVTDYLSI 180

Query: 226 ----GRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILD 281
               G I   F    P+    N SI   P      ++ D++ I                 
Sbjct: 181 KKNGGEITSNFYD--PLLERYNFSIFDYPV-----FNLDKEKI----------------- 216

Query: 282 VPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPAD---KPPYLVLNQV 338
                    + +L  SD V+   S DLA LR +K   +V + L+      K  +  LNQ+
Sbjct: 217 ---------EHILNFSDCVIFIISHDLASLRVAKLSQEVNRFLQTVGNGVKREFTCLNQI 267

Query: 339 KTPKKPEISISDFCAPLGITPSAIIPF 365
           K      +S+ D  A L    SA I +
Sbjct: 268 KPAGGAILSLGDLTALLNNEISAQIIY 294


>gi|331701266|ref|YP_004398225.1| septum site-determining protein MinD [Lactobacillus buchneri NRRL
           B-30929]
 gi|329128609|gb|AEB73162.1| septum site-determining protein MinD [Lactobacillus buchneri NRRL
           B-30929]
          Length = 268

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/223 (21%), Positives = 102/223 (45%), Gaps = 14/223 (6%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN----FDKDPIN 216
           G +      +GGVG +T + N   ++A +   + +L DLD+  G  N++     D   + 
Sbjct: 2   GKAYVITSGKGGVGKTTSSANIGTALA-MLGKKVVLLDLDI--GLRNLDVVLGLDNRIMY 58

Query: 217 SISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFP 276
            I D      ++ +A V      + + L +L A     +T   +E  +  ++D L+  F 
Sbjct: 59  DIVDVAAGRAKLSQALVK--DKRFDDLLYLLPAAQNTDKTA-LNEDQVREIVDELKPDFD 115

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            +++D P          +  +D  +I T+ +++ +R++  ++ +L++  P  + P+L++N
Sbjct: 116 FILIDCPAGIEQGFMNAIAGADSAIIVTTPEISAVRDADRVVGLLEQ-HPLQEQPHLIIN 174

Query: 337 QVKTPKKPEISISD---FCAPLGITPSAIIPFDGAVFGMSANS 376
           +++     + S+ D       LG+    I+  D AV   S N 
Sbjct: 175 RIRQHMMKDGSVMDVDEITHHLGVELLGIVFDDDAVITTSNNG 217


>gi|255658706|ref|ZP_05404115.1| putative response regulator receiver domain protein [Mitsuokella
           multacida DSM 20544]
 gi|260849093|gb|EEX69100.1| putative response regulator receiver domain protein [Mitsuokella
           multacida DSM 20544]
          Length = 376

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/300 (20%), Positives = 132/300 (44%), Gaps = 23/300 (7%)

Query: 124 LISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCA 183
           LI       LI+P +  ++  ++    T   EG      ++ F   +G  G +T+  N A
Sbjct: 91  LIGAGARGCLIKPFTGVELQEAVREFVT---EGSEKDCETLVFFSPKGKSGKTTLIANLA 147

Query: 184 FSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAEN 243
            ++A     +  + D DL +G   + F+  P ++I +A   V  +    + R  V  +E 
Sbjct: 148 EALARRSHEQVGIIDADLQFGDMAVFFNLAPKSTIVEAARDVRFLSPVTLKRYYVPVSER 207

Query: 244 LSILTAPAMLSRTYDFDEKMIVPVLD----ILEQIFPLVILDVPHVWNSWTQEVLTLSDK 299
           + +L      +   ++ +K+ +P L+    + + +F  +++DVP  +N  +      S  
Sbjct: 208 VHVLCG----TTKPNYIDKVSIPQLENIIRMSKSLFRYLLIDVPPGFNPTSIAAAENSSV 263

Query: 300 VVITTSLDLA-GLRNSKNLIDVLKKLRPADKPPYLVLNQVK---TPKKPEISISDFCAPL 355
             +   ++ A  + + +  + + +    AD+   ++  +V      K+ E+        L
Sbjct: 264 TYLCAMINGAFEMDHMRRALAIFQDWDDADERARVIFTRVSPCTEQKRRELENE-----L 318

Query: 356 GITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYT 415
           G   +AIIP +  V   +A++G+M  E+ P + +A  +   +  ++G      PQ+A ++
Sbjct: 319 GHPVAAIIPNEYLVVSQAADNGQMATELQPDNPLAKSVDRLAEQIIGS---RAPQAARWS 375


>gi|83747916|ref|ZP_00944948.1| PUTATIVE PILUS ASSEMBLY PROTEIN: CpaE2 [Ralstonia solanacearum
           UW551]
 gi|207739457|ref|YP_002257850.1| pilus assembly protein [Ralstonia solanacearum IPO1609]
 gi|83725449|gb|EAP72595.1| PUTATIVE PILUS ASSEMBLY PROTEIN: CpaE2 [Ralstonia solanacearum
           UW551]
 gi|206592833|emb|CAQ59739.1| probable pilus assembly protein [Ralstonia solanacearum IPO1609]
          Length = 439

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/272 (20%), Positives = 108/272 (39%), Gaps = 9/272 (3%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISD 220
           G  ++ +G+R GVG++T+A N A  +      + +L DL  P     +  +        +
Sbjct: 154 GRVLAILGARPGVGTTTLAANLATLVRRTAGSDVMLLDLGQPLRDGALYLNVPANFHFVE 213

Query: 221 AIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVIL 280
           A+  + R D+ FV      +   L +L  P  L+   D      + +L+ L   F L ++
Sbjct: 214 AVRNLRRFDQVFVQTALSRHPNGLVVLPLPVSLAEMRDISFSEALGLLNRLRTFFDLQVV 273

Query: 281 DVPHVWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVK 339
           D+    N  +  +++  +D V++ T   +  + ++  L+  LKK R  D+   L L   K
Sbjct: 274 DLGGFNNIDFIAQLVKAADDVMLVTEQSVGAIVSAAELVQELKK-REIDR-DQLHLTISK 331

Query: 340 TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRV 399
              +  +        L I     +P       +++N G  + E  P       +   ++ 
Sbjct: 332 FDARLSLDAEQIAERLEIPSVMTVPSRRQALVVASNQGATLAETRPIDPYVRAIAGIAQA 391

Query: 400 LMGRVTVSKP------QSAMYTKIKKIFNMKC 425
           L       +P       + M T++ + F  K 
Sbjct: 392 LGYTQPGERPPGMAGWMAGMRTRLGERFRRKS 423


>gi|89100213|ref|ZP_01173080.1| Flp pilus assembly protein ATPase CpaE-like [Bacillus sp. NRRL
           B-14911]
 gi|89085063|gb|EAR64197.1| Flp pilus assembly protein ATPase CpaE-like [Bacillus sp. NRRL
           B-14911]
          Length = 386

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 73/349 (20%), Positives = 146/349 (41%), Gaps = 40/349 (11%)

Query: 74  DSSTPDLIIV-----QTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNH 128
           D   PDL+ +     +  VD+ + + A  P+         ++ I  + D  L R +    
Sbjct: 43  DRLAPDLVFLIESEGEATVDTIDYIHAASPML-------PIVFIAFSQDFDLLRNVTRAG 95

Query: 129 VSEYLIEPLSVADIINSISAIF--------------TPQEEGKGSSGCSISFIGSRGGVG 174
           V +Y I P     +   + +I               +  +  K   G   SF   +GG G
Sbjct: 96  VVDYFILPDENTMLYGRLDSIIQMAVQRKQQLSETASTSQSFKRGRGRIFSFYSGKGGSG 155

Query: 175 SSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVS 234
            + I+ + A ++      + +L DL+L +G        +   S++D +  +  ++++ + 
Sbjct: 156 RTIISSSFAQTLKLESTAQVILIDLNLQFGGVETYLSIESNRSLADLLPVIEELNESHIR 215

Query: 235 RL--PVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQE 292
            +     Y++ L IL +P       +  E  +  +L    + +  V++D+P V N  T  
Sbjct: 216 NVSEKERYSK-LEILLSPRDAEVAENLPEGFVSRLLRTCRRSYDFVLVDLPTVMNEHTYS 274

Query: 293 VLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR-PADKPPYLVLNQVKTPKKPEISISDF 351
            L  SDK+  T +LD   +   K +  +  +L    +    L+LN+V   ++ EI  +D 
Sbjct: 275 ALEESDKIYYTLNLDTPSISMLKQVEGLFLRLGIETEGRMELLLNEV--GRENEIKPADL 332

Query: 352 CAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDP--KSAIANLLVDFSR 398
              +    +  IP D  + G+ A+    I++ +P  K A+   L+ F++
Sbjct: 333 KNIIQYPIAFKIPRD--IKGVQAH----INKSEPFRKEAVEKKLIPFTK 375


>gi|221633898|ref|YP_002523124.1| septum site-determining protein MinD [Thermomicrobium roseum DSM
           5159]
 gi|221155374|gb|ACM04501.1| septum site-determining protein MinD [Thermomicrobium roseum DSM
           5159]
          Length = 274

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/256 (21%), Positives = 113/256 (44%), Gaps = 18/256 (7%)

Query: 154 EEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI--NFD 211
           EE +  +G  I+    +GGVG +T   N   ++A+      +L D D+     +I    +
Sbjct: 2   EEQQDRNGRVITITSGKGGVGKTTTTANVGAALAA-RGKAVVLVDADIGLRNLDIVLGLE 60

Query: 212 KDPINSISDAIYPVGRIDKAFV--SRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLD 269
              +  I D +    R+ +A +   RL      NL+++ A     +     E+M   +  
Sbjct: 61  NRIVYDIVDVVEGRCRLRQALIRDKRL-----TNLALIPAAQTRDKEAVSPEQMRA-LCQ 114

Query: 270 ILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADK 329
            L Q F  V++D P       +  +  +D+V++ T+ +++ +R++  ++ +++       
Sbjct: 115 ELRQQFDFVLIDSPAGIERGFRNAIAGADEVLVVTNPEVSAVRDADRIVGLVEAAEL--P 172

Query: 330 PPYLVLNQVK---TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPK 386
           PP L++N++      +   +S+ D    L I    ++P D  +   + N G+ +  +DP 
Sbjct: 173 PPRLIVNRIDPELVRRGDMLSVEDVLEILAIPLIGVVPADETIV-TATNRGEPVA-LDPH 230

Query: 387 SAIANLLVDFSRVLMG 402
           S       D +  L+G
Sbjct: 231 SRAGQAFRDIAARLLG 246


>gi|116872973|ref|YP_849754.1| septum site-determining protein MinD [Listeria welshimeri serovar
           6b str. SLCC5334]
 gi|116741851|emb|CAK20975.1| septum site-determining protein MinD [Listeria welshimeri serovar
           6b str. SLCC5334]
          Length = 266

 Score = 48.9 bits (115), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/281 (20%), Positives = 128/281 (45%), Gaps = 33/281 (11%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKD 213
           G +I     +GGVG +T   N   ++A       +  M+  L +LD+  G  N I +D  
Sbjct: 2   GEAIVITSGKGGVGKTTSTANLGTALALQGKKVCLIDMDIGLRNLDVVLGLENRIIYD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
               + D +    +I +A +      + + L +L A     +     E+M+    D++ Q
Sbjct: 60  ----LVDVVEGRCKIHQAMIK--DKRFDDLLFLLPAAQTTDKNAVSAEQMV----DLINQ 109

Query: 274 IFP---LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP 330
           + P    +++D P    +  +  +  +DK ++ T+ +++ +R++  +I +L+K     +P
Sbjct: 110 LRPDYDYILIDCPAGIETGYKNAVAGADKAIVVTTPEISAVRDADRIIGLLEK--EDIEP 167

Query: 331 PYLVLNQVKTP---KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS 387
           P L++N+++T        + I +    L I    II  D  V   S+NSG  +  + P +
Sbjct: 168 PKLIINRIRTQMMVNGDVMDIDEITTHLSIELLGIIIDDDEVI-RSSNSGDPVAMI-PNN 225

Query: 388 AIANLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
             +    + +R ++G     +++   +   + ++K++F  K
Sbjct: 226 RASQGYRNIARRILGESIPLMSIEAKKPGFFARLKQLFGGK 266


>gi|116623312|ref|YP_825468.1| Flp pilus assembly protein ATPase CpaE-like protein [Candidatus
           Solibacter usitatus Ellin6076]
 gi|116226474|gb|ABJ85183.1| Flp pilus assembly protein ATPase CpaE-like protein [Candidatus
           Solibacter usitatus Ellin6076]
          Length = 399

 Score = 48.9 bits (115), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 71/315 (22%), Positives = 129/315 (40%), Gaps = 31/315 (9%)

Query: 71  CFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVS 130
           CF D++T D  + QT      ++S L P       G  V+ +  +ND  L    +     
Sbjct: 64  CFLDAAT-DCELAQT------LISELAP-------GLPVVALHPSNDADLILRCLRRGAC 109

Query: 131 EYLIEPLSVADIINSISAIF-----TPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFS 185
           E++ +P S     +++  +F     T  +    ++G     +  + G G+ST+A + A  
Sbjct: 110 EFVADPTS-----DTLRCVFERLARTRSDAAHPAAGSVYCVVPGKPGCGASTLAAHLAIQ 164

Query: 186 IASVFAMETLLADLDLPYGTANINF--DKDPINSISDAIYPVGRIDKAFVSRLPVFYAEN 243
           +        LL D D  + TA+I F     P   + D +    R+D    +RL V  A  
Sbjct: 165 LRGSGVEPVLLVDGD--HLTASITFLLKLKPEFHLEDVLRDWSRMDDDLWARLTV-PAFG 221

Query: 244 LSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVIT 303
           + +L AP   +       +    + +   + +  V+LD+P +  +       L+D V++ 
Sbjct: 222 VDVLAAPEDPTTRTPVSRQAAGELCNFWRERYAAVVLDLPDMRAAADCGFAALADIVLLV 281

Query: 304 TSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAII 363
           T+ +LA L+ +   +  L           L+LN+  TP    +   D    L + P AI+
Sbjct: 282 TTNELAALQATGRALRYLDSAAGDRSRLRLILNRY-TPAT-GLKREDVKTALSLEPFAIL 339

Query: 364 PFDGAVFGMSANSGK 378
             D  V   +   G+
Sbjct: 340 CNDYEVIQTALLDGR 354


>gi|254487507|ref|ZP_05100712.1| response regulator receiver protein [Roseobacter sp. GAI101]
 gi|214044376|gb|EEB85014.1| response regulator receiver protein [Roseobacter sp. GAI101]
          Length = 412

 Score = 48.9 bits (115), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 82/349 (23%), Positives = 148/349 (42%), Gaps = 29/349 (8%)

Query: 66  AEAVSCFS--DSSTPDLIIVQTKVDSREVLSAL-EPLAEVCDSGTKVIVIG-DTNDVSLY 121
           +EA++ F   ++ + +LI +   V+  E L  + E + +      KVI+I  D + VSL+
Sbjct: 46  SEALAFFGQPEAQSLELIALALDVEDEEDLVLMGEIIVQAKARDIKVILIAEDVSPVSLH 105

Query: 122 RALISNHVSEYLIEPLSVADIINSI------------SAIFTPQ-EEGKGSSGCSISFIG 168
            +L+     E++  PL   ++  +I            SA   P  + G    G  I   G
Sbjct: 106 -SLLRQGADEFVPYPLPEGELAAAIERVRAEPDPVGQSATKAPTLKPGADKDGALIVVHG 164

Query: 169 SRGGVGSSTIAHNCAFSIASVFAM---ETLLADLDLPYGTANINFDKDPINSISDAIYPV 225
             GG G +T+A N A+ +A+       +  L DLDL +G      D      + D +   
Sbjct: 165 LAGGTGGTTMAVNLAWELANADKKNPPKVCLLDLDLQFGAVATFLDLPRREVVYDMLSET 224

Query: 226 GRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHV 285
             +D+    +  + Y + L +LTAPA +        + +  +LD+    F  V++D+P  
Sbjct: 225 ENMDEESFGQALLTYEDRLQVLTAPAEMLPLDLITSEDVNRILDLARNQFDYVVVDMPST 284

Query: 286 WNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR-PADKPPYLVLNQVKTPKKP 344
              W++ VL  +        LD+   +N+      L+    P +K  Y V+N  + PK  
Sbjct: 285 LVQWSEAVLNNAHIYFAMLELDMRCAQNALRFKRALQSEELPVEKLRY-VMN--RAPKFT 341

Query: 345 EIS----ISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAI 389
           ++S    +      LGI+    +P  G     + + G  +    PK+ +
Sbjct: 342 DLSAKSRVKRMAESLGISIDVHLPDGGKQITQANDHGMPLANSAPKNPL 390


>gi|149911404|ref|ZP_01900022.1| hypothetical protein PE36_11177 [Moritella sp. PE36]
 gi|149805512|gb|EDM65517.1| hypothetical protein PE36_11177 [Moritella sp. PE36]
          Length = 345

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/294 (22%), Positives = 127/294 (43%), Gaps = 23/294 (7%)

Query: 95  ALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINS-ISAIFTPQ 153
            +  + E+       I++GD    ++   LI   V   + + +SV DI    I+++ T  
Sbjct: 22  TINDIKEIAKHNINFILVGD----NIRNELIRTAVQFKVKDIISVEDIEKELINSLLTSA 77

Query: 154 EEGKGSSGCS--ISFIGSRGGVGSSTIAHNCAFSI-ASVFAMETLLADLDLPYGTANINF 210
            E   +S  +   + I  + G G+S I  +C   I A++   E  + D DL YG+    F
Sbjct: 78  NELMQASKIAPLYTIINGKPGSGASFIT-SCLGEISANLSNQEIAIIDADLNYGSLADTF 136

Query: 211 DKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDI 270
           + D    ++DA+  + ++D   +  + +   +NLS+L +        +        +L  
Sbjct: 137 NFDANYYLTDALNELDKLDNTAIKSM-MLKRDNLSLLASKPYTQLNTN------PQILRC 189

Query: 271 LEQI-------FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKK 323
           L+Q+         LV++D+      +T  +L LS K++I    ++  LR +K +I  L +
Sbjct: 190 LDQLVWKVKLNHDLVLVDLSRGIEHFTIPLLNLSSKILIVIQQNILSLREAKVMIQQLTQ 249

Query: 324 LRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
               D     V+    + K   IS++D    LGI    ++  +  +     +SG
Sbjct: 250 HLGIDVHKLHVIVNRYSAKNSNISLTDIKKVLGIDSLYVVSNNYQLANAGIDSG 303


>gi|30022523|ref|NP_834154.1| cell division inhibitor MinD [Bacillus cereus ATCC 14579]
 gi|75763220|ref|ZP_00742981.1| Cell division inhibitor MinD [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|206969671|ref|ZP_03230625.1| septum site-determining protein MinD [Bacillus cereus AH1134]
 gi|218236122|ref|YP_002369256.1| septum site-determining protein MinD [Bacillus cereus B4264]
 gi|218899617|ref|YP_002448028.1| septum site-determining protein MinD [Bacillus cereus G9842]
 gi|228902978|ref|ZP_04067118.1| Septum site-determining protein minD [Bacillus thuringiensis IBL
           4222]
 gi|228910284|ref|ZP_04074101.1| Septum site-determining protein minD [Bacillus thuringiensis IBL
           200]
 gi|228923202|ref|ZP_04086492.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228941616|ref|ZP_04104163.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228954732|ref|ZP_04116754.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228960725|ref|ZP_04122364.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228967530|ref|ZP_04128557.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228974545|ref|ZP_04135111.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228981140|ref|ZP_04141440.1| Septum site-determining protein minD [Bacillus thuringiensis Bt407]
 gi|229048161|ref|ZP_04193730.1| Septum site-determining protein minD [Bacillus cereus AH676]
 gi|229071958|ref|ZP_04205168.1| Septum site-determining protein minD [Bacillus cereus F65185]
 gi|229081714|ref|ZP_04214207.1| Septum site-determining protein minD [Bacillus cereus Rock4-2]
 gi|229111920|ref|ZP_04241464.1| Septum site-determining protein minD [Bacillus cereus Rock1-15]
 gi|229129727|ref|ZP_04258695.1| Septum site-determining protein minD [Bacillus cereus BDRD-Cer4]
 gi|229147019|ref|ZP_04275379.1| Septum site-determining protein minD [Bacillus cereus BDRD-ST24]
 gi|229152651|ref|ZP_04280839.1| Septum site-determining protein minD [Bacillus cereus m1550]
 gi|229180725|ref|ZP_04308063.1| Septum site-determining protein minD [Bacillus cereus 172560W]
 gi|229192660|ref|ZP_04319619.1| Septum site-determining protein minD [Bacillus cereus ATCC 10876]
 gi|29898081|gb|AAP11355.1| Cell division inhibitor MinD [Bacillus cereus ATCC 14579]
 gi|74489294|gb|EAO52749.1| Cell division inhibitor MinD [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|206735359|gb|EDZ52527.1| septum site-determining protein MinD [Bacillus cereus AH1134]
 gi|218164079|gb|ACK64071.1| septum site-determining protein MinD [Bacillus cereus B4264]
 gi|218545278|gb|ACK97672.1| septum site-determining protein MinD [Bacillus cereus G9842]
 gi|228590750|gb|EEK48610.1| Septum site-determining protein minD [Bacillus cereus ATCC 10876]
 gi|228602703|gb|EEK60186.1| Septum site-determining protein minD [Bacillus cereus 172560W]
 gi|228630797|gb|EEK87438.1| Septum site-determining protein minD [Bacillus cereus m1550]
 gi|228636407|gb|EEK92877.1| Septum site-determining protein minD [Bacillus cereus BDRD-ST24]
 gi|228653844|gb|EEL09714.1| Septum site-determining protein minD [Bacillus cereus BDRD-Cer4]
 gi|228671484|gb|EEL26784.1| Septum site-determining protein minD [Bacillus cereus Rock1-15]
 gi|228701559|gb|EEL54052.1| Septum site-determining protein minD [Bacillus cereus Rock4-2]
 gi|228711117|gb|EEL63082.1| Septum site-determining protein minD [Bacillus cereus F65185]
 gi|228723148|gb|EEL74524.1| Septum site-determining protein minD [Bacillus cereus AH676]
 gi|228778340|gb|EEM26607.1| Septum site-determining protein minD [Bacillus thuringiensis Bt407]
 gi|228784948|gb|EEM32961.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228792185|gb|EEM39760.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228798941|gb|EEM45916.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228804930|gb|EEM51527.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228817828|gb|EEM63906.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228836408|gb|EEM81759.1| Septum site-determining protein minD [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228849344|gb|EEM94181.1| Septum site-determining protein minD [Bacillus thuringiensis IBL
           200]
 gi|228856654|gb|EEN01174.1| Septum site-determining protein minD [Bacillus thuringiensis IBL
           4222]
 gi|326942228|gb|AEA18124.1| cell division inhibitor MinD [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 265

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/278 (20%), Positives = 126/278 (45%), Gaps = 28/278 (10%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKD 213
           G +I     +GGVG +T + N   ++A       +   +  L +LD+  G  N I FD  
Sbjct: 2   GEAIVITSGKGGVGKTTTSANIGTALALSGKKVCLIDTDIGLRNLDVVMGLENRIVFD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
               + D +    R+ +A +        ++L +L A     ++    E+M   ++ +L Q
Sbjct: 60  ----LVDVVEGRCRLPQALIKDKRF---DDLYLLPAAQTSDKSAVTPEQMD-ELIQVLRQ 111

Query: 274 IFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYL 333
            +  +++D P       +  +  +DK ++ T+ +++ +R++  +I +L+K     +PP L
Sbjct: 112 DYDYILIDCPAGIEQGFKNAVAGADKAIVVTTPEVSSMRDADRIIGLLEK--EDIEPPKL 169

Query: 334 VLNQVKTPKKPE---ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIA 390
           V+N+V++    E   + + +    L I    ++  D  V   + N+G+ +  + P    A
Sbjct: 170 VINRVRSHMLHEQDMLDVDEIVRTLSIELLGVVEDDDEVI-RATNTGEPVA-LQPSGKAA 227

Query: 391 NLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
               + +R L+G         + + +++ K+K  F ++
Sbjct: 228 LAYRNIARRLLGENVPLQAFEQEKVSVFAKVKNFFGIR 265


>gi|124025126|ref|YP_001014242.1| putative septum site-determining protein MinD [Prochlorococcus
           marinus str. NATL1A]
 gi|123960194|gb|ABM74977.1| putative septum site-determining protein MinD [Prochlorococcus
           marinus str. NATL1A]
          Length = 271

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 84/177 (47%), Gaps = 12/177 (6%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLL-ADLDLPYGTANINFDKDPINSISDAIYPVGR 227
            +GGVG +T+  N   S+A       +L AD  L      +  +   + +  + +    R
Sbjct: 13  GKGGVGKTTLTANLGISLARQGLTTAVLDADFGLRNLDLLLGLENRIVYTAQEVLEEECR 72

Query: 228 IDKAFVSRLPVFYAENLSILTA--PAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHV 285
           +D+A V         NLS+L A  P ML      D K IV   D+L++ F  V++D P  
Sbjct: 73  LDQALVKH---KQESNLSLLPAGNPRMLDWLKPDDMKRIV---DMLKEQFNFVLIDCPAG 126

Query: 286 WNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPK 342
                +  +  S + ++ T+ +++ +R++  +I +L     + KP  LVLN+V+ PK
Sbjct: 127 VEDGFKNAMAASQEAIVVTNPEVSAVRDADRVIGLLNT--NSIKPVQLVLNRVR-PK 180


>gi|167587314|ref|ZP_02379702.1| response regulator receiver protein [Burkholderia ubonensis Bu]
          Length = 297

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/263 (22%), Positives = 110/263 (41%), Gaps = 45/263 (17%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSI-----------------------------ASVFA 191
           G  ++ +G+R G+G ST+A N A  +                             A+   
Sbjct: 35  GKLVALLGARAGMGVSTLAANLAVWLHKRGSAGAADGAAIGASSRASSRASSGGAAASLG 94

Query: 192 METLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPA 251
            +T L DL LP G + +  +        +A+  + RID+ FV+     +A  +++ T P 
Sbjct: 95  RQTALVDLGLPTGDSALFLNTRCEFHFVEAVRNLRRIDRTFVNTALTRHASGVALTTLPP 154

Query: 252 MLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWN-SWTQEVLTLSDKVVITTSLDLAG 310
            L+   +      V +L+ L   F   ++D+    N  +  ++   SD+  +    ++A 
Sbjct: 155 NLADLREVSYASCVGLLNRLRAFFDQQLVDLGGFSNREFVAQIAAASDEAWLVCDQNVAS 214

Query: 311 LRNSKNLIDVLKKLRPAD---KPPYLVLNQVKTPKKPEISI--SDFCAPLGITPSAIIPF 365
           + ++   +D+L++LR A        +V+NQ      P +S+  +     LG+     +P 
Sbjct: 215 IVSA---VDLLEELRDAGVDSGKMRVVVNQY----DPALSLTPTQIADRLGVALLTTLPA 267

Query: 366 DGAVFGMSANSGKMI---HEVDP 385
                G +AN G++I    E DP
Sbjct: 268 RRVPIGQAANQGRLIVDTAERDP 290


>gi|254818926|ref|ZP_05223927.1| hypothetical protein MintA_03321 [Mycobacterium intracellulare ATCC
           13950]
          Length = 427

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 80/164 (48%), Gaps = 10/164 (6%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           ++F+  +GGVG +TIA     + AS+     +  D +   GT +     +   ++   ++
Sbjct: 176 VAFLSLKGGVGKTTIAATLGATFASIRGDRVVAVDANPDRGTLSQKIPLETAATVRQLLH 235

Query: 224 PVGRID-----KAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLV 278
             G I+     + + S+ P    E L+  T PA+   +  F  +    +LDILE+ + LV
Sbjct: 236 DAGTIERYSDVRRYTSKGPSGL-EVLASETDPAI---SEAFSAEDYGRILDILERFYGLV 291

Query: 279 ILDV-PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL 321
           + D  P + +S  + VL  +D +V+ +S  + G R++   +D L
Sbjct: 292 LTDCGPGLLHSVMKSVLDRADALVVVSSASIDGARSASATLDWL 335


>gi|308174496|ref|YP_003921201.1| ATPase activator of MinC [Bacillus amyloliquefaciens DSM 7]
 gi|307607360|emb|CBI43731.1| ATPase activator of MinC [Bacillus amyloliquefaciens DSM 7]
 gi|328554415|gb|AEB24907.1| ATPase activator of MinC [Bacillus amyloliquefaciens TA208]
 gi|328912819|gb|AEB64415.1| ATPase activator of MinC [Bacillus amyloliquefaciens LL3]
          Length = 267

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/273 (20%), Positives = 122/273 (44%), Gaps = 17/273 (6%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI--NFDKDPINSI 218
           G +I     +GGVG +T + N   ++A +      L D D+     ++    +   I  +
Sbjct: 2   GEAIVITSGKGGVGKTTTSANLGTALA-ILGKRVCLVDTDIGLRNLDVVMGLENRIIYDL 60

Query: 219 SDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLV 278
            D I    +  +A V      + + L ++ A     +T    E+ I  ++  L+Q F  V
Sbjct: 61  VDVIEGRCKTHQALVK--DKRFDDLLHLMPAAQTSDKTAVVPEQ-IKSLVQELKQEFDYV 117

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQV 338
           I+D P       +  ++ +DK ++ T+ +++ +R++  +I +L++     +PP L++N++
Sbjct: 118 IIDCPAGIEQGYKNAVSGADKAIVVTTPEISAVRDADRIIGLLEQ--EDIEPPRLIVNRI 175

Query: 339 KT---PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVD 395
           +         + + +    L I    I+  D  V   ++N G+ I  ++ K+  +    +
Sbjct: 176 RNHLVKNGDTMDVDEVVHHLSIDLLGIVADDDEVI-RASNIGEPI-AMNSKNRASIAYRN 233

Query: 396 FSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
            +R ++G       + + Q  M  KIK  F ++
Sbjct: 234 IARRILGESVPLQVLEEQQKGMMAKIKSFFGVR 266


>gi|172060496|ref|YP_001808148.1| response regulator receiver protein [Burkholderia ambifaria MC40-6]
 gi|171993013|gb|ACB63932.1| response regulator receiver protein [Burkholderia ambifaria MC40-6]
          Length = 424

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/276 (19%), Positives = 109/276 (39%), Gaps = 22/276 (7%)

Query: 123 ALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNC 182
           A +   V +++    S  + + +   + +   E     G  ++ +G+R G+G ST+A N 
Sbjct: 103 AALRAGVRDFIDVSASAEEALRTTRGLLSHVSEPASRHGKVVALLGARAGMGVSTLAANL 162

Query: 183 AFSI---------------ASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGR 227
           A  +                +    +T L DL LP G   +  +        DA+  + R
Sbjct: 163 AVWLQKRALGPGATGGPDGGAPAGRQTALIDLGLPAGDGALFLNTRCEFHFIDAVQNLRR 222

Query: 228 IDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWN 287
           ID+ FV+     +   +++ T P  L    D      + +L+     F   ++D+    N
Sbjct: 223 IDRTFVNTALTRHLSGVALTTLPPDLGGLRDVSYAACIGLLNRFRAFFDQQVVDLGGFSN 282

Query: 288 -SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEI 346
             +  ++   +D+  +     +A + ++ +L+  L+          LV+NQ      P +
Sbjct: 283 REFVTQIAAGADEAWLVCDQGVASIVSAADLLTGLRDAGVDTDRVKLVVNQY----DPAL 338

Query: 347 SI--SDFCAPLGITPSAIIPFDGAVFGMSANSGKMI 380
           ++        LG+     +P      G +AN G++I
Sbjct: 339 NLMPGQIAERLGLALVGTLPARRVAIGHAANQGRLI 374


>gi|154686934|ref|YP_001422095.1| hypothetical protein RBAM_025040 [Bacillus amyloliquefaciens FZB42]
 gi|154352785|gb|ABS74864.1| MinD [Bacillus amyloliquefaciens FZB42]
          Length = 269

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/273 (20%), Positives = 122/273 (44%), Gaps = 17/273 (6%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI--NFDKDPINSI 218
           G +I     +GGVG +T + N   ++A +      L D D+     ++    +   I  +
Sbjct: 4   GEAIVITSGKGGVGKTTTSANLGTALA-ILGKRVCLVDTDIGLRNLDVVMGLENRIIYDL 62

Query: 219 SDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLV 278
            D I    +  +A V      + + L ++ A     +T    E+ I  ++  L+Q F  V
Sbjct: 63  VDVIEGRCKTHQALVK--DKRFDDLLHLMPAAQTSDKTAVVPEQ-IKSLVQELKQEFDYV 119

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQV 338
           I+D P       +  ++ +DK ++ T+ +++ +R++  +I +L++     +PP L++N++
Sbjct: 120 IIDCPAGIEQGYKNAVSGADKAIVVTTPEISAVRDADRIIGLLEQ--EDIEPPRLIVNRI 177

Query: 339 KT---PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVD 395
           +         + + +    L I    I+  D  V   ++N G+ I  ++ K+  +    +
Sbjct: 178 RNHLMKNGDTMDVDEVVHHLSIDLLGIVADDDEVI-RASNIGEPI-AMNSKNRASIAYRN 235

Query: 396 FSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
            +R ++G       + + Q  M  KIK  F ++
Sbjct: 236 IARRILGESVPLQVLEEQQKGMMAKIKSFFGVR 268


>gi|229816769|ref|ZP_04447051.1| hypothetical protein BIFANG_02016 [Bifidobacterium angulatum DSM
           20098]
 gi|229785785|gb|EEP21899.1| hypothetical protein BIFANG_02016 [Bifidobacterium angulatum DSM
           20098]
          Length = 268

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 82/167 (49%), Gaps = 13/167 (7%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI--NFDKDPINSISDA 221
           ISF    GG+G STI    A ++ S+  ++  L D D+P+G   I    + +P  S+ D 
Sbjct: 19  ISFTSPSGGIGLSTITALVALTL-SMQDIDCALLDADIPHGGLGILLGIEHEPGLSLQDI 77

Query: 222 IYPVGRID-KAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVIL 280
             P+GRID KAF   LP  + E +++L   +   +  ++ +  +   +  L +   +V+ 
Sbjct: 78  DAPLGRIDGKAFNLELP--HWEGINVLACASWRGQLPEWWQ--MQAAIQALCEANRMVLA 133

Query: 281 DVPH--VWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
           DV    VW  +  E+L      V+   L + GL  +K  +  L++LR
Sbjct: 134 DVGDGTVWE-YVPELLMAQH--VVAVELSVLGLARAKAHLARLQRLR 177


>gi|329935282|ref|ZP_08285248.1| septum site-determining protein [Streptomyces griseoaurantiacus
           M045]
 gi|329305105|gb|EGG48964.1| septum site-determining protein [Streptomyces griseoaurantiacus
           M045]
          Length = 541

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 77/168 (45%), Gaps = 2/168 (1%)

Query: 158 GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  G  I+  G++GGVG++  A   A + A        LADLDL  G      D     S
Sbjct: 147 GPGGTLITVTGAKGGVGATVTAVQLALA-ARASGRTVALADLDLQSGDVASYLDVQFRRS 205

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
           ++D +  +  I+   +      +   +S+L APA   R  +  +++   VL  L     +
Sbjct: 206 VAD-LAAITDINPRVLQDAVYAHDSGVSLLLAPAEGERGEEVTDRVARQVLGALRSRHDV 264

Query: 278 VILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
           VI+D      + T   + L+D+ ++  + D+  +R +K ++ +  +L+
Sbjct: 265 VIVDCGSQMTAATAAAVELADQALLLVTPDVVAVRAAKRMVRMWDRLQ 312


>gi|118444083|ref|YP_877772.1| septum site-determining protein MinD [Clostridium novyi NT]
 gi|118134539|gb|ABK61583.1| septum site-determining protein MinD [Clostridium novyi NT]
          Length = 265

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 65/279 (23%), Positives = 121/279 (43%), Gaps = 34/279 (12%)

Query: 163 SISFIGSRGGVGSSTIAHNCAFSIAS------VFAMETLLADLDLPYGTAN-INFDKDPI 215
           +I     +GGVG +T   N   ++AS      V   +T L +LD+  G  N I F     
Sbjct: 4   AIVITSGKGGVGKTTTTANIGTALASLGKKVVVVDGDTGLRNLDVLMGLENRIVF----- 58

Query: 216 NSISDAIYPVGRIDKAFVS--RLPVFYAENLSILTAPAMLSR-TYDFDEKMIVPVLDILE 272
            ++ D I    RI +A +   R P     NL +L  P   +R   D   + ++ ++  L+
Sbjct: 59  -TLLDVIEERCRIKQALIKDKRFP-----NLCLL--PTAQTRDKNDVSPEQMLNLVKTLK 110

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY 332
           + F  VI+D P       +  +  +DK ++  + ++  +R++  +I  L      D    
Sbjct: 111 EEFDYVIIDSPAGIEQGFENAIIGADKALVVVNPEVTSVRDADRVIGKLDAKGIDDH--R 168

Query: 333 LVLNQVK---TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAI 389
           L++N++      K   + ++D    L I    ++P D  +  ++ N G+ +  ++ K+  
Sbjct: 169 LIVNRLSYDMVKKGDMLDVNDILDSLAIKLMGVVPIDEEIT-VATNKGEPVV-LNNKAIS 226

Query: 390 ANLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
                + +R + G      T    QS     +KKIFN+K
Sbjct: 227 GKAFTNIARRITGEDIPIETFDNHQSGFLASLKKIFNLK 265


>gi|241759626|ref|ZP_04757727.1| septum site-determining protein MinD [Neisseria flavescens SK114]
 gi|241319998|gb|EER56379.1| septum site-determining protein MinD [Neisseria flavescens SK114]
          Length = 271

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 115/241 (47%), Gaps = 30/241 (12%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF----DKDPINSISDAIYP 224
            +GGVG +T + + A  +A +   +T + D D+  G  N++     ++  +  + + I+ 
Sbjct: 10  GKGGVGKTTTSASIATGLA-LRGHKTAVIDFDV--GLRNLDLIMGCERRVVYDLINVIHG 66

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI------FPLV 278
              +++A +        ENL IL A    S+T D D      V ++++++      F  +
Sbjct: 67  EATLNQALIKDKN---CENLYILPA----SQTRDKDALTREGVDNVMKELASEKMGFEFI 119

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQ 337
           I D P          L  +D+ +ITT+ +++ +R+S  ++ +L+ K R A++   +  + 
Sbjct: 120 ICDSPAGIEQGALMALYFADEAIITTNPEVSSVRDSDRILGILQSKSRKAEQGSTVKEHL 179

Query: 338 VKTPKKPE-------ISISDFCAPLGITPSAIIPFDGAVFGMSANSGK-MIHEVDPKSAI 389
           + T   PE       +S+ D C  L I    +IP    V   ++NSG+ +IH+ +  +A 
Sbjct: 180 LITRYSPERVAKGEMLSVQDICDILRIPLIGVIPESQNVL-QASNSGEPVIHQDNAAAAE 238

Query: 390 A 390
           A
Sbjct: 239 A 239


>gi|114565904|ref|YP_753058.1| septum site-determining protein MinD [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114336839|gb|ABI67687.1| septum site-determining protein MinD [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 273

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 102/238 (42%), Gaps = 28/238 (11%)

Query: 156 GKGSSGCSISFIGS-RGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTANI 208
           GK + G S+  + S +GGVG +T   N A ++A      +V  ++  L  LDL  G  N 
Sbjct: 2   GKKTEGSSVIVVTSGKGGVGKTTTVANVASALARKGYKIAVMDLDIGLKKLDLILGLEN- 60

Query: 209 NFDKDPINSISDAIYPVGRIDKAFVS--RLPVFYAENLSILTAPAMLSRTYD-FDEKMIV 265
                 I  I   I     + +A V   R P  Y         PA  +R  D    + + 
Sbjct: 61  ----RVIYDIIQVIEGECTLKQALVKDKRFPELY-------MLPAAQTRNKDDIKPEQVQ 109

Query: 266 PVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
            +   L   F  + +D P       +  +  +DK ++ T+ +++ +R++  +I +L+  +
Sbjct: 110 EICRQLRPEFDFIFIDCPAGIEQGFRNAIAAADKAIVVTNPEVSAVRDADRIIGMLESAQ 169

Query: 326 PADKPPYLVLNQVKTP---KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMI 380
             D    LV+N+++         +SI D    L I+   I+P D  V  +S N G+ I
Sbjct: 170 FQD--IQLVINRLQASMVRSGDMLSIDDLMEHLCISLLGIVPEDKKVL-ISTNKGEPI 224


>gi|254393098|ref|ZP_05008258.1| septum site-determining protein [Streptomyces clavuligerus ATCC
           27064]
 gi|294814744|ref|ZP_06773387.1| Putative septum site-determining protein [Streptomyces clavuligerus
           ATCC 27064]
 gi|326443125|ref|ZP_08217859.1| putative septum site-determining protein [Streptomyces clavuligerus
           ATCC 27064]
 gi|197706745|gb|EDY52557.1| septum site-determining protein [Streptomyces clavuligerus ATCC
           27064]
 gi|294327343|gb|EFG08986.1| Putative septum site-determining protein [Streptomyces clavuligerus
           ATCC 27064]
          Length = 415

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 58/272 (21%), Positives = 113/272 (41%), Gaps = 40/272 (14%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS--LYRALISNHVSEYLIE 135
           P++++V  ++     + ALE + EV      V V+  T D    LY A + +     +  
Sbjct: 56  PEVVLVHERIGP---VPALELIREVALRFPAVGVVLVTVDAGPGLYSAAMDSGARGLVAL 112

Query: 136 PLSVADIINSISA-----------------IFTPQEEGKGSSGCSISFIGSRGGVGSSTI 178
           PLS  ++   + A                 +FT      G  G  ++  G++GGVG +T+
Sbjct: 113 PLSYEELAQRVQAAAGWSTGVRRHLGHSGDVFT------GPGGTVVTVSGAKGGVG-TTV 165

Query: 179 AHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISD--AIYPVG-RI--DKAFV 233
                   A        LADLDL  G      D     S++D   I  +G R+  D  F 
Sbjct: 166 TAVQLALAAQASGRTVALADLDLQAGDVASYLDVQFRRSVADLAGIQDIGPRVLQDALFA 225

Query: 234 SRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEV 293
                 +   + +L AP    R  + D++ +  ++  L   + +V++D     ++     
Sbjct: 226 ------HQTGMGLLLAPGEGERGEEVDDRAVRQIVSALRNRYEVVVVDCGTQMHNANAAA 279

Query: 294 LTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
           + ++D  ++ T+ D+  +R +K ++ +  +L+
Sbjct: 280 IEMADITLLVTTPDVVAVRGAKRMVRLWDRLQ 311


>gi|294501402|ref|YP_003565102.1| septum site-determining protein MinD [Bacillus megaterium QM B1551]
 gi|295706750|ref|YP_003599825.1| septum site-determining protein MinD [Bacillus megaterium DSM 319]
 gi|294351339|gb|ADE71668.1| septum site-determining protein MinD [Bacillus megaterium QM B1551]
 gi|294804409|gb|ADF41475.1| septum site-determining protein MinD [Bacillus megaterium DSM 319]
          Length = 266

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 57/277 (20%), Positives = 122/277 (44%), Gaps = 26/277 (9%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN----FDKDPIN 216
           G +I     +GGVG +T + N   ++A +      L D D+  G  N++     +   I 
Sbjct: 2   GEAIVVTSGKGGVGKTTTSANLGTALA-LAGKRVCLVDTDI--GLRNLDVVMGLENRIIY 58

Query: 217 SISDAIYPVGRIDKAFVS--RLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI 274
            + D +    +  KA +   R    Y     +L A     +T    E+M   VL  L+Q 
Sbjct: 59  DLVDVVEGRCQPQKALIKDKRFECLY-----LLPAAQTSDKTAVQPEQMRELVLQ-LKQD 112

Query: 275 FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLV 334
           +  V++D P       +  +  +DK ++ T+ +++ +R++  +I +L++     + P LV
Sbjct: 113 YDYVVIDCPAGIEQGYKNAVAGADKALVVTTPEVSAVRDADRIIGLLEQ--EDIESPKLV 170

Query: 335 LNQVKT---PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIAN 391
           +N++++        + + +    L +    I+  D  V   S N   ++  +DP S  + 
Sbjct: 171 INRIRSHMMKNGDMLDVEEISQLLAVDLIGIVADDENVIRASNNGEPIV--MDPSSKASI 228

Query: 392 LLVDFSRVLMGRV----TVSKPQSAMYTKIKKIFNMK 424
              + +R ++G      ++ +    M+ +IK+ F ++
Sbjct: 229 AYRNIARRILGETVPLQSLDEEDKGMFARIKRFFGVR 265


>gi|254252519|ref|ZP_04945837.1| Hypothetical protein BDAG_01751 [Burkholderia dolosa AUO158]
 gi|124895128|gb|EAY69008.1| Hypothetical protein BDAG_01751 [Burkholderia dolosa AUO158]
          Length = 272

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 94/227 (41%), Gaps = 4/227 (1%)

Query: 187 ASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSI 246
           AS  A +T L DL LP G   +  +        DA++ + RID+ FV+     +A  +++
Sbjct: 30  ASPVARQTALLDLGLPAGDGALFLNTRCEFHFVDAVHNLRRIDRTFVNTALTRHASGVAL 89

Query: 247 LTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWN-SWTQEVLTLSDKVVITTS 305
            T P  L    D        +L+     F   ++D+    N  +  +++ L+D+  +   
Sbjct: 90  TTLPPDLGGLRDVSYASCAGLLNRFRAFFDQQVVDLGGFTNREFVAQIVALADEAWLVCD 149

Query: 306 LDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPF 365
             +A +  + +L+  L+          LV+NQ        ++ +     LG++    +P 
Sbjct: 150 QGVASIGAAADLLADLRDSGVDIDRVRLVVNQYDAALT--LTPAQIATRLGLSLVGTLPS 207

Query: 366 DGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMG-RVTVSKPQS 411
                G +AN G++I +V  +      L   +  L G  V    P+S
Sbjct: 208 RRVAIGQAANQGRLIVDVAERDPYVRALESLAARLPGVSVRAGAPRS 254


>gi|72383534|ref|YP_292889.1| putative septum site-determining protein MinD [Prochlorococcus
           marinus str. NATL2A]
 gi|72003384|gb|AAZ59186.1| septum site-determining protein MinD [Prochlorococcus marinus str.
           NATL2A]
          Length = 271

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 84/177 (47%), Gaps = 12/177 (6%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLL-ADLDLPYGTANINFDKDPINSISDAIYPVGR 227
            +GGVG +T+  N   S+A       +L AD  L      +  +   + +  + +    R
Sbjct: 13  GKGGVGKTTLTANLGISLARQGLTTAVLDADFGLRNLDLLLGLENRIVYTAQEVLEEECR 72

Query: 228 IDKAFVSRLPVFYAENLSILTA--PAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHV 285
           +D+A V         NLS+L A  P ML      D K IV   D+L++ F  V++D P  
Sbjct: 73  LDQALVKH---KQESNLSLLPAGNPRMLDWLKPDDMKCIV---DMLKEQFNYVLIDCPAG 126

Query: 286 WNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPK 342
                +  +  S + ++ T+ +++ +R++  +I +L     + KP  LVLN+V+ PK
Sbjct: 127 VEDGFKNAMAASQEAIVVTNPEVSAVRDADRVIGLLNT--NSIKPVQLVLNRVR-PK 180


>gi|284048524|ref|YP_003398863.1| response regulator receiver protein [Acidaminococcus fermentans DSM
           20731]
 gi|283952745|gb|ADB47548.1| response regulator receiver protein [Acidaminococcus fermentans DSM
           20731]
          Length = 367

 Score = 47.8 bits (112), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/311 (16%), Positives = 129/311 (41%), Gaps = 9/311 (2%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPL 137
           P+LI++   +D     S L P  +     T +I +    D      L+ +    ++++P 
Sbjct: 49  PELILLDIDLDRN---STLLPDLKKAYPHTVIIGMSRRWDAEAQSRLLRSGAGGFMVKPF 105

Query: 138 SVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLA 197
           S  ++++++  +   Q          ++F   +G  G +T+  N   ++A        + 
Sbjct: 106 SGEELLDTLKNL---QNTSASRHSQVVAFFSPKGKSGKTTLIANLGAALAQQTGEPVAII 162

Query: 198 DLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTY 257
           D DL +G   + F+  P ++I +A+  +  +    +    V   ENLS+L   A      
Sbjct: 163 DGDLQFGDMGVFFNLTPQSTIVEAVRDISFLSPVTLKSYFVPVNENLSVLCGAAKPDLAE 222

Query: 258 DFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLA-GLRNSKN 316
               + +  ++++   IF  V++D+   ++        ++DK ++   ++    + + K 
Sbjct: 223 TVTMEGMTSLIEMARGIFRYVLVDLSSGFSDVACTACEMADKTLVMAMVNGGYEVEHMKR 282

Query: 317 LIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANS 376
            +++ +     D+    V  +V    + E     +   LG     ++P +      +A++
Sbjct: 283 ALEIFRAWEDCDRRVKPVFTRVSPCTEEE--RDRYSQALGFPVFQVLPNEYLAVSAAADN 340

Query: 377 GKMIHEVDPKS 387
           G+++    P++
Sbjct: 341 GRLLLNQAPEN 351


>gi|304313410|ref|YP_003813008.1| Chromosome partition protein [gamma proteobacterium HdN1]
 gi|301799143|emb|CBL47386.1| Chromosome partition protein [gamma proteobacterium HdN1]
          Length = 273

 Score = 47.8 bits (112), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 88/199 (44%), Gaps = 16/199 (8%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF---DKDPINS 217
           G  ++    +GGVG +T + N A S+A+    +TLL DLD P G A +       +   +
Sbjct: 2   GKILAVANQKGGVGKTTSSVNLAASLAAT-RRKTLLIDLD-PQGNATMGSGVNKSEQTRT 59

Query: 218 ISDAIYPVGRIDKAFVS--RLPVFYAENL----SILTAPAMLSRTYDFDEKMIVPVLDIL 271
           I D +     +D+  V   R+P     +L      LTA  ++       E+ +   LD +
Sbjct: 60  IFDVL-----VDEVPVEEVRIPTEAGFDLLPANGDLTAAEVMLLDATNKERRLEKALDRV 114

Query: 272 EQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPP 331
             ++  +I+D P   N  T   L  +D VVI    +   L     L+  ++K+R    P 
Sbjct: 115 RNVYDFIIIDCPPSLNMLTINALVAADGVVIPIQCEYYALEGLTALLGTIEKIRSVLNPK 174

Query: 332 YLVLNQVKTPKKPEISISD 350
             +   ++T   P I++++
Sbjct: 175 LQIDGLLRTMYDPRIALAN 193


>gi|217970445|ref|YP_002355679.1| septum site-determining protein MinD [Thauera sp. MZ1T]
 gi|217507772|gb|ACK54783.1| septum site-determining protein MinD [Thauera sp. MZ1T]
          Length = 270

 Score = 47.8 bits (112), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 107/229 (46%), Gaps = 25/229 (10%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF----DKDPINSISDAIYP 224
            +GGVG +T +   A  +A +   +T + D D+  G  N++     ++  +  + + +  
Sbjct: 9   GKGGVGKTTTSAAFASGLA-LRGFKTAVIDFDV--GLRNLDLIMGCERRVVYDLVNVVNG 65

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYD-FDEKMIVPVLDILEQI-FPLVILDV 282
             R+++A +      + +NL IL  PA  +R  D   E+ +  VL  LE + F  V+ D 
Sbjct: 66  EARLNQALIKDK---HCDNLFIL--PASQTRDKDALTEEGVEKVLQELEHMGFEYVVCDS 120

Query: 283 PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL----KKLRPADKP--PYLVLN 336
           P          LT +D+ ++TT+ +++ +R+S  ++ +L    K+ R   +P   +L++ 
Sbjct: 121 PAGIERGAVMALTFADEAIVTTNPEVSSVRDSDRILGILQSKSKRAREGGEPVKEHLLIT 180

Query: 337 QVKTPKKPE----ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIH 381
           +  +PK+ E    +S  D    L +    +IP   +V   S      IH
Sbjct: 181 RY-SPKRVEDGEMLSYKDVQELLRVPLIGVIPESESVLHASNQGTPAIH 228


>gi|307730005|ref|YP_003907229.1| putative pilus assembly protein, CpaE-like protein [Burkholderia
           sp. CCGE1003]
 gi|307584540|gb|ADN57938.1| putative pilus assembly protein, CpaE-like protein [Burkholderia
           sp. CCGE1003]
          Length = 413

 Score = 47.8 bits (112), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 55/285 (19%), Positives = 114/285 (40%), Gaps = 6/285 (2%)

Query: 106 GTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSIS 165
           G +++  G   +     A +   V +++      AD +     +     E     G   +
Sbjct: 87  GLQIVATGSLAEPESALAALRAGVRDFIDLSAPAADALRITQQVLDNLVEPVSRHGRVTA 146

Query: 166 FIGSRGGVGSSTIAHNCAFSIASVFAM---ETLLADLDLPYGTANINFDKDPINSISDAI 222
            +G+R G+G ST+A N A  +    A    + +L DL LP G   +  +        +A+
Sbjct: 147 LLGARVGMGVSTLATNLAVMLQRRDAQQGRQAVLFDLGLPAGDGLLMLNARSDFHFVEAV 206

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDV 282
             + R D+ FV      +   L+  T P  L+   +      + +L+ L   F   I+D+
Sbjct: 207 RNLRRFDQTFVHTALSHHTSGLAFTTLPPNLAEMREISYSSSIGLLNRLRAFFDQQIVDL 266

Query: 283 PHVWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTP 341
               N  +  +V+   D+  +     +A + ++  +++ L++         L++N+    
Sbjct: 267 GGFSNMEFVAQVVRAGDEAWLVCDQGVASIVSAVGVLESLREAGADTTNVRLIVNRFDA- 325

Query: 342 KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPK 386
            +  ++ +     L I   A +P      G +AN G +I +  P+
Sbjct: 326 -ELGLAAARIAERLDIALLASLPERRVALGQTANQGLLIADAAPR 369


>gi|51473285|ref|YP_067042.1| chromosome partitioning protein ParA (Soj protein) [Rickettsia
           typhi str. Wilmington]
 gi|51459597|gb|AAU03560.1| chromosome partitioning protein ParA (Soj protein) [Rickettsia
           typhi str. Wilmington]
          Length = 255

 Score = 47.8 bits (112), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 83/180 (46%), Gaps = 21/180 (11%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF---DKDPINSISD 220
           I+ +  +GGV  +T   N A + ASV   + L+ DLD P G ++  F    +   N+I  
Sbjct: 4   IAIVNQKGGVAKTTTTVNLATAFASV-NKKILVIDLD-PQGNSSTGFGIIQQQRKNTIYQ 61

Query: 221 AIYPVGRIDKAFVS-RLPVFYAENLSILTAPAMLS------RTYDFDEKMIVPVLDILEQ 273
            +  +  +  A +S  +P     NL I+T+   LS       T    E +++ +L+ ++ 
Sbjct: 62  VLTNLIELKDAIISTNIP-----NLEIITSNTNLSAAELDLTTLKDREYILMKLLEEVKI 116

Query: 274 IFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL----KKLRPADK 329
           ++  +I+D P   N  T   L  SD+V+I    D   L    NL+  +    KKL P  K
Sbjct: 117 LYDYIIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSNLLKTIEIVEKKLNPKIK 176


>gi|146329380|ref|YP_001209806.1| septum site-determining protein MinD [Dichelobacter nodosus
           VCS1703A]
 gi|146232850|gb|ABQ13828.1| septum site-determining protein MinD [Dichelobacter nodosus
           VCS1703A]
          Length = 273

 Score = 47.8 bits (112), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 111/227 (48%), Gaps = 30/227 (13%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF----DKDPINSISDAIYP 224
            +GGVG +T + + A  IA +   +T+  D D+  G  N++     ++  + +  D I  
Sbjct: 10  GKGGVGKTTTSASLATGIA-LLGYKTIAIDFDV--GLKNLDLLMGVERRVVYNFIDVIRG 66

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFD---EKMIVPVLDILEQI-FPLVIL 280
             R+++A +    +   ENL  L A    S+T+D D   ++ +  VL+ L+++ F  +I 
Sbjct: 67  GVRLNQAIIRDKAI---ENLYTLAA----SQTWDKDVLTQEGVEKVLNELKEMGFQYIIC 119

Query: 281 DVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL----KKLRPADKP--PYLV 334
           D P          L  +D+ +ITT+ +++ +R+S  ++ +L    ++    ++P   +LV
Sbjct: 120 DSPAGIERGALMALYFADEAIITTNPEVSSIRDSDRILGILSSKSRRAELGEEPVKEHLV 179

Query: 335 LNQVKTPKKPEI----SISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
           + +   P++  I    S+ D    LG+    +IP    V  +++N G
Sbjct: 180 ITRYD-PRRVRIKDMLSVEDVIDVLGVELLGVIPESNDVL-LASNEG 224


>gi|296158796|ref|ZP_06841625.1| putative pilus assembly protein, CpaE-like protein [Burkholderia
           sp. Ch1-1]
 gi|295891001|gb|EFG70790.1| putative pilus assembly protein, CpaE-like protein [Burkholderia
           sp. Ch1-1]
          Length = 413

 Score = 47.8 bits (112), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 75/372 (20%), Positives = 142/372 (38%), Gaps = 45/372 (12%)

Query: 32  HVFCVTDTLYS--VVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDS 89
           HV  + DTL +  VVE + +DP M  +  RI              +  P L+ V      
Sbjct: 26  HVHWLADTLVAAGVVETATLDPSM--LTQRIA-------------TLNPSLVFVDFSCGR 70

Query: 90  REVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAI 149
               SA          G +++ +G   +     A +   V +++       D +     +
Sbjct: 71  AAAASAAASAVRAAYPGMQIVALGSLAEPESALAALRAGVRDFIDLSAPREDALRITRQV 130

Query: 150 FTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIAS---VFAMETLLADLDLPYGTA 206
                E     G   + +G+R G+G ST+A N +  +         +  L DL LP   A
Sbjct: 131 LDNLVEPVSRHGHVTALLGARVGMGVSTLAANLSVMLQRRDVAQGRQAALLDLGLPAADA 190

Query: 207 NINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVP 266
           ++  +     +  +A+  + R D+ FV      +A  L++ T P  L+   +      + 
Sbjct: 191 SLLLNTRSEFNFVEAVRNLRRFDQTFVHTALSHHASGLALTTLPPNLADMREVSYSSSIG 250

Query: 267 VLDILEQIFPLVILDVPHVWNS-WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
           +L  L   F   I+D+    NS +   V+  +D+  +     +A + ++  ++D L++  
Sbjct: 251 LLTRLRAFFDQQIVDLGGFANSEFIAHVVQAADETWLLCDQGVASIVSAVGVLDALREEG 310

Query: 326 PADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAI-----------IPFDGAVFGMSA 374
                  L++N+             F A LG+ P+ I           +P      G +A
Sbjct: 311 VDTANVRLIVNK-------------FDADLGLAPAQIAQRLDIALLGTLPERRIALGQAA 357

Query: 375 NSGKMIHEVDPK 386
           N G ++ +V  +
Sbjct: 358 NQGHLLVDVAAR 369


>gi|311069291|ref|YP_003974214.1| ATPase activator of MinC [Bacillus atrophaeus 1942]
 gi|310869808|gb|ADP33283.1| ATPase activator of MinC [Bacillus atrophaeus 1942]
          Length = 268

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 58/278 (20%), Positives = 121/278 (43%), Gaps = 26/278 (9%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI--NFDKDPINSI 218
           G +I     +GGVG +T + N   ++A +      L D D+     ++    +   I  +
Sbjct: 2   GEAIVITSGKGGVGKTTTSANLGTALA-ILGKRVCLVDTDIGLRNLDVVMGLENRIIYDL 60

Query: 219 SDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVP-----VLDILEQ 273
            D +    ++ +A V        ++L  L   A  S     D+  +VP     ++  L+Q
Sbjct: 61  VDVVEGRCKMHQALVKDKRF---DDLLYLMPAAQTS-----DKTAVVPDQIKTLIQQLKQ 112

Query: 274 IFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYL 333
            F  VI+D P       +  ++ +DK ++ T+ +++ +R++  +I +L++    + PP L
Sbjct: 113 EFDYVIIDCPAGIEQGYKNAVSGADKAIVVTTPEISAVRDADRIIGLLEQEENIE-PPRL 171

Query: 334 VLNQVKT---PKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIA 390
           ++N+++         + + +    L I    I+  D  V   S N G+ I  +D K+  +
Sbjct: 172 IVNRIRNHLMKNGDTMDVDEVVHHLSIDLIGIVADDDEVIKAS-NIGEPI-AMDSKNRAS 229

Query: 391 NLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
               + +R ++G       + +    M  KIK  F ++
Sbjct: 230 IAYRNIARRILGESVPLQVLEEQNKGMMAKIKSFFGVR 267


>gi|281212460|gb|EFA86620.1| hypothetical protein PPL_00421 [Polysphondylium pallidum PN500]
          Length = 312

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 84/194 (43%), Gaps = 17/194 (8%)

Query: 243 NLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVI 302
           NL +L A     +T     + +  VLD L + F  ++ D P    S     +  SD  +I
Sbjct: 122 NLYLLAASQTKDKTA-LKMEAVEKVLDELRENFDYIVCDSPAGIESGAHHAMYWSDSAII 180

Query: 303 TTSLDLAGLRNSKNLIDVL--KKLRPADKPPYLVLNQVKTPKKPE-------ISISDFCA 353
            T+ +L+ +R+S  ++ +L  K  R  +    + LN + T   PE       +S+ D   
Sbjct: 181 CTNPELSSVRDSDKMLGILASKSKRALEGKDPIKLNLLITRYSPERAESGGMLSVKDIQE 240

Query: 354 PLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMG-----RVTVSK 408
            LGI    ++P    +   + N G+ +  +D  S  A    D     +G     R T  K
Sbjct: 241 NLGIKLLGVVPESQDILSCT-NLGRPVITLDKNSDPAEAYRDVVDRFLGENKPMRFTEPK 299

Query: 409 PQSAMYTKIKKIFN 422
           P + +++K+ K+F 
Sbjct: 300 P-TGLFSKMSKLFG 312


>gi|320161466|ref|YP_004174690.1| response regulator receiver protein [Anaerolinea thermophila UNI-1]
 gi|319995319|dbj|BAJ64090.1| response regulator receiver protein [Anaerolinea thermophila UNI-1]
          Length = 413

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/230 (17%), Positives = 95/230 (41%), Gaps = 24/230 (10%)

Query: 108 KVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSI--SAIFTPQEEGKGSSGCSIS 165
           +V+++    D S  R  +     ++L +P  + ++ ++I  + +   +E  K + G  ++
Sbjct: 82  QVVILSVQGDQSYMRRAMLAGARDFLTKPPMIDELTDAIRRAGVLAHEERKKVTPGFPVA 141

Query: 166 FI---------------------GSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYG 204
            +                       +GG G +TIA N A ++ +       L D +L +G
Sbjct: 142 PVEPGLSTPMPALLPRGKVIVVYSPKGGTGCTTIATNLAIALKADEETRVALIDANLEFG 201

Query: 205 TANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFY-AENLSILTAPAMLSRTYDFDEKM 263
              +  ++   N++ D       +D   V  + V + A  L IL AP           + 
Sbjct: 202 DVAVFLNEQGKNTVLDLAPRAEELDPEIVQSVMVNHRASGLDILAAPPRPEHASKITGEQ 261

Query: 264 IVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRN 313
              +++ L+ ++  +++D         Q  L +++ +V+ T+ D+  ++N
Sbjct: 262 FSKMVEYLKSLYAYIVIDTASSLTEVVQAALDIANVIVLVTTQDIPSIKN 311


>gi|225076346|ref|ZP_03719545.1| hypothetical protein NEIFLAOT_01390 [Neisseria flavescens
           NRL30031/H210]
 gi|224952331|gb|EEG33540.1| hypothetical protein NEIFLAOT_01390 [Neisseria flavescens
           NRL30031/H210]
          Length = 271

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 113/243 (46%), Gaps = 34/243 (13%)

Query: 169 SRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTANINFDKDPINSISDAI 222
            +GGVG +T + + A  +A      +V   +  L +LDL  G      ++  +  + + I
Sbjct: 10  GKGGVGKTTTSASIATGLALRGHKTAVIDFDVGLRNLDLIMGC-----ERRVVYDLINVI 64

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI------FP 276
           +    +++A +        ENL IL A    S+T D D      V ++++++      F 
Sbjct: 65  HGEATLNQALIKDKN---CENLYILPA----SQTRDKDALTREGVENVMKELASKKMGFE 117

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK-KLRPADKPPYLVL 335
            +I D P          L  +D+ +ITT+ +++ +R+S  ++ +L+ K R A++   +  
Sbjct: 118 FIICDSPAGIEQGALMALYFADEAIITTNPEVSSVRDSDRILGILQSKSRKAEQGGTVKE 177

Query: 336 NQVKTPKKPE-------ISISDFCAPLGITPSAIIPFDGAVFGMSANSGK-MIHEVDPKS 387
           + + T   PE       +S+ D C  L I    +IP    V   ++N+G+ +IH+ +  +
Sbjct: 178 HLLITRYSPERVAKGEMLSVQDICDILRIPLIGVIPESQNVL-QASNAGEPVIHQDNAAA 236

Query: 388 AIA 390
           A A
Sbjct: 237 AEA 239


>gi|116075874|ref|ZP_01473133.1| putative septum site-determining protein MinD [Synechococcus sp.
           RS9916]
 gi|116067189|gb|EAU72944.1| putative septum site-determining protein MinD [Synechococcus sp.
           RS9916]
          Length = 271

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 127/283 (44%), Gaps = 29/283 (10%)

Query: 159 SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSI 218
           S+  +I     +GGVG +T+  N   ++A    + T++ D D  +G  N++      N I
Sbjct: 3   STSRTILICSGKGGVGKTTLTANLGIALAR-LGLRTVVLDAD--FGLRNLDLLLGLENRI 59

Query: 219 ----SDAIYPVGRIDKAFVSRLPVFYAENLSILTA--PAMLSRTYDFDEKMIVPVLDILE 272
                + +    R+++A V         NL++L A  P ML      D + I     +LE
Sbjct: 60  VFTAQEVLAETCRLEQALVKH---KQEPNLALLPAGNPRMLEWLKPEDMQAIA---KMLE 113

Query: 273 QIFPLVILDVP-HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPP 331
           Q F  V++D P  + + +   V    + +VITT  +++ +R++  +I +L        P 
Sbjct: 114 QQFDYVLIDCPAGIEDGFKNAVAAAKEAIVITTP-EVSAVRDADRVIGLLNT--HGVSPV 170

Query: 332 YLVLNQVKTPK----KPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS 387
            LVLN+V+ PK    +  +++ D    L +    ++  D  V  +S N G+ +      S
Sbjct: 171 QLVLNRVR-PKMMANQEMLAVDDVTDILALPLLGLVLEDEQVI-VSTNRGEPLTLNGSHS 228

Query: 388 AIANLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMKCF 426
             A    + +R L G     +  SK +S +  K++++   K F
Sbjct: 229 PAARAYGNVARRLQGEEVPLIDPSKERSGLRAKVRRLMQKKIF 271


>gi|18311120|ref|NP_563054.1| septum site-determining protein MinD [Clostridium perfringens str.
           13]
 gi|110798628|ref|YP_696816.1| septum site-determining protein MinD [Clostridium perfringens ATCC
           13124]
 gi|110802303|ref|YP_699414.1| septum site-determining protein MinD [Clostridium perfringens
           SM101]
 gi|168205627|ref|ZP_02631632.1| septum site-determining protein MinD [Clostridium perfringens E
           str. JGS1987]
 gi|168208840|ref|ZP_02634465.1| septum site-determining protein MinD [Clostridium perfringens B
           str. ATCC 3626]
 gi|168212825|ref|ZP_02638450.1| septum site-determining protein MinD [Clostridium perfringens CPE
           str. F4969]
 gi|168215765|ref|ZP_02641390.1| septum site-determining protein MinD [Clostridium perfringens NCTC
           8239]
 gi|169344211|ref|ZP_02865193.1| septum site-determining protein MinD [Clostridium perfringens C
           str. JGS1495]
 gi|182623939|ref|ZP_02951727.1| septum site-determining protein MinD [Clostridium perfringens D
           str. JGS1721]
 gi|18145803|dbj|BAB81844.1| septum site-determining protein [Clostridium perfringens str. 13]
 gi|110673275|gb|ABG82262.1| septum site-determining protein MinD [Clostridium perfringens ATCC
           13124]
 gi|110682804|gb|ABG86174.1| septum site-determining protein MinD [Clostridium perfringens
           SM101]
 gi|169297670|gb|EDS79770.1| septum site-determining protein MinD [Clostridium perfringens C
           str. JGS1495]
 gi|170662881|gb|EDT15564.1| septum site-determining protein MinD [Clostridium perfringens E
           str. JGS1987]
 gi|170713027|gb|EDT25209.1| septum site-determining protein MinD [Clostridium perfringens B
           str. ATCC 3626]
 gi|170715486|gb|EDT27668.1| septum site-determining protein MinD [Clostridium perfringens CPE
           str. F4969]
 gi|177910832|gb|EDT73186.1| septum site-determining protein MinD [Clostridium perfringens D
           str. JGS1721]
 gi|182382421|gb|EDT79900.1| septum site-determining protein MinD [Clostridium perfringens NCTC
           8239]
          Length = 265

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 59/275 (21%), Positives = 116/275 (42%), Gaps = 28/275 (10%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIAS------VFAMETLLADLDLPYGTANINFDKDP 214
           G SI     +GGVG +T   N   ++A+      V   +T L +LD+  G  N       
Sbjct: 2   GVSIVITSGKGGVGKTTTTANIGTALAAQGKKVVVVDGDTGLRNLDVLMGLEN-----RI 56

Query: 215 INSISDAIYPVGRIDKAFV--SRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILE 272
           + ++ D I    R  +A +   R    Y      L   A      D   + ++ +++ L+
Sbjct: 57  VYTVIDVIENRCRTKQALIRDKRFNNLY------LLPTAQTKDKNDISPEQMLRLVNELK 110

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY 332
           + F  VILD P       +  +  +D+ ++  + ++  +R++  +I  L   +  +    
Sbjct: 111 EEFDYVILDCPAGIEQGFENAIVGADRAIVVVNPEITSVRDADRVIGKLDA-KGLENHEV 169

Query: 333 LV--LNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIA 390
           +V  LN   T K   + ISD    L +    ++P D  +  +S N G+ I  +D K++  
Sbjct: 170 IVNRLNYEMTKKGDMLDISDIIETLSVKLLGVVPDDRNIT-VSTNKGEPIV-LDEKASAG 227

Query: 391 NLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIF 421
               +  R ++G     + ++     +++ I K+F
Sbjct: 228 QAFRNIGRRIIGEDVPIMDLNTEHQGIFSSILKLF 262


>gi|313835705|gb|EFS73419.1| response regulator receiver domain protein [Propionibacterium acnes
           HL037PA2]
 gi|314928376|gb|EFS92207.1| response regulator receiver domain protein [Propionibacterium acnes
           HL044PA1]
 gi|314970228|gb|EFT14326.1| response regulator receiver domain protein [Propionibacterium acnes
           HL037PA3]
 gi|328908043|gb|EGG27802.1| response regulator receiver protein [Propionibacterium sp. P08]
          Length = 426

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 89/212 (41%), Gaps = 5/212 (2%)

Query: 129 VSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIAS 188
           VSE +   L  AD +  + A    Q   +G   C     G++GGVG++T+A + A     
Sbjct: 111 VSERIGRALEYADTMRKVIAGTVAQRRRRGRLIC---VAGAKGGVGTTTLAVHMAADFLR 167

Query: 189 VFAMETL-LADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSIL 247
           V     + + D D+  G      D     SI+D       +    V    + +   + ++
Sbjct: 168 VHPQSRVCVVDADVEKGDVAAVLDIRQSVSIADIAKVYSDLSANTVGDAVIQHESGIHVM 227

Query: 248 TAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLD 307
            AP  +  +     + I  +LD+L   FPLVI+D     +     V  ++D++V+  S D
Sbjct: 228 LAPVDVRESDYITPEAIHAILDLLRMEFPLVIVDAGGHVSPGQAAVAQMADEMVVVISPD 287

Query: 308 LAGLRNSKNLIDVLKKLRPADKPPY-LVLNQV 338
              +R  +      + L   D+    +V+N+V
Sbjct: 288 ALVMRAFRKRAAAWESLGVRDEAELKVVVNKV 319


>gi|149925871|ref|ZP_01914135.1| chromosome partitioning protein, parA family protein [Limnobacter
           sp. MED105]
 gi|149825988|gb|EDM85196.1| chromosome partitioning protein, parA family protein [Limnobacter
           sp. MED105]
          Length = 265

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 88/199 (44%), Gaps = 38/199 (19%)

Query: 167 IGSRGGVGSSTIAHNCAFSIASVFAMETLLADLD----------------LPYGTANINF 210
              +GGVG STI  N A +I++   ++TLL DLD                L Y  A+  F
Sbjct: 6   FNQKGGVGKSTITSNLA-AISANSGLKTLLIDLDPQGNSTQYIMGRGSAPLEYSLADF-F 63

Query: 211 DKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSIL-TAPAMLSRTYDFDEKMIV---- 265
           D+    +++  I P  +    FV   P    ENL +L + PA+       + +  +    
Sbjct: 64  DQ----ALNFKIRP--KKSAEFVVETPY---ENLDLLGSHPALEELQVKLESRYKIFKLR 114

Query: 266 PVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
             LD L+  +  V +D P   N +++  L  +D V+I    D    R   NL+D L ++R
Sbjct: 115 EALDELKGQYDRVYIDTPPALNFFSRSALIAADSVLIPFDCDEFSRRALYNLMDALNEIR 174

Query: 326 PADKPPYL-----VLNQVK 339
            AD  P L     V+NQ +
Sbjct: 175 -ADHNPALEVEGIVVNQFQ 192


>gi|301106673|ref|XP_002902419.1| septum site-determining protein minD [Phytophthora infestans T30-4]
 gi|262098293|gb|EEY56345.1| septum site-determining protein minD [Phytophthora infestans T30-4]
          Length = 295

 Score = 47.0 bits (110), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 109/241 (45%), Gaps = 32/241 (13%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF----DKDPINSISDAIYP 224
            +GGVG +T+  +  + +A      T L D D+  G  N++     ++  I      I  
Sbjct: 36  GKGGVGKTTVTASMGYGLAQR-GFRTCLIDFDI--GLRNLDLHLGCERRVIFDFIHVIEK 92

Query: 225 VGRIDKAFVS--RLPVFYAENLSILTAPAMLSRTYDFD---EKMIVPVLDILEQIFPLVI 279
             R+++A +   RL     E LS+L A    S+T D +   E  +  VLD L+  F  ++
Sbjct: 93  NCRLNQALIKDKRL-----ERLSLLAA----SQTRDKEALTEDGVEEVLDELKSQFDFIL 143

Query: 280 LDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL--KKLRPAD-KPP---YL 333
            D P    S  +  +  +D  ++ T+ +++  R+S  +I  +  K LR  + + P    L
Sbjct: 144 CDSPAGIESGARHAMYFADDAILVTNPEISSCRDSDKMIGFIASKSLRAKEGREPVNQRL 203

Query: 334 VLNQVKTPKKPE---ISISDFCAPLGITPSAIIPFDGAVFGMSANSGK-MIHEVDPKSAI 389
           ++N+    +      +S+ D    LG+    +IP    V   S+N G+ +I     K+A+
Sbjct: 204 LVNRYDANRVKNDDCLSVDDIEEMLGLPVCGVIPESAHVL-TSSNMGQPVITAEGEKAAV 262

Query: 390 A 390
           A
Sbjct: 263 A 263


>gi|320160384|ref|YP_004173608.1| septum site-determining protein MinD [Anaerolinea thermophila
           UNI-1]
 gi|319994237|dbj|BAJ63008.1| septum site-determining protein MinD [Anaerolinea thermophila
           UNI-1]
          Length = 267

 Score = 47.0 bits (110), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 61/252 (24%), Positives = 109/252 (43%), Gaps = 30/252 (11%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAM------ETLLADLDLPYGTAN-INFDKDPIN 216
           I+F   +GGVG +T   N A ++A +         +  L +LDL  G  N I +D     
Sbjct: 6   ITFTSGKGGVGKTTTTANVAVALALLGKKVVCIDGDIGLRNLDLVLGLENRIVYD----- 60

Query: 217 SISDAIYPVGRIDKAFV--SRLPVFYAENLSILTAPAMLSRTYD-FDEKMIVPVLDILEQ 273
            + D +    R+ +A +   RLP  Y         PA  +R  +      +V + D L  
Sbjct: 61  -VVDVVEGRCRLRQAMIRDKRLPELY-------LIPAAQTRDKNALSPSDMVRLCDELRS 112

Query: 274 IFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYL 333
            F  + +D P       +  +  +D+VV+ T+ +++ +R++  +I +++       P  L
Sbjct: 113 DFDYICIDSPAGIERGFRNAIAPADQVVVVTNPEVSAVRDADRVIGLVEAEEKG--PARL 170

Query: 334 VLNQVK---TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIA 390
           +LN+V      +   +S  D    L I    I+P D  V  +S N G+ I  ++ K+   
Sbjct: 171 ILNRVNPAMVKRNEMLSPEDVLELLAIDLLGIVPEDENVV-ISTNRGQPIA-LNGKTRAG 228

Query: 391 NLLVDFSRVLMG 402
               + +R L G
Sbjct: 229 EAFHNIARRLNG 240


>gi|34558174|ref|NP_907989.1| septum site-determining protein MIND cell division inhibitor MIND
           [Wolinella succinogenes DSM 1740]
 gi|34483893|emb|CAE10889.1| SEPTUM SITE-DETERMINING PROTEIN MIND CELL DIVISION INHIBITOR MIND
           [Wolinella succinogenes]
          Length = 268

 Score = 47.0 bits (110), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 65/280 (23%), Positives = 132/280 (47%), Gaps = 31/280 (11%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIAS----VFAME--TLLADLDLPYGTAN-INFDKD 213
           G  I+    +GGVG ST   N A  +A     V A++    L +LD+  G  N I +D  
Sbjct: 2   GIVITVTSGKGGVGKSTTCANIAVGLAQEGKRVVAVDFDIGLRNLDMILGLENRIVYD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYD-FDEKMIVPVLDILE 272
               + D +     + +A ++       +NL  L  PA  S+  +  D++ +  ++D L+
Sbjct: 60  ----VVDVMEGKCNLSQALINDKK---TKNLYFL--PASQSKDKNILDKEKVRALIDALK 110

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL----KKLRPAD 328
           + F  V+LD P       +  + L+D+ +I ++ +++ +R++  +I ++    +K +  D
Sbjct: 111 REFDFVLLDSPAGIEGGFEHAVFLADRALIISTPEVSSVRDADRVIGIIDAKSEKAKQGD 170

Query: 329 K-PPYLVLNQVK---TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVD 384
           +   ++++N++K     +   +SI D    L +    ++P D  V   + NSG+ +    
Sbjct: 171 EVEKHIIINRIKPEMVERGEMMSIDDVLNILALPLIGVVPEDERVVS-ATNSGEPVIYGT 229

Query: 385 PKSAIANLLVDFSRVLMGRVTVS--KPQSAMYTKIKKIFN 422
             S +A   +   R+L   V     K +S + + IK++F+
Sbjct: 230 SISGLAYKRI-AKRILGESVEFPELKSKSGILSAIKRLFS 268


>gi|292571655|gb|ADE29570.1| ATPase involved in chromosome partitioning [Rickettsia prowazekii
           Rp22]
          Length = 255

 Score = 47.0 bits (110), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 83/180 (46%), Gaps = 21/180 (11%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF---DKDPINSISD 220
           IS +  +GGV  +T   N A + ASV   + L+ DLD P G ++  F    +   N+I  
Sbjct: 4   ISIVNQKGGVAKTTTTVNLATAFASV-NKKILVIDLD-PQGNSSTGFGIIQQQRKNTIYQ 61

Query: 221 AIYPVGRIDKAFV-SRLPVFYAENLSILTAPAMLS------RTYDFDEKMIVPVLDILEQ 273
            +  +  +  A + + +P     NL I+T+   LS       T    E +++ +L+ ++ 
Sbjct: 62  VLTNLIELKDAIIATNIP-----NLEIITSNTNLSAAELDLTTLKEREYVLMKLLEEVKI 116

Query: 274 IFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL----KKLRPADK 329
           ++  +I+D P   N  T   L  SD+V+I    D   L    +L+  +    KKL P  K
Sbjct: 117 LYDYIIIDCPPALNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIVEKKLNPKIK 176


>gi|85709473|ref|ZP_01040538.1| ATPase, ParA family protein [Erythrobacter sp. NAP1]
 gi|85688183|gb|EAQ28187.1| ATPase, ParA family protein [Erythrobacter sp. NAP1]
          Length = 243

 Score = 47.0 bits (110), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 73/147 (49%), Gaps = 10/147 (6%)

Query: 162 CSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDP-INSISD 220
            SI+    +GGVG +T A N A+  A++   ETLL DLD   G+  +    DP   S ++
Sbjct: 2   ASIAIYSVKGGVGKTTFAVNLAWCAANISRRETLLWDLDASNGSGFL-LGVDPKKKSTAE 60

Query: 221 AIYPVGRIDKAFVSRLPVFYAENLSILTAPA---MLSRTYDF--DEKMIVPVLDILEQIF 275
           +++ + R     + +    YA NL +L A      L R +D    +K +  + + L + +
Sbjct: 61  SVFDLDRKANKLIRK--TEYA-NLHLLPADESIRTLDRQFDRIGKKKRLAKLAEGLRKDY 117

Query: 276 PLVILDVPHVWNSWTQEVLTLSDKVVI 302
             +I D P V +  + +V+  +D V++
Sbjct: 118 DRIIFDCPPVMSEVSAQVMRAADIVIV 144


>gi|239929204|ref|ZP_04686157.1| septum site-determining protein [Streptomyces ghanaensis ATCC
           14672]
 gi|291437537|ref|ZP_06576927.1| septum site-determining protein [Streptomyces ghanaensis ATCC
           14672]
 gi|291340432|gb|EFE67388.1| septum site-determining protein [Streptomyces ghanaensis ATCC
           14672]
          Length = 417

 Score = 47.0 bits (110), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 73/340 (21%), Positives = 146/340 (42%), Gaps = 41/340 (12%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS--LYRALISNHVSEYLIE 135
           P++++V  ++     + ALE + EV      + VI  T+D S  L++A +       +  
Sbjct: 56  PEVVVVHERIGP---VPALELIREVALRFPAIGVILVTSDASPGLFQAAMDYGARGLVAL 112

Query: 136 PLSVADIINSISAIFT-----PQEEGKGS------SGCSISFIGSRGGVGSSTIAHNCAF 184
           PL   ++ + + A+        +  G GS       G  ++  G++GGVG+ T+      
Sbjct: 113 PLGYEELASRVQAVAQWSAGVRRHLGAGSDVFTGAGGTVVTVSGAKGGVGA-TLTAVQLA 171

Query: 185 SIASVFAMETLLADLDLPYGT----ANINFDKDPIN--SISDAIYPVGRIDKAFVSRLPV 238
             A      T L D+DL  G      ++ F +  ++  +I+D I P    D  F      
Sbjct: 172 LAAQASGRATALVDMDLQTGDIASYLDVQFRRSVVDLAAITD-ISPRVLADAVF------ 224

Query: 239 FYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSD 298
            +   L++L APA   R  D  ++    ++  L   + +V++D     +      + ++D
Sbjct: 225 RHDTGLALLLAPAEGERGEDVTDRAARQIVSTLRSRYEVVVIDCGAQLSGAGAAAVEMAD 284

Query: 299 KVVITTSLDLAGLRNSKNLIDVLKKL--RPADKPPYLVLNQVK-TPKKPEI--SISDFCA 353
             ++ T+ D+  +R +K  + +  +L  R A++   +V    + T  +P +   I+    
Sbjct: 285 TALLVTTPDVIAVRGAKRTVRMWDRLQIRKAEETTVVVNRHTRATEIQPPLIQRITGTAV 344

Query: 354 PLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
                P+      G V     ++G+ +HE++ KSA+   L
Sbjct: 345 AATAVPAGFKELQGVV-----DAGR-VHELESKSAVKQAL 378


>gi|296168241|ref|ZP_06850214.1| conserved hypothetical protein [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295896813|gb|EFG76444.1| conserved hypothetical protein [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 446

 Score = 47.0 bits (110), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 81/168 (48%), Gaps = 11/168 (6%)

Query: 161 GC-SISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSIS 219
           GC  I+ +  +GGVG +TIA     + AS+     +  D +   GT +     +   ++ 
Sbjct: 192 GCYRIALLSLKGGVGKTTIAATMGATFASIRGDRVVAVDANPDRGTLSQKIPLETSATVR 251

Query: 220 DAIYPVGRID-----KAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI 274
             ++  G I+     + + S+ P    E L+  T PA +S  +  D+     VLD+LE+ 
Sbjct: 252 QLLHDAGSIERYSDVRRYTSKGPSGL-EVLASETDPA-VSEAFGADD--YTRVLDVLERF 307

Query: 275 FPLVILDV-PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL 321
           + LV+ D  P + +S    VL  +D +V+ +S  + G R++   +D L
Sbjct: 308 YGLVLTDCGPGLLHSVMSSVLEKADVLVVVSSGSIDGARSASATLDWL 355


>gi|172058120|ref|YP_001814580.1| septum site-determining protein MinD [Exiguobacterium sibiricum
           255-15]
 gi|171990641|gb|ACB61563.1| septum site-determining protein MinD [Exiguobacterium sibiricum
           255-15]
          Length = 282

 Score = 47.0 bits (110), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 63/287 (21%), Positives = 122/287 (42%), Gaps = 28/287 (9%)

Query: 153 QEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI--NF 210
            ++ K   G +I     +GGVG +T   N   ++A +      L D D+     +I    
Sbjct: 9   HKDAKTHVGRAIVVTSGKGGVGKTTTTANIGTALA-LMGHSVCLVDTDIGLRNLDIVLGL 67

Query: 211 DKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVP---- 266
           D   I +I D +    ++ +A V R   F  E + +L  PA  S+    D+  + P    
Sbjct: 68  DNRSIYNIVDVVTGQCKLHQALV-RDKRF--EEMYLL--PAAQSK----DKSSVTPEQVK 118

Query: 267 -VLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
            ++D L+  +  V++D P          +  +D+ VI T+ + A ++++  +I +L++  
Sbjct: 119 GIIDSLKLEYDFVLIDCPAGIEQGFMNAIAGADEAVIVTTPEKAAVQDADRIIGMLER-S 177

Query: 326 PADKPPYLVLNQVKTPKKPE---ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHE 382
                P LV+N+V++        + I +    L I    +I  D  V   S     +   
Sbjct: 178 ERQIVPKLVVNRVRSHMMASGDMLDIDEIMRILSIDLLGLIVDDEEVIAASHRGVPVTMN 237

Query: 383 VDPKSAIANLLVDFSRVLMGRVT-----VSKPQSAMYTKIKKIFNMK 424
            D ++ +     + +R ++G        + +PQ   + K+KK+  MK
Sbjct: 238 PDNRAGLG--YRNITRRILGESVPLLDIMEQPQKGFFVKLKKMLGMK 282


>gi|228993188|ref|ZP_04153109.1| Septum site-determining protein minD [Bacillus pseudomycoides DSM
           12442]
 gi|228999238|ref|ZP_04158818.1| Septum site-determining protein minD [Bacillus mycoides Rock3-17]
 gi|229006785|ref|ZP_04164418.1| Septum site-determining protein minD [Bacillus mycoides Rock1-4]
 gi|228754407|gb|EEM03819.1| Septum site-determining protein minD [Bacillus mycoides Rock1-4]
 gi|228760435|gb|EEM09401.1| Septum site-determining protein minD [Bacillus mycoides Rock3-17]
 gi|228766514|gb|EEM15156.1| Septum site-determining protein minD [Bacillus pseudomycoides DSM
           12442]
          Length = 267

 Score = 46.6 bits (109), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 60/288 (20%), Positives = 125/288 (43%), Gaps = 46/288 (15%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDK- 212
           G +I     +GGVG +T + N   ++A       +   +  L +LD+  G  N I FD  
Sbjct: 2   GEAIVITSGKGGVGKTTTSANIGTALALSGKKVCLIDTDIGLRNLDVVMGLENRIVFDLV 61

Query: 213 DPINS---ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAM------LSRTYDFDEKM 263
           D +     +  A+    R D+ ++  LP     + S +T   M      L + YD+D   
Sbjct: 62  DVVEGRCRLPQALIKDKRFDELYL--LPAAQTSDKSAVTPEQMDELIQLLRQDYDYD--- 116

Query: 264 IVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKK 323
                         +++D P       +  +  +DK ++ T+ +++ +R++  +I +L+K
Sbjct: 117 -------------YILIDCPAGIEQGFKNAVAGADKAIVVTTPEVSSMRDADRIIGLLEK 163

Query: 324 LRPADKPPYLVLNQVKTPKKPE---ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMI 380
                +PP LV+N+V++    E   + + +    L I    ++  D  V   + N+G+ +
Sbjct: 164 --EDIEPPKLVINRVRSHMLHEQDMLDVDEIVRTLSIELLGVVEDDDEVI-RATNTGEPV 220

Query: 381 HEVDPKSAIANLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMK 424
             + P    +    + +R L+G         + + +++TK+K  F ++
Sbjct: 221 A-LQPNGKASLAYRNIARRLLGESVPLQAFGQEKVSVFTKMKNFFGIR 267


>gi|319795780|ref|YP_004157420.1| response regulator receiver protein [Variovorax paradoxus EPS]
 gi|315598243|gb|ADU39309.1| response regulator receiver protein [Variovorax paradoxus EPS]
          Length = 424

 Score = 46.6 bits (109), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 58/137 (42%), Gaps = 12/137 (8%)

Query: 158 GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAME------------TLLADLDLPYGT 205
           GS GC+++ +G+R G+G +T+A + A ++  +                  L DL LP   
Sbjct: 139 GSRGCTLTLLGARAGLGVTTLATSLALTLHDLLTQTPARPPGRVSRHGVALLDLGLPARD 198

Query: 206 ANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIV 265
             +  D     S  D +  + R+D+  +      +   +++L  PA L++  +      V
Sbjct: 199 GLLYLDTQSGFSFVDGVRNLRRLDQTLLHTALAHHGSGVAVLPLPASLTQVREISHADSV 258

Query: 266 PVLDILEQIFPLVILDV 282
            ++  L   F   I D+
Sbjct: 259 ALIKRLSDFFDFQIADL 275


>gi|224499796|ref|ZP_03668145.1| septum site-determining protein MinD [Listeria monocytogenes
           Finland 1988]
          Length = 263

 Score = 46.6 bits (109), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 62/274 (22%), Positives = 124/274 (45%), Gaps = 32/274 (11%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKD 213
           G +I     +GGVG +T   N   ++A       +  M+  L +LD+  G  N I +D  
Sbjct: 2   GEAIVITSGKGGVGKTTSTANLGTALALQGKKVCLIDMDIGLRNLDVVLGLENRIIYD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
               + D +    +I +A +      + + L +L A     +     E+M+    D++ Q
Sbjct: 60  ----LVDVVEGRCKIHQAMIK--DKRFDDLLFLLPAAQTTDKNAVSGEQMV----DLINQ 109

Query: 274 IFP---LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP 330
           + P    +++D P    +  +  +  +DK ++ T+ +++ +R++  +I +L+K     +P
Sbjct: 110 LRPDYDFILIDCPAGIETGYKNAVAGADKAIVVTTPEISAVRDADRIIGLLEK--EDIEP 167

Query: 331 PYLVLNQVKTP---KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS 387
           P L++N+++T        + I +    L I    II  D  V   S+NSG  +  + P +
Sbjct: 168 PKLIINRIRTQMMMNGDVMDIDEITTHLSIELLGIIIDDDEVI-RSSNSGDPVAML-PNN 225

Query: 388 AIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIF 421
             +    + +R ++G    S P  ++ TK   IF
Sbjct: 226 RASQGYRNIARRILGE---SIPLMSIETKKXGIF 256


>gi|90411201|ref|ZP_01219214.1| hypothetical protein P3TCK_06532 [Photobacterium profundum 3TCK]
 gi|90328047|gb|EAS44368.1| hypothetical protein P3TCK_06532 [Photobacterium profundum 3TCK]
          Length = 412

 Score = 46.6 bits (109), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 69/357 (19%), Positives = 148/357 (41%), Gaps = 26/357 (7%)

Query: 60  ITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS 119
           I    + + ++   +S+TPDLI++  K D + +  +L+   +       ++++ D  D  
Sbjct: 52  IASSEVEQNLNQLKESNTPDLILMDGKDDWQVLTVSLKQALKQNSLIPDIVLLVDHADTI 111

Query: 120 LYRALISNHVSEYLIEPL---SVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSS 176
           + R  +   V + L  P     +  +    +AI    ++   + G    FI ++GG+G+S
Sbjct: 112 IMRQALKFGVKDVLTIPFGEEELDQVFFDCAAI----KKNNVTLGKVSVFINAKGGMGAS 167

Query: 177 TIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRL 236
            I+   A  +        +L D D  +G  +     +   ++SDA+     +D+  +  L
Sbjct: 168 IISTTIAHMVTLQHTSPPVLIDTDAQFGCISDLLSTNSKFTLSDALEQTDELDEYALQGL 227

Query: 237 PVFYAENLSILTAPAMLSRTYD---------FDEKMIVPVLDILEQIFPLVILDVPHVWN 287
              +   L  + +     + +D         F++      L  L   F  +I+D+     
Sbjct: 228 LSKHKSGLRFIASRK--DKLFDTIPTHSPLAFNQ-----FLTKLRANFEHIIIDMSRGIE 280

Query: 288 SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY-LVLNQVKTPKKPEI 346
            +T   L+ ++ + I    ++  +R + NLI  +K L   +   + +++N  +  KK EI
Sbjct: 281 KFTLPALSEAEYIFIVVQQNVPAIREAANLIKQIKHLLGVNDNKFKIIVN--RYSKKIEI 338

Query: 347 SISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGR 403
           +  +    L I    +IP D      S N G+++     K  I   + + S  ++ +
Sbjct: 339 TPDEIKKSLHIDELFLIPNDFQSVSASTNLGELLATHSSKQPIIKGMKEISNKILNK 395


>gi|251798394|ref|YP_003013125.1| septum site-determining protein MinD [Paenibacillus sp. JDR-2]
 gi|247546020|gb|ACT03039.1| septum site-determining protein MinD [Paenibacillus sp. JDR-2]
          Length = 263

 Score = 46.6 bits (109), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 113/247 (45%), Gaps = 15/247 (6%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI--NFDKDPINSI 218
           G +I     +GGVG +T + N   ++A +   +  + D D+     ++    +   I  +
Sbjct: 2   GEAIVVTSGKGGVGKTTTSANLGTALA-LLGKKVCMVDTDIGLRNLDVVMGLENRIIYDL 60

Query: 219 SDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLV 278
            D      R+++A +        E L +L A A      D   + +  ++  L++ F  V
Sbjct: 61  IDVAEGRCRLNQALIKDKRF---EELYMLPA-AQTKDKQDVSPEQVRDMVLELKKDFDYV 116

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQV 338
           I+D P       +  +  +D+ ++ T+ + A +R++  +I +L+K +    P  +++N++
Sbjct: 117 IIDCPAGIEHGFRNAIAGADRAIVVTTPENAAVRDADRVIGLLEKEQI---PSKIIINRI 173

Query: 339 KTP--KKPE-ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVD 395
           +    K  E + I + C  L +    I+P D  V   +ANSG+    +DP S  A    +
Sbjct: 174 RQNMVKNGEMLDIDEICQVLAVDLLGIVPDDEKVI-KAANSGEPTV-MDPSSRAAIAYRN 231

Query: 396 FSRVLMG 402
            +R ++G
Sbjct: 232 IARRILG 238


>gi|323341957|ref|ZP_08082190.1| response regulator receiver protein [Erysipelothrix rhusiopathiae
           ATCC 19414]
 gi|322464382|gb|EFY09575.1| response regulator receiver protein [Erysipelothrix rhusiopathiae
           ATCC 19414]
          Length = 412

 Score = 46.2 bits (108), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 47/228 (20%), Positives = 94/228 (41%), Gaps = 5/228 (2%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           I+   S+GGVG +T+A N A  +A    ++  + D DL +G        +  +++++ + 
Sbjct: 140 ITVFSSKGGVGRTTVAMNLAVKLAQK-KLKVAILDFDLEFGEVATAMRIETKDTLAELLQ 198

Query: 224 PVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVP 283
                +   + +    +   +++L AP       +     +  ++  L   +  +I+D  
Sbjct: 199 EQASPNVDTIRKYMAVHPSGVNVLAAPNSPEFADNISVSQVEKIVSSLRSYYDYLIIDTS 258

Query: 284 HVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKK 343
             +N+       LS  ++  T +D+  LR +K  + ++  L   +K   +V  +     K
Sbjct: 259 MGFNNINLSCFDLSSTIIYVTGMDIPTLRRTKKGLSIVTSLAGNEKIKLVVAKEEPGRVK 318

Query: 344 PEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIAN 391
           P+        PL  T    IP+D      + N GK I    P S +A 
Sbjct: 319 PKDVSRVLEFPLWHT----IPYDLKSSIDALNQGKPIAIDSPLSGVAK 362


>gi|15603937|ref|NP_220452.1| SOJ protein (soj) [Rickettsia prowazekii str. Madrid E]
 gi|3860628|emb|CAA14529.1| SOJ PROTEIN (soj) [Rickettsia prowazekii]
          Length = 255

 Score = 46.2 bits (108), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 83/180 (46%), Gaps = 21/180 (11%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF---DKDPINSISD 220
           IS +  +GGV  +T   N A + ASV   + L+ DLD P G ++  F    +   N+I  
Sbjct: 4   ISIVNQKGGVAKTTTTVNLATAFASV-NKKILVIDLD-PQGNSSTGFGIIQQQRKNTIYQ 61

Query: 221 AIYPVGRIDKAFV-SRLPVFYAENLSILTAPAMLS------RTYDFDEKMIVPVLDILEQ 273
            +  +  +  A + + +P     NL I+T+   LS       T    E +++ +L+ ++ 
Sbjct: 62  VLTNLIELKDAIIATNIP-----NLEIITSNTNLSAAELDLTTLKEREYVLMKLLEEVKI 116

Query: 274 IFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL----KKLRPADK 329
           ++  +I+D P   N  T   L  SD+V+I    D   L    +L+  +    KKL P  K
Sbjct: 117 LYDYIIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIVEKKLNPKIK 176


>gi|268609345|ref|ZP_06143072.1| septum site-determining protein MinD [Ruminococcus flavefaciens
           FD-1]
          Length = 245

 Score = 46.2 bits (108), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 49/222 (22%), Positives = 99/222 (44%), Gaps = 21/222 (9%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           I+    +GG G ST+     +++A      TL+ +LD      +I F  +      D  Y
Sbjct: 5   IAITSGKGGTGKSTVCAGLGYTLAKQ-GHRTLIIELDFGLRCLDIMFGVE-----DDIRY 58

Query: 224 PVGRIDKAFVSRL----PVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVI 279
            +G + K   S L    P+  A NL++L AP  L+       + IV +   +++ F  +I
Sbjct: 59  DLGDVLKGKKSALEAIAPIPMASNLNLLCAPKSLTSV---SAEQIVEICRSVKKYFEYII 115

Query: 280 LDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVK 339
           +D     NS   +++  ++ +++ ++ D   +R++  + D        +K   L++N++ 
Sbjct: 116 IDTGAGINSHVFDIVEQANLILVVSTPDPVCIRDASLMSDEF--YNRGNKSQRLIINKIS 173

Query: 340 TPKKPE---ISISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
                E    ++ +    +G+    +IP D   F M+  +GK
Sbjct: 174 KKVIGEALVANLDEIIDKVGVQLIGVIPDD---FKMTVATGK 212


>gi|297202072|ref|ZP_06919469.1| septum site-determining protein [Streptomyces sviceus ATCC 29083]
 gi|197714288|gb|EDY58322.1| septum site-determining protein [Streptomyces sviceus ATCC 29083]
          Length = 416

 Score = 46.2 bits (108), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 72/342 (21%), Positives = 144/342 (42%), Gaps = 45/342 (13%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS--LYRALISNHVSEYLIE 135
           P++++V  ++     + ALE + EV      V VI  T+DV   L++A +       +  
Sbjct: 56  PEVVVVHERIGP---VPALELIREVALRFPAVGVILVTSDVGPGLFQAAMDYGARGLIAL 112

Query: 136 PLSVADIINSISAIFTPQEEGKGSSGCSISFI-----------GSRGGVGSSTIAHNCAF 184
           PL   ++   + A+       +   G +               G++GGVG++T A     
Sbjct: 113 PLGYEELATRVHAVAQWSTGVRRHLGAATDVFTGVGGTVVTVSGAKGGVGATTTA-IQLA 171

Query: 185 SIASVFAMETLLADLDLPYGT----ANINFDKDPIN--SISDAIYPVGRIDKAFVSRLPV 238
             A      T L D+DL  G      ++ F +  ++  +I+D I P    D  F      
Sbjct: 172 LAAQASGRTTALLDMDLQTGDIASYLDVQFRRSVVDLATITD-ISPRVLADAVFA----- 225

Query: 239 FYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSD 298
            +   L++L AP    R  +  E+    ++  L   + +V++D     +     V+ ++D
Sbjct: 226 -HDTGLALLLAPGEGERGEEVTERAARQIVSALRSRYEVVVVDCGAQLSGAGAAVVEMAD 284

Query: 299 KVVITTSLDLAGLRNSKNLIDVLKKL--RPADKPPYLV-----LNQVKTPKKPEISISDF 351
             ++ T+ D+  +R +K  + +  +L  R A++   +V       +++ P   +I+ +  
Sbjct: 285 TALLVTTPDVVAVRGAKRAVRMWDRLQVRKAEETTVVVNRHSRGTEIQPPLIQKITGTGV 344

Query: 352 CAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
            A   + P+      GAV     ++G+ +HE+D K  +   L
Sbjct: 345 AAT--VIPANFKELQGAV-----DAGR-VHELDAKGTVKQAL 378


>gi|332982939|ref|YP_004464380.1| hypothetical protein Mahau_2394 [Mahella australiensis 50-1 BON]
 gi|332700617|gb|AEE97558.1| hypothetical protein Mahau_2394 [Mahella australiensis 50-1 BON]
          Length = 297

 Score = 46.2 bits (108), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 81/176 (46%), Gaps = 3/176 (1%)

Query: 130 SEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASV 189
           SEYL    +V+ +  ++    +  +  +      IS    +GGVG +T+A   A ++ + 
Sbjct: 66  SEYLSTGNTVSKLTATLRKTLSKPKTKRVYKQTIISIWSVKGGVGRTTLAKTLAETLPT- 124

Query: 190 FAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTA 249
             +  L+ DL+   G +++++           +Y   R  +AF + L V +  N+ I+  
Sbjct: 125 -DLNILILDLNFQDGGSDLSYMLHLPVLPHMGMYLKNRTKEAFEANL-VEFRNNIYIMQT 182

Query: 250 PAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTS 305
           P  L+         I  ++D    +F  +I+D+P+  +   Q  L  S+KV++ TS
Sbjct: 183 PPRLNLAEGITPGDIKQMIDYARTMFDFIIIDLPNKEDELVQAALQASNKVLMLTS 238


>gi|237752169|ref|ZP_04582649.1| septum site-determining protein mind cell division inhibitor mind
           [Helicobacter winghamensis ATCC BAA-430]
 gi|229376411|gb|EEO26502.1| septum site-determining protein mind cell division inhibitor mind
           [Helicobacter winghamensis ATCC BAA-430]
          Length = 266

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 106/232 (45%), Gaps = 22/232 (9%)

Query: 160 SGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN----FDKDPI 215
           SGC I+    +GGVG ST   N A  +A     + +  D D+  G  N++     +   +
Sbjct: 2   SGCVITITSGKGGVGKSTTTANLAVGLAQ-LGKKVVAVDFDI--GLRNLDMILGLENRIV 58

Query: 216 NSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYD-FDEKMIVPVLDILEQI 274
             I + +     + +A ++       +NL  L  PA  S+  +  D   +  +++ L++ 
Sbjct: 59  YDIVNVMEGECNLSQALINDKK---TKNLYFL--PASQSKDKNVLDTDKVAGLINKLKEE 113

Query: 275 FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL-----KKLRPADK 329
           F +V+LD P       +  + L+D+ +I ++ +++ +R++  +I ++     K     + 
Sbjct: 114 FDIVLLDSPAGIEGGFEHSIFLADRALIISTPEVSSVRDADRVIGIIDAKSQKAKNGGEV 173

Query: 330 PPYLVLNQVK---TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
             ++++N++K     K   + + D    L +    I+P D  +   S N+G+
Sbjct: 174 QKHIIINRLKPEMVEKGEMLGVEDVLNILALPLIGIVPEDEKIIS-STNTGE 224


>gi|298370403|ref|ZP_06981719.1| septum site-determining protein MinD [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298281863|gb|EFI23352.1| septum site-determining protein MinD [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 270

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 113/242 (46%), Gaps = 33/242 (13%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF----DKDPINSISDAIYP 224
            +GGVG +T + + A  +A +   +T + D D+  G  N++     ++  +  + + I  
Sbjct: 10  GKGGVGKTTTSASIATGLA-LRGHKTAVIDFDV--GLRNLDLIMGCERRVVYDLINVIQG 66

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFD-------EKMIVPVLDILEQIFPL 277
              + +A +        ENL IL A    S+T D D       EK++  + + +   F  
Sbjct: 67  EATLTQALIKDKN---CENLFILPA----SQTRDKDALNRDGVEKIMTELTEKMG--FEY 117

Query: 278 VILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK-KLRPADKPPYLVLN 336
           VI D P          L  +D+ +ITT+ +++ +R+S  ++ +L+ K R A++   +  +
Sbjct: 118 VICDSPAGIEQGALMALYFADEAIITTNPEVSSVRDSDRILGILQSKSRKAEQGGTVKEH 177

Query: 337 QVKTPKKPE-------ISISDFCAPLGITPSAIIPFDGAVFGMSANSGK-MIHEVDPKSA 388
            + T   PE       +S+ D C  L I    +IP    V   ++N+G+ +IH+ D  +A
Sbjct: 178 LLITRYSPERVAKDEMLSVQDICDILRIPLIGVIPESQNVL-QASNAGEPVIHQQDATAA 236

Query: 389 IA 390
            A
Sbjct: 237 EA 238


>gi|7524873|ref|NP_045875.1| septum site-determining protein [Chlorella vulgaris]
 gi|3024135|sp|P56346|MIND_CHLVU RecName: Full=Putative septum site-determining protein minD
 gi|2224467|dbj|BAA57951.1| cell division inhibitor MinD [Chlorella vulgaris]
          Length = 282

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 126/264 (47%), Gaps = 20/264 (7%)

Query: 169 SRGGVGSSTIAHNCAFSIASV-FAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGR 227
            +GGVG +T   N   SIA + + +  + AD+ L      +  +   + +  D +    R
Sbjct: 24  GKGGVGKTTTTANLGMSIARLGYRVALIDADIGLRNLDLLLGLENRVLYTAMDIVEGQCR 83

Query: 228 IDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI-FPLVILDVPHVW 286
           +D+A +        +NL++L A +   + Y+   K +  ++D ++++ F  V++D P   
Sbjct: 84  LDQALIRDK---RWKNLALL-AISKNRQKYNVTRKNMQNLIDSVKELGFQFVLIDCPAGI 139

Query: 287 NSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVK---TPKK 343
           +      +  + + VI T+ ++  +R++  +  +L+          L++N+V+     K 
Sbjct: 140 DVGFINAIASAQEAVIVTTPEITAIRDADRVAGLLEA--NGIYNVKLLVNRVRPDMIQKN 197

Query: 344 PEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK--MIHEVDPKSAIANLLVDFSRVLM 401
             +S+ D    LGI     IP D +V  +S N G+  ++++    S IA    + +R L+
Sbjct: 198 DMMSVRDVQEMLGIPLLGAIPEDTSVI-ISTNKGEPLVLNKKLTLSGIA--FENAARRLI 254

Query: 402 GR----VTVSKPQSAMYTKIKKIF 421
           G+    + ++ PQ  M+ K+++ F
Sbjct: 255 GKQDYFIDLTSPQKGMFQKLQEFF 278


>gi|325263535|ref|ZP_08130269.1| sporulation initiation inhibitor protein Soj [Clostridium sp. D5]
 gi|324031244|gb|EGB92525.1| sporulation initiation inhibitor protein Soj [Clostridium sp. D5]
          Length = 261

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 85/199 (42%), Gaps = 27/199 (13%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPI----NSIS 219
           I F  ++GG G ST   N  + +  +     L+ D D+    +   FD++ +     S  
Sbjct: 7   ICFANNKGGSGKSTTCSNVGYGLTQL-GKNVLMIDGDMQLNLSLSLFDEEQVLAYAQSEK 65

Query: 220 DAIYPVGRID--KAFVSRLPVFYAENLSILTAPAMLS-----------RTYDFDEKMIVP 266
           +    + + D    ++   P    E L ++ +  ++S           R Y    K + P
Sbjct: 66  NLYEGIKQQDDLSGYIVHSPY---EGLDLIPSSTLMSSIEYELFTKWQREYIL-RKCLTP 121

Query: 267 VLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVI---TTSLDLAGLRNSKNLIDVLKK 323
           V D   QI+  +++D P     W   +L  SD+V+I   +T   L GL N    ++ +K+
Sbjct: 122 VRD--SQIYDYILIDAPPTLGGWVMNILCASDEVIIPVESTPWGLFGLGNMFEFLEEVKQ 179

Query: 324 LRPADKPPYLVLNQVKTPK 342
           + P  K   +V+ +V T K
Sbjct: 180 IAPDLKLGGIVITKVDTRK 198


>gi|125624221|ref|YP_001032704.1| hypothetical protein llmg_1409 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|124493029|emb|CAL97992.1| conserved hypothetical protein [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|300071001|gb|ADJ60401.1| hypothetical protein LLNZ_07265 [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 289

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 75/171 (43%), Gaps = 18/171 (10%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRI 228
           ++GGVG +TI +N A+ +  +   + L+AD D      N      P+N   D I P   +
Sbjct: 15  TKGGVGKTTIIYNGAYFLTMLKLKKVLIADFDFQMNLTNRFI---PVNQRKDLIKPENDV 71

Query: 229 DKAFVSRL---PVFYAENLSILTAPAMLSRTYD---------FDEKMIVPVLDILEQIFP 276
              F + +   P+   +NL ++     L    D         +  +     ++ L + + 
Sbjct: 72  LNFFKNDIIPEPILVDDNLWLIPGNPKLEELLDDVKNGKQRNYLLQWYYSNMEKLSEQYD 131

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLD---LAGLRNSKNLIDVLKKL 324
            ++ D  +  N  T  +L +SDKV+    +D   ++ L +  N I+ LKKL
Sbjct: 132 FILFDTHNDHNMITDNILAVSDKVIAIADVDGDSMSMLADEVNHINKLKKL 182


>gi|323495639|ref|ZP_08100710.1| type II secretion system protein Z [Vibrio sinaloensis DSM 21326]
 gi|323319274|gb|EGA72214.1| type II secretion system protein Z [Vibrio sinaloensis DSM 21326]
          Length = 411

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 85/372 (22%), Positives = 156/372 (41%), Gaps = 39/372 (10%)

Query: 67  EAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALIS 126
           E +   + SS  +++IV+   +S  V   +  ++ +  +   VIVIG  + +S  R L +
Sbjct: 56  EIIKKHARSSALEIVIVELN-ESSNVTEDMRRISHLLPNSASVIVIGSEDAISTIRNLKA 114

Query: 127 NHVSEYLIEPLSVADIINSISAIFTPQEE----GKGSSGCSISFIGSRGGVGSSTIAHNC 182
                YL  P+S  ++I+ +  +   ++     GK      ++F G+ GGVG+S +    
Sbjct: 115 MGFY-YLFWPVSKEELIDFVKNVSDNRQRNAGLGKAREAKKVAFWGATGGVGNSLLVAEI 173

Query: 183 AFSIASVFAMETLLADLDLPYGTANI-----NFDKDPINSISDAIYPVGRIDKAFVSRLP 237
           A  ++S      ++ D D   G  +I      F+K  I        P G    A  + L 
Sbjct: 174 ACELSSKKNSSCVVVDHDFVGGNLDILLGLKKFEKKDI--------PPG----ALTANLD 221

Query: 238 VFYAENLSILTAPAMLS----RTYDFDE---KMIVPVL-DILEQIFPLVILDVPHVWNSW 289
             YA N++    P MLS    ++ D  E   K  V  L D L +    +I D+    N  
Sbjct: 222 TSYALNMTQKITP-MLSILSVQSKDLSETQMKEYVRTLSDELSEQTNFLIEDLSRSVNCK 280

Query: 290 --TQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEIS 347
              +      D +VI     +A LR++  +   L++L+   +   +V+N     K   ++
Sbjct: 281 LDLEYSAKECDAIVIALKPTVACLRDASRVCSQLRELQTKAR-IIIVINHTAPEKHATVT 339

Query: 348 ISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVS 407
             +    L        P+DG +   +   GK +H  D K  I+  +   +  L+G  +  
Sbjct: 340 REEIEKYLRRPIDVTCPYDGQM-SKALLEGKHLH--DLKLPISKSINQITAALLGEKS-E 395

Query: 408 KPQSAMYTKIKK 419
             +S+++ K+ K
Sbjct: 396 GGKSSLFAKLLK 407


>gi|307547043|ref|YP_003899522.1| chromosome partitioning protein ParA [Halomonas elongata DSM 2581]
 gi|307219067|emb|CBV44337.1| K03496 chromosome partitioning protein [Halomonas elongata DSM
           2581]
          Length = 256

 Score = 45.8 bits (107), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 82/183 (44%), Gaps = 8/183 (4%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN--FDKDPIN-SISD 220
           I+    +GGVG +T A N A S+A+      LL DLD P G A +    DK  ++ S+ D
Sbjct: 5   IALTNQKGGVGKTTTAVNLAASLAA-LDRRVLLIDLD-PQGHATMGSGVDKHELDGSVLD 62

Query: 221 AIYPVGRIDKAFVSRLPVFYA---ENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
            +    +  +  +      +A    N  +  A   L    +  E+ +V  L+ +   + +
Sbjct: 63  VVLGERKPSEVILDCPEAGFALLPGNGDLTAAEVELLERNEGRERCLVKALEDVAAEYDV 122

Query: 278 VILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQ 337
           V++D P   N  T   LT +D V+I    +   L     L+D +++++ +  P   +   
Sbjct: 123 VLIDCPPSLNMLTVNALTAADGVLIPLQCEFYALEGLSALLDTVEQIKDSVNPQLEIFGI 182

Query: 338 VKT 340
           ++T
Sbjct: 183 LRT 185


>gi|297618668|ref|YP_003706773.1| cell division ATPase MinD [Methanococcus voltae A3]
 gi|297377645|gb|ADI35800.1| cell division ATPase MinD [Methanococcus voltae A3]
          Length = 266

 Score = 45.4 bits (106), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 56/275 (20%), Positives = 125/275 (45%), Gaps = 23/275 (8%)

Query: 155 EGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN--INFDK 212
           + K +    I+ +  +GG G ST++ N AF++ S +  + ++ D D+        +  + 
Sbjct: 5   DSKKNEAIKIAMVSGKGGTGKSTVSANLAFAL-SKYGKDVVIVDTDVNMANLELIVGMEG 63

Query: 213 DPI--NSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDI 270
            PI  NS+       G  D   +++    Y EN+ ++ A   L      +   +  +++ 
Sbjct: 64  MPITLNSVM-----AGNAD---ITQAIYEYTENMRVVPAGVSLDELKFDNSAELEIIIER 115

Query: 271 LEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP 330
           L  +  ++++D P   N     +++ +D V++  + D+  + ++  LI++  KL  +   
Sbjct: 116 LNSMCEVLLIDCPAGLNQDVNSIISSADHVIVVVTPDITSVSDAIKLINLSSKLETSVLG 175

Query: 331 PYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIA 390
              V+N++ T    E++       L +   A +P D  V   +A  G +  +  P+S ++
Sbjct: 176 A--VVNKI-TNDSSELTTKAIETILELPVIASVPEDDTVRANAA-YGILSVQKQPESGLS 231

Query: 391 NLLVDFSRVLMGRVTVSKPQ----SAMYTKIKKIF 421
           N +++ +  L G   +  PQ    S +  K+K++ 
Sbjct: 232 NAIMELAAKLTGNRYI--PQKGSSSTLVDKLKRLL 264


>gi|297157610|gb|ADI07322.1| hypothetical protein SBI_04201 [Streptomyces bingchenggensis BCW-1]
          Length = 596

 Score = 45.4 bits (106), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 52/243 (21%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 158 GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  G  ++  G++GGVG+ T+        A        L D+DL  G      D     S
Sbjct: 147 GPGGKLVAVAGAKGGVGT-TVTAVQLALAAQAAGRRVALVDMDLQSGDIASYLDVQFRRS 205

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
           I+D +  +  I    +      +   L +L AP    R  +  ++    V+  L   F +
Sbjct: 206 IAD-LAQINDITPRVLQEAVFTHQTGLGLLLAPGEGERGEEVSDRAARQVVSALRSRFEV 264

Query: 278 VILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL--RPADKPPYLVL 335
           VI+D      S    V+ ++D  ++ T+ D+  +R +K ++ +  +L  R A+    +V 
Sbjct: 265 VIVDCGTQMTSAGAAVVEIADLALLVTTPDVVAVRAAKRMVRLWDRLQVRKAEDTVTIVN 324

Query: 336 NQVKTPK-KPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLV 394
              ++ + +P++        +  T   ++P        + +SG+M  ++D KSA+   L 
Sbjct: 325 RHTRSAEIQPQLIERATGTRMART---VVPAGFKELQPAVDSGRM-QDLDAKSAVKQALW 380

Query: 395 DFS 397
             +
Sbjct: 381 GLA 383


>gi|255027428|ref|ZP_05299414.1| cell division inhibitor (septum placement) protein MinD [Listeria
           monocytogenes FSL J2-003]
          Length = 238

 Score = 45.4 bits (106), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 105/230 (45%), Gaps = 28/230 (12%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKD 213
           G +I     +GGVG +T   N   ++A       +  M+  L +LD+  G  N I +D  
Sbjct: 2   GEAIVITSGKGGVGKTTSTANLGTALALQGKKVCLIDMDIGLRNLDVVLGLENRIIYD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
               + D +    +I +A +      + + L +L A     +     E+M+    D++ Q
Sbjct: 60  ----LVDVVEGRCKIHQAMIK--DKRFDDLLFLLPAAQTTDKNAVSGEQMV----DLINQ 109

Query: 274 IFP---LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP 330
           + P    +++D P    +  +  +  +DK ++ T+ +++ +R++  +I +L+K     +P
Sbjct: 110 LRPDYDFILIDCPAGIETGYKNAVAGADKAIVVTTPEISAVRDADRIIGLLEK--EDIEP 167

Query: 331 PYLVLNQVKTP---KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
           P L++N+++T        + I +    L I    II  D  V   S+NSG
Sbjct: 168 PKLIINRIRTQMMMNGDVMDIDEITTHLSIELLGIIIDDDEVI-RSSNSG 216


>gi|261380596|ref|ZP_05985169.1| septum site-determining protein MinD [Neisseria subflava NJ9703]
 gi|284796573|gb|EFC51920.1| septum site-determining protein MinD [Neisseria subflava NJ9703]
          Length = 271

 Score = 45.4 bits (106), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 112/243 (46%), Gaps = 34/243 (13%)

Query: 169 SRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTANINFDKDPINSISDAI 222
            +GGVG +T + + A  +A      +V   +  L +LDL  G      ++  +  + + I
Sbjct: 10  GKGGVGKTTTSASIATGLALRGHKTAVIDFDVGLRNLDLIMGC-----ERRVVYDLINVI 64

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI------FP 276
                +++A +        ENL IL A    S+T D D      V ++++++      F 
Sbjct: 65  QGEATLNQALIKDKN---CENLYILPA----SQTRDKDALTREGVDNVMKELASEKMGFE 117

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK-KLRPADKPPYLVL 335
            +I D P          L  +D+ +ITT+ +++ +R+S  ++ +L+ K R A++   +  
Sbjct: 118 FIICDSPAGIEQGALMALYFADEAIITTNPEVSSVRDSDRILGILQSKSRKAEQGGTVKE 177

Query: 336 NQVKTPKKPE-------ISISDFCAPLGITPSAIIPFDGAVFGMSANSGK-MIHEVDPKS 387
           + + T   PE       +S+ D C  L I    +IP    V   ++N+G+ +IH+ +  +
Sbjct: 178 HLLITRYSPERVAKGEMLSVQDICDILRIPLIGVIPESQNVL-QASNAGEPVIHQDNAAA 236

Query: 388 AIA 390
           A A
Sbjct: 237 AEA 239


>gi|225378100|ref|ZP_03755321.1| hypothetical protein ROSEINA2194_03760 [Roseburia inulinivorans DSM
           16841]
 gi|225210101|gb|EEG92455.1| hypothetical protein ROSEINA2194_03760 [Roseburia inulinivorans DSM
           16841]
          Length = 268

 Score = 45.4 bits (106), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 105/225 (46%), Gaps = 23/225 (10%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN----FDKDPINSIS 219
           I+F   +GGVG +T   N    + S+   + +L D D+  G  N++     +   + ++ 
Sbjct: 5   ITFTSGKGGVGKTTTTANVGVGL-SLLEKKVILIDTDI--GLRNLDVVMGLENRIVYNLV 61

Query: 220 DAIYPVGRIDKAFVS--RLPVFYAENLSILTAPAMLSRTYD-FDEKMIVPVLDILEQIFP 276
           D +    R+ +A +   R P     NLS++  P+   R +     + +  +++ L++ + 
Sbjct: 62  DVLTGKCRVKQAVIRDRRYP-----NLSVI--PSACVREHPPITIEAMQTLMEELKESYD 114

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            +++D P   +S     +  +DKVV+ T+  +A + ++  ++ +L+  R  D   YL++N
Sbjct: 115 YILVDSPAGIDSGFDLAVCAADKVVVVTTPQVAAVHDADCVLRLLR--RKKDISTYLLIN 172

Query: 337 QVKTPKKPE---ISISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
             +     E   + ISD C  L      ++  D  +  +S N G+
Sbjct: 173 SFRKQLVKEGNMLQISDICELLNTELLGVVLEDEHII-ISQNHGE 216


>gi|148653947|ref|YP_001281040.1| septum site-determining protein MinD [Psychrobacter sp. PRwf-1]
 gi|148573031|gb|ABQ95090.1| septum site-determining protein MinD [Psychrobacter sp. PRwf-1]
          Length = 270

 Score = 45.4 bits (106), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 76/162 (46%), Gaps = 19/162 (11%)

Query: 169 SRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKDPINSISDA 221
            +GGVG +T + + A  +A       V   +  L +LDL  G  N I +D        D 
Sbjct: 10  GKGGVGKTTTSASFAAGLALRGYKTVVIDFDVGLRNLDLLMGCENRIVYD------FVDV 63

Query: 222 IYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYD-FDEKMIVPVLDILEQIFPLVIL 280
           I    R+ +A V    +   ENL IL  PA  +R  D   ++ +  V+D L + F  +I 
Sbjct: 64  ISGNARLSQALVKDKQL---ENLYIL--PASQTRDKDALTDEGVAEVIDELSKQFDYIIC 118

Query: 281 DVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK 322
           D P       Q  +  +D+ +I T+ +++ +R+S  +I VL+
Sbjct: 119 DSPAGIERGAQLAMYHADEAIIVTNPEISSVRDSDRIIGVLQ 160


>gi|149909545|ref|ZP_01898199.1| ATPases involved in chromosome partitioning [Moritella sp. PE36]
 gi|149807450|gb|EDM67401.1| ATPases involved in chromosome partitioning [Moritella sp. PE36]
          Length = 423

 Score = 45.4 bits (106), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 78/355 (21%), Positives = 153/355 (43%), Gaps = 23/355 (6%)

Query: 76  STPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIE 135
           S+ ++++V+   +S+ V   +E ++ +  +   VIVIG  + +S  R L S     YL  
Sbjct: 76  SSIEIVLVELN-NSKNVSKDMESISHLLPNDASVIVIGSEDAISTIRNLKSMGYY-YLFW 133

Query: 136 PLSVADIINSISAIFTPQEE----GKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFA 191
           P++  ++I+ I ++   ++     G+      I+  GS+GGVG+S +    AF + +   
Sbjct: 134 PITKQELIDFIRSVNDNRKRNSGLGQNRVAKKIAVWGSKGGVGASMLTAEIAFQLTTNKK 193

Query: 192 METLLADLDLPYGTANI-----NFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSI 246
              LL D +   G  +I      F+K  +   S +    G +D AF   +       LS+
Sbjct: 194 STCLLVDHNFSGGNMDILMGLQKFEKRLVQRGSLS----GTLDVAFAMSMTKKVNNMLSL 249

Query: 247 LTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWT--QEVLTLSDKVVITT 304
           L   +      +  E  I+ + + LE+    +I D+    NS    + V   SD +V+  
Sbjct: 250 LALDSDDLNELELKE-YIITLNNELEKQKNFIIEDLSRSANSKQDLRNVAQNSDAMVLVI 308

Query: 305 SLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIP 364
           +  +A +R +  +       + + +  ++VLN     K   ++  +    L      I P
Sbjct: 309 APTVASVREAAKVKAQFTNEKSSAR-FFIVLNYTMVEKNATVTPEEVEKFLRQPIDIICP 367

Query: 365 FDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKK 419
           F+     ++   GK  H    K  +A  L     +L+G   +   + + +T++KK
Sbjct: 368 FEPNSDAITL-EGK--HLFQQKGEMAKSLHRLVSLLVGE-ALENDKPSFFTRLKK 418


>gi|327439520|dbj|BAK15885.1| septum formation inhibitor-activating ATPase [Solibacillus
           silvestris StLB046]
          Length = 294

 Score = 45.4 bits (106), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 92/190 (48%), Gaps = 12/190 (6%)

Query: 154 EEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN---- 209
           +EG  + G +I     +GGVG +T   N   ++A +   +  L D D+  G  N++    
Sbjct: 24  KEGAANVGEAIVITSGKGGVGKTTTTANLGTALA-LQGKKVCLVDTDI--GLRNLDVILG 80

Query: 210 FDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLD 269
            +   I  + D I    +  +A V    V   E L ++ A     +     E+M   ++D
Sbjct: 81  LENRIIYDLVDVIEGRCKTHQALVKDKRV--DERLYLMPAAQNTDKNAINPEQM-KALID 137

Query: 270 ILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADK 329
            L++ F  +++D P       +  +  +D+ ++ T+ +++ +R++  +I +L++  P + 
Sbjct: 138 ELKREFDYILIDCPAGIEQGYRNAVAGADRAIVVTTPEISAVRDADRIIGLLEQ-EPIE- 195

Query: 330 PPYLVLNQVK 339
           PP L++N+++
Sbjct: 196 PPKLIINRIR 205


>gi|224501516|ref|ZP_03669823.1| septum site-determining protein MinD [Listeria monocytogenes FSL
           R2-561]
 gi|328465579|gb|EGF36808.1| septum site-determining protein MinD [Listeria monocytogenes 1816]
          Length = 258

 Score = 45.4 bits (106), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 105/230 (45%), Gaps = 28/230 (12%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKD 213
           G +I     +GGVG +T   N   ++A       +  M+  L +LD+  G  N I +D  
Sbjct: 2   GEAIVITSGKGGVGKTTSTANLGTALALQGKKVCLIDMDIGLRNLDVVLGLENRIIYD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQ 273
               + D +    +I +A +      + + L +L A     +     E+M+    D++ Q
Sbjct: 60  ----LVDVVEGRCKIHQAMIK--DKRFDDLLFLLPAAQTTDKNAVSGEQMV----DLINQ 109

Query: 274 IFP---LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP 330
           + P    +++D P    +  +  +  +DK ++ T+ +++ +R++  +I +L+K     +P
Sbjct: 110 LRPDYDFILIDCPAGIETGYKNAVAGADKAIVVTTPEISAVRDADRIIGLLEK--EDIEP 167

Query: 331 PYLVLNQVKTP---KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
           P L++N+++T        + I +    L I    II  D  V   S+NSG
Sbjct: 168 PKLIINRIRTQMMMNGDVMDIDEITTHLSIELLGIIIDDDEVI-RSSNSG 216


>gi|187923646|ref|YP_001895288.1| pilus assembly protein, CpaE-like protein [Burkholderia
           phytofirmans PsJN]
 gi|187714840|gb|ACD16064.1| putative pilus assembly protein, CpaE-like protein [Burkholderia
           phytofirmans PsJN]
          Length = 413

 Score = 45.4 bits (106), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 70/355 (19%), Positives = 136/355 (38%), Gaps = 23/355 (6%)

Query: 32  HVFCVTDTLYS--VVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDS 89
           HV  + DTL    VVE + +DP M  +  RI              +  P L+ V      
Sbjct: 26  HVHWLADTLVGAGVVEAATLDPSM--LMQRIA-------------ALNPSLVFVDFSGGR 70

Query: 90  REVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAI 149
               SA          G +++ +G   +     A +   V +++       D +     +
Sbjct: 71  AAAASAAANAVRTAYPGMQIVALGSLAEPESALAALRAGVRDFIDLSAPAEDALRITRQV 130

Query: 150 FTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIA---SVFAMETLLADLDLPYGTA 206
                E     G   + +G+R G+G ST+A N A  +    S    +  L DL LP    
Sbjct: 131 LDNLVEPVSRHGRVTALLGARIGMGVSTLAANLAVLLQRRDSAQGRQAALLDLGLPAADG 190

Query: 207 NINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVP 266
           ++  +     +  +A+  + R D+ FV      +   L++ T P  L+   +      + 
Sbjct: 191 SLLLNTRSEFNFVEAVRNLRRFDQTFVHTALSHHTSGLALTTLPPNLADMREVSYSSSIG 250

Query: 267 VLDILEQIFPLVILDVPHVWNS-WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
           +L+ L   F   I+D+    NS +   V+  +D+  +     +A + ++  ++D L++  
Sbjct: 251 LLNRLRAFFDQQIVDLGGFTNSEFIAHVVQAADETWLLCDQGVASIVSAVGVLDALREEG 310

Query: 326 PADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMI 380
                  L++N  K   +  ++ +     L I+    +P      G + N G ++
Sbjct: 311 VETANVRLIVN--KFDAELGLAAAQIAQRLDISLLTALPERRVALGQAVNQGHLL 363


>gi|89068020|ref|ZP_01155437.1| ATPase, putative [Oceanicola granulosus HTCC2516]
 gi|89046259|gb|EAR52316.1| ATPase, putative [Oceanicola granulosus HTCC2516]
          Length = 236

 Score = 45.4 bits (106), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 88/195 (45%), Gaps = 14/195 (7%)

Query: 196 LADLDLPYGTANINFDKDPINSISDAIYPVGRID-KAFVSRLPVFYAENLSILTAPAMLS 254
           L DLDL +G+A+   D     ++ + +     +D ++FV+ L   Y + L +LTAP  L 
Sbjct: 18  LMDLDLQFGSASTYLDLPRREAVFELLTNTDAMDGESFVAALQT-YQDKLHVLTAPTELI 76

Query: 255 RTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNS 314
                  + +  ++D     F  V++D+P     W+Q V+  +        +D   +R++
Sbjct: 77  PLDLISSEDVRKLIDTARANFDYVLIDMPSTMVDWSQSVIEAAHVYFAVLEMD---MRSA 133

Query: 315 KNLIDVLKKLRPADKP---PYLVLNQVKTPKKPEIS----ISDFCAPLGITPSAIIPFDG 367
           +N + + + L+  D P      VLN  + PK  +++    +      LGI+    +P  G
Sbjct: 134 QNTLRIKRALQAEDLPFEKLRFVLN--RAPKFTDLNGKSRVKRLAESLGISIEVQLPDGG 191

Query: 368 AVFGMSANSGKMIHE 382
                +A+ G  + E
Sbjct: 192 RPVMQNADHGTPMAE 206


>gi|319789269|ref|YP_004150902.1| septum site-determining protein MinD [Thermovibrio ammonificans
           HB-1]
 gi|317113771|gb|ADU96261.1| septum site-determining protein MinD [Thermovibrio ammonificans
           HB-1]
          Length = 266

 Score = 45.4 bits (106), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 98/212 (46%), Gaps = 20/212 (9%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIA----SVFAMET--LLADLDLPYGTANINFDKDPINS 217
           I     +GGVG ST+  N A ++A     V A++    L +LDL  G  N     D ++ 
Sbjct: 6   ICVTSGKGGVGKSTVTANVATALALKGYKVVAIDADIGLRNLDLVLGLEN-RIVYDLVHV 64

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
           +   + P    +KA V        +NL +L A     ++    E + V +++ L   F  
Sbjct: 65  VEGVVPP----EKALVKD---KRTKNLYLLPAAQTKDKSAVKPEDL-VKIVEELRDKFDF 116

Query: 278 VILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQ 337
           + +D P       +  +T +D +++  + ++A +R++  +I + + ++ ++  P LV+N+
Sbjct: 117 IFIDSPAGIEEGFKTAVTPADTIIVVANPEMASIRDADRVIGLCEAMQKSE--PKLVINR 174

Query: 338 V---KTPKKPEISISDFCAPLGITPSAIIPFD 366
           +   K  +   + + D    LG+    I+P D
Sbjct: 175 IDPKKVARGEMLDVDDVLQILGLDLIGIVPED 206


>gi|255324189|ref|ZP_05365311.1| conserved hypothetical protein [Corynebacterium tuberculostearicum
           SK141]
 gi|255298705|gb|EET78000.1| conserved hypothetical protein [Corynebacterium tuberculostearicum
           SK141]
          Length = 355

 Score = 45.4 bits (106), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 121 YRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAH 180
           Y A ++ H     I P  V +++ SI+A   PQE   GS+  +I+ +G+ GGVG+ST A 
Sbjct: 89  YEAALACHAESAFIIPAQVKELLASIAAAGAPQEARPGSA--TIAVVGASGGVGTSTFAA 146

Query: 181 NCA 183
             A
Sbjct: 147 ALA 149


>gi|67458509|ref|YP_246133.1| ATPase involved in chromosome partitioning [Rickettsia felis
           URRWXCal2]
 gi|67004042|gb|AAY60968.1| ATPases involved in chromosome partitioning [Rickettsia felis
           URRWXCal2]
          Length = 255

 Score = 45.4 bits (106), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 85/181 (46%), Gaps = 23/181 (12%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF---DKDPINSISD 220
           I+ +  +GGV  +T   N A + A+V   + L+ DLD P G ++  F    +   N+I  
Sbjct: 4   IAIVNQKGGVAKTTTTVNLATAFAAV-NKKILVIDLD-PQGNSSTGFGISQQQRKNTIYQ 61

Query: 221 AIYPVGRIDKAFVSR-LPVFYAENLSILTAPAMLSRTYDFD-------EKMIVPVLDILE 272
            +  + ++  A +S  +P     NL I+T+   LS   + D       E +++ +L+ ++
Sbjct: 62  VLTNLIKLKDAIISTDIP-----NLEIITSNTNLSAA-ELDLTKLKDREYILMKLLEEIK 115

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL----KKLRPAD 328
            ++  VI+D P   N  T   L  SD+V+I    D   L    +L+  +    KKL P  
Sbjct: 116 ILYDYVIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIVEKKLNPKI 175

Query: 329 K 329
           K
Sbjct: 176 K 176


>gi|311741048|ref|ZP_07714873.1| conserved hypothetical protein [Corynebacterium pseudogenitalium
           ATCC 33035]
 gi|311303850|gb|EFQ79928.1| conserved hypothetical protein [Corynebacterium pseudogenitalium
           ATCC 33035]
          Length = 355

 Score = 45.4 bits (106), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 121 YRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIA 179
           Y A ++ H     I P  V +++ SI+A   PQE   GS+  +I+ +G+ GGVG+ST A
Sbjct: 89  YEAALACHAESAFIIPAQVKELLASIAAAGAPQEARPGSA--TIAVVGASGGVGTSTFA 145


>gi|302553850|ref|ZP_07306192.1| septum site-determining protein [Streptomyces viridochromogenes DSM
           40736]
 gi|302471468|gb|EFL34561.1| septum site-determining protein [Streptomyces viridochromogenes DSM
           40736]
          Length = 410

 Score = 45.1 bits (105), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 73/340 (21%), Positives = 146/340 (42%), Gaps = 41/340 (12%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVS--LYRALISNHVSEYLIE 135
           P+++IV  ++     + ALE + EV      V VI  T+D S  L++A +       +  
Sbjct: 56  PEVVIVHERIGP---VPALELIREVALRFPAVGVILVTSDASPGLFQAAMDYGARGLVAL 112

Query: 136 PLSVADIINSISAIF---TPQEEGKGSSG--------CSISFIGSRGGVGSSTIAHNCAF 184
           PLS  ++ + + A+    T      G+ G          ++  G++GGVG +T+      
Sbjct: 113 PLSYEELASRVQAVAQWSTGVRRHLGAGGDVFTGVGGTVVTVSGAKGGVG-ATLTAIQLA 171

Query: 185 SIASVFAMETLLADLDLPYGT----ANINFDKDPIN--SISDAIYPVGRIDKAFVSRLPV 238
             A      T L D+DL  G      ++ F +  ++  +I+D I P    D  F      
Sbjct: 172 LAAQASGRSTALVDMDLQTGDIASYLDVQFRRSVVDLAAITD-ISPRVLADAVF------ 224

Query: 239 FYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSD 298
            +   L++L APA   R  D  ++    ++  L   + +V++D            + ++D
Sbjct: 225 RHDTGLALLLAPAEGERGEDVTDRAARQIVSALRSRYEVVVIDCGAQLGGAGAAAVEMAD 284

Query: 299 KVVITTSLDLAGLRNSKNLIDVLKKL--RPADKPPYLVLNQVK-TPKKPEI--SISDFCA 353
           + ++ T+ D+  +R +K  + +  +L  R A++   +V    + T  +P +   I+    
Sbjct: 285 RALLVTTPDVVAVRGAKRAVRMWDRLQIRKAEETTVVVNRHTRNTEIQPPLIQKITGTAV 344

Query: 354 PLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
              + P+        V     ++G+ +HE++ KS++   L
Sbjct: 345 AATVVPANFKELQSVV-----DAGR-VHELENKSSVKQAL 378


>gi|119897946|ref|YP_933159.1| putative septum site-determining protein [Azoarcus sp. BH72]
 gi|119670359|emb|CAL94272.1| putative septum site-determining protein [Azoarcus sp. BH72]
          Length = 270

 Score = 45.1 bits (105), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 106/229 (46%), Gaps = 25/229 (10%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF----DKDPINSISDAIYP 224
            +GGVG +T +   A  +A +   +T + D D+  G  N++     ++  +  + + I  
Sbjct: 9   GKGGVGKTTTSAAFASGLA-LRGFKTAVIDFDV--GLRNLDLIMGCERRVVYDLVNVING 65

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYD-FDEKMIVPVLDILEQI-FPLVILDV 282
             ++++A +      + +NL IL  PA  +R  D   E  +  VL  LE + F  V+ D 
Sbjct: 66  EAKLNQALIKDK---HCDNLFIL--PASQTRDKDALTEAGVEAVLKELEHMAFDYVVCDS 120

Query: 283 PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL----KKLRPADKP--PYLVLN 336
           P          LT +D+ ++TT+ +++ +R+S  ++ +L    K+ R   +P   +L++ 
Sbjct: 121 PAGIERGAVMALTFADEAIVTTNPEVSSVRDSDRILGILQSKSKRAREGGEPVKEHLLVT 180

Query: 337 QVKTPKKPE----ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIH 381
           +  +PK+ E    +S  D    L +    +IP   +V   S      IH
Sbjct: 181 RY-SPKRVEDGEMLSYKDVQELLRVPLIGVIPESESVLQASNQGTPAIH 228


>gi|282850521|ref|ZP_06259900.1| septum site-determining protein MinD family protein [Veillonella
           parvula ATCC 17745]
 gi|282580014|gb|EFB85418.1| septum site-determining protein MinD family protein [Veillonella
           parvula ATCC 17745]
          Length = 307

 Score = 45.1 bits (105), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 102/242 (42%), Gaps = 25/242 (10%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLAD-------LDLPYGTANINFDKDPIN 216
           I  +  +GGVG +TI   C  S  S      LL D       LDL  G AN     D ++
Sbjct: 5   IGIVSGKGGVGKTTIT-ACLGSALSYAGHRVLLCDGDFGLRDLDLVLGVAN-EIIYDALD 62

Query: 217 SISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFP 276
           +  D  Y    +D A VS      AENL  L A +  +R  D   K    ++  L + + 
Sbjct: 63  ASEDKDY----MDDAVVS-----IAENLDFLPA-SQSARWEDIGRKKYKKLVRRLCEEYD 112

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            +++D P       + +L L ++ ++ T      LRN   +I V ++    D    +  N
Sbjct: 113 YILIDAPAGIGKGIEAILELVNRCIVVTHPLWVSLRNGARMIQVCQEHNIRDYS--IAFN 170

Query: 337 QVKTPKKPEISISDFCAPLGITP-SAIIPFDGAVFGMSANSGKMIHEVDPK-SAIANLLV 394
            V    + +I + D    L      AIIP+D  V   + + G+++  V  +  A+   LV
Sbjct: 171 AVPIDGE-DIHLYDMLEVLRAEYVGAIIPYDEDVLTYTQD-GRLLEFVSSELKAVLAPLV 228

Query: 395 DF 396
           D+
Sbjct: 229 DY 230


>gi|92115408|ref|YP_575336.1| chromosome segregation ATPase [Chromohalobacter salexigens DSM
           3043]
 gi|91798498|gb|ABE60637.1| chromosome segregation ATPase [Chromohalobacter salexigens DSM
           3043]
          Length = 255

 Score = 45.1 bits (105), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 77/182 (42%), Gaps = 7/182 (3%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN--FDKDPINSISDA 221
           I+    +GGVG +T A N A  +A+      LL DLD P G A +    DK  ++     
Sbjct: 5   IALTNQKGGVGKTTTAVNLAACLAA-LDKRVLLVDLD-PQGHATMGSGIDKHELDGSVLE 62

Query: 222 IYPVGRIDKAFVSRLP-VFYA--ENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLV 278
           +   GR     +   P   YA       LTA  +     D  E+ +   L  +   + +V
Sbjct: 63  VLLEGRRASEVILDCPDAGYALLPGNGDLTAAEVDLLDRDGRERCLGEALGSVAASYDVV 122

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQV 338
           I+D P   N  T   LT +D V+I    +   L     L+D +++++ +  P   V   V
Sbjct: 123 IIDCPPSLNMLTVNALTAADGVLIPLQCEFYALEGLSALLDTVEQIQASVNPSLEVFGIV 182

Query: 339 KT 340
           +T
Sbjct: 183 RT 184


>gi|227510175|ref|ZP_03940224.1| septum site determining protein [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
 gi|227513103|ref|ZP_03943152.1| septum site determining protein [Lactobacillus buchneri ATCC 11577]
 gi|227524318|ref|ZP_03954367.1| septum site determining protein [Lactobacillus hilgardii ATCC 8290]
 gi|227083678|gb|EEI18990.1| septum site determining protein [Lactobacillus buchneri ATCC 11577]
 gi|227088549|gb|EEI23861.1| septum site determining protein [Lactobacillus hilgardii ATCC 8290]
 gi|227190380|gb|EEI70447.1| septum site determining protein [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
          Length = 268

 Score = 45.1 bits (105), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 102/217 (47%), Gaps = 15/217 (6%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN----FDKDPINSISDAIYP 224
            +GGVG +T + N   ++A +   +  L DLD+  G  N++     D   +  I D    
Sbjct: 10  GKGGVGKTTSSANIGTALA-MLGKKVCLMDLDI--GLRNLDVVLGLDNRIMYDIVDVASG 66

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH 284
              + +A V      + + L +L A     +T    +  +V +++ ++  F  V++D P 
Sbjct: 67  RASLGQALVK--DKRFDDLLYLLPAAQNTDKTA-LTQDQVVQIVNEIKPDFDYVLIDCPA 123

Query: 285 VWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKP 344
                    +  +D  +I T+ +++ +R++  ++ +L++  P  + P+L++N+++T    
Sbjct: 124 GIEQGFMNAIAGADSAIIVTTPEISAVRDADRVVGLLEQ-HPLQEEPHLIINRIRTHMMK 182

Query: 345 EISISD---FCAPLGITPSAIIPFDGAVFGMSANSGK 378
           + S+ D       LG+    I+  D AV   ++N G+
Sbjct: 183 DGSVMDVDEITHHLGVELLGIVFDDDAVI-TTSNQGE 218


>gi|325673439|ref|ZP_08153130.1| Flp pilus assembly protein ATPase CpaE family protein [Rhodococcus
           equi ATCC 33707]
 gi|325555460|gb|EGD25131.1| Flp pilus assembly protein ATPase CpaE family protein [Rhodococcus
           equi ATCC 33707]
          Length = 399

 Score = 45.1 bits (105), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 65/313 (20%), Positives = 125/313 (39%), Gaps = 21/313 (6%)

Query: 78  PDLIIVQTKVDSREVLSALEPLAEVCDS---GTKVIVIGDTNDVSLYRALISNHVSEYLI 134
           PD++++   V   E LS    LA   D    GT V++  D       RA+ +  V + + 
Sbjct: 49  PDVLVLGPDVPEVEGLS----LAGRIDHSTPGTTVVLASDAGTDVWLRAMRAG-VRDVMS 103

Query: 135 EPLSVADI---INSISAIFTPQEEGKGS-------SGCSISFIGSRGGVGSSTIAHNCAF 184
               +AD+   ++        + +G  +        G  I     +GG G +T+A N A 
Sbjct: 104 PEAEIADVRAVLDRAGQAALARRQGASAPAEQHAVQGKVIVVASPKGGTGKTTVATNLAV 163

Query: 185 SIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENL 244
            +A+     T+L DLD+ +G         P + ++DA+      D   +  +   ++  L
Sbjct: 164 GLAAAAPHSTVLVDLDVQFGDVASALQLVPEHCLTDAVASPASQDMIVLKTVLTPHSTGL 223

Query: 245 SILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITT 304
             L      +       + +  +L  L   F  V++D        T   L L+  VV+ +
Sbjct: 224 HALCGSDSPAAGDSITGEQVSTLLTQLAAEFRYVVVDTAPGLLEHTLAALDLATDVVLVS 283

Query: 305 SLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIP 364
            +D+  +R     + +L +L       ++VLN     ++  +++ D    +G+ P+ I+ 
Sbjct: 284 GMDVPSVRGMHKELQLLTELNLGPVVRHVVLNFAD--RREGLTVQDIQNTIGV-PADIVI 340

Query: 365 FDGAVFGMSANSG 377
                  +S N G
Sbjct: 341 KRSKAVALSTNRG 353


>gi|6978030|gb|AAF34248.1|AF168003_3 putative Soj [Desulfovibrio gigas]
          Length = 243

 Score = 45.1 bits (105), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 93/224 (41%), Gaps = 29/224 (12%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRI 228
           S+GGVG +T A + A  +A +   +TLL D D   G A       P + ++D I      
Sbjct: 3   SKGGVGKTTTAVHLAAGLA-LNNYKTLLVDCDTQ-GQAAFMLGIRPNDGLADLILGDTPP 60

Query: 229 DKAFVSRLPVFYAENLSILTAPAMLSR------TYDF-DEKMIVPVLDILEQIFPLVILD 281
           DKA +        +NL +L+    L++        D+  E  +   L  +E+ F  +ILD
Sbjct: 61  DKAMLKA-----RDNLWLLSGGKSLAKIKRHITRKDYAGENTLAEALRPIERAFQFIILD 115

Query: 282 VPHVWNSWTQEVLTLSDKVVITTSLD---LAGLRNSKNLIDVLKKLRPADKPPYLVLNQV 338
               W+S T  VL  + +++   SL+   + GL         L+K  P     YL+   +
Sbjct: 116 TSPSWDSLTVNVLFYAQELLAPISLEVMSIQGLAEFLRNFAALRKHNPGVTLKYLLPMHL 175

Query: 339 KTPKKPEISISD---------FCAPLGITPSAIIPFDGAVFGMS 373
             P K   +I +          C P+  +P      +   +GM+
Sbjct: 176 SKPSKNSQAILESLEKFYGKYLCTPIRYSPKLA---EAPAYGMT 216


>gi|268679503|ref|YP_003303934.1| septum site-determining protein MinD [Sulfurospirillum deleyianum
           DSM 6946]
 gi|268617534|gb|ACZ11899.1| septum site-determining protein MinD [Sulfurospirillum deleyianum
           DSM 6946]
          Length = 269

 Score = 44.7 bits (104), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 113/234 (48%), Gaps = 30/234 (12%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASV------FAMETLLADLDLPYGTAN-INFDKD 213
           G  I+    +GGVG ST   N A  +A++         +  L +LD+  G  N I +D  
Sbjct: 2   GIVITVTSGKGGVGKSTTTANLAVGLANLGKKVVAIDFDIGLRNLDMILGLENRIVYD-- 59

Query: 214 PINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYD-FDEKMIVPVLDILE 272
               + D +     + +A ++      ++NL  L  PA  ++  D  +++ +  +++ L+
Sbjct: 60  ----VVDVMEGRCNLAQALINDKK---SKNLYFL--PASQTKDKDILNKEKVKALIESLK 110

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL-----KKLRPA 327
           + F +++LD P    S  +  + L+D+ +I ++ D++ +R++  +I ++     K     
Sbjct: 111 ESFDIIMLDSPAGIESGFEHSIFLADRALIVSTPDVSSVRDADRVIGIIDAKSEKAKNGL 170

Query: 328 DKPPYLVLNQVKTPKKPE----ISISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
           +   ++++N++K P+  E    +S+ D  + L +    I+P D  +   S N+G
Sbjct: 171 EVEKHIIINRIK-PEMVEAGNMLSVEDVLSILALPLIGIVPDDEDII-TSTNTG 222


>gi|302669121|ref|YP_003832946.1| partitioning protein ParA2 [Butyrivibrio proteoclasticus B316]
 gi|302397461|gb|ADL36364.1| partitioning protein ParA2 [Butyrivibrio proteoclasticus B316]
          Length = 255

 Score = 44.7 bits (104), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 81/175 (46%), Gaps = 16/175 (9%)

Query: 163 SISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAI 222
           +IS I  +GG G +T A   A+++A+      LL D+D   G  +      P++    ++
Sbjct: 4   TISTINQKGGAGKTTTAIEVAYNLAN-LEKRVLLIDMDSQVGLTHYL----PVDLSKPSM 58

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRT----YDFDEKMIVPVLDILEQI---F 275
           Y V + DK  +  +     + +  + A   LS++     D+D+  I+   DI+E I   +
Sbjct: 59  YNVLKADKKIMDAIQKL--DRIDAIIASEELSKSDKEFVDYDDIFILK--DIIEAIQDDY 114

Query: 276 PLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP 330
             +++D     +     V   SD ++I  SLD   L+  + +   ++KLR   +P
Sbjct: 115 DYIVVDTGPQRSILLNMVYVASDYIIIPNSLDKGSLKGVEKVYKDIEKLRTGKRP 169


>gi|218295626|ref|ZP_03496422.1| septum site-determining protein MinD [Thermus aquaticus Y51MC23]
 gi|218243785|gb|EED10312.1| septum site-determining protein MinD [Thermus aquaticus Y51MC23]
          Length = 267

 Score = 44.7 bits (104), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 54/233 (23%), Positives = 107/233 (45%), Gaps = 35/233 (15%)

Query: 163 SISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYG-TANINFDKDPI 215
           +I     +GGVG +T   N    +A      +V  ++  L +LD+  G    + FD    
Sbjct: 5   AIVVTSGKGGVGKTTTTANLGAGLARLGEKVAVIDVDVGLRNLDVVMGLEGRVVFD---- 60

Query: 216 NSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFD-------EKMIVPVL 268
             + D +    ++ +A +    V   ENL +L A    S+T D +       ++++  +L
Sbjct: 61  --LIDVLEGRAKVRQALIRDKRV---ENLYLLPA----SQTKDKEALDPVRFQELVRHLL 111

Query: 269 DILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPAD 328
           +  E+ F  V++D P       Q   T ++  ++  + ++A +R++  +I +L+     +
Sbjct: 112 E--EEGFDRVLIDSPAGIEKGFQTAATPAEGALVVVNPEVASVRDADRIIGLLEAREIRE 169

Query: 329 KPPYLVLNQVK---TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
              +LV+N+++     +   +S+ D    LG+ P  IIP D  V  +S N G+
Sbjct: 170 N--FLVINRLRPKMVSRGDMLSVEDVVEILGLKPIGIIPEDEQVL-VSTNQGE 219


>gi|291295319|ref|YP_003506717.1| septum site-determining protein MinD [Meiothermus ruber DSM 1279]
 gi|290470278|gb|ADD27697.1| septum site-determining protein MinD [Meiothermus ruber DSM 1279]
          Length = 267

 Score = 44.7 bits (104), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 106/224 (47%), Gaps = 29/224 (12%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN----FDKDPINSISDAIYP 224
            +GGVG +T   N   ++A    +   +A +D+  G  N++     +   +  + D I  
Sbjct: 11  GKGGVGKTTTTANVGAALAR---LGEKVAVVDVDVGLRNLDVVMGLEGRVVYDLIDVIEG 67

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDE------KMIVPVLDILEQIFPLV 278
             ++ +A +    +   E L++L A    S+T D +       + IV  L + E+ F  V
Sbjct: 68  KCKLRQALIRDKRI---EGLALLAA----SQTRDKEALDPEKFRQIVRAL-LEEEGFDRV 119

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQV 338
           ++D P       Q   T ++  ++  + +++ +R++  +I +L+      +  +LV+N++
Sbjct: 120 LIDSPAGIEKGFQTAATPAEGALVVVNPEVSSVRDADRIIGMLEAREI--RENFLVINRL 177

Query: 339 KTPKKPE----ISISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
           + PK  +    +S+ D    LGI P  I+P D  V  +S+N G+
Sbjct: 178 R-PKMVQRGDMLSVEDVVEILGIKPIGIVPEDEGVL-ISSNQGE 219


>gi|193212022|ref|YP_001997975.1| cobyrinic acid ac-diamide synthase [Chlorobaculum parvum NCIB 8327]
 gi|193085499|gb|ACF10775.1| Cobyrinic acid ac-diamide synthase [Chlorobaculum parvum NCIB 8327]
          Length = 265

 Score = 44.7 bits (104), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 79/177 (44%), Gaps = 21/177 (11%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISD 220
           G  I+    +GGVG +T A N A SIA +   +TLL D+D P   A   F  +P + I +
Sbjct: 2   GRVIAIANQKGGVGKTTTAVNIAASIA-ISEFKTLLVDID-PQANATSGFGLEPGDEIEN 59

Query: 221 AIYPV----GRIDKA-------FVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLD 269
             Y V    G+I  A       ++  LP     N++++     L    + +  M   +  
Sbjct: 60  TFYHVMVNGGQIRDAIKSSSLEYLDVLP----SNMNLVGMEVELVNMREREYVMQKALKQ 115

Query: 270 ILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLD---LAGLRNSKNLIDVLKK 323
           + +Q +  +I+D P      T   LT +D V+I    +   L GL    N I +++K
Sbjct: 116 VKDQ-YDYIIIDCPPSLGLITLNSLTAADSVLIPVQAEYYALEGLGKLLNTISIVRK 171


>gi|269838035|ref|YP_003320263.1| septum site-determining protein MinD [Sphaerobacter thermophilus
           DSM 20745]
 gi|269787298|gb|ACZ39441.1| septum site-determining protein MinD [Sphaerobacter thermophilus
           DSM 20745]
          Length = 287

 Score = 44.7 bits (104), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 58/281 (20%), Positives = 125/281 (44%), Gaps = 26/281 (9%)

Query: 153 QEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI--NF 210
           +E+ + + G  I+F   +GGVG +T   N   ++A+      +L D D+     +I    
Sbjct: 3   EEQQQTTLGRVITFTSGKGGVGKTTTTANVGAALAA-LGKSVVLIDADIGLRNLDIVLGL 61

Query: 211 DKDPINSISDAIYPVGRIDKAFV--SRLPVFYAENLSILTAPAMLSRTYD-FDEKMIVPV 267
           +   +  + D +    R+ +A +   RL        S+   PA  +R  +    + +  +
Sbjct: 62  ENRIVYDLVDVVEGNCRLRQAMIRDKRLN-------SLHLIPAAQTREKEAVSPQQMKAL 114

Query: 268 LDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPA 327
            D L + F  +++D P       +  +  +D+VV+ T+ +++ +R++  +I +++    A
Sbjct: 115 CDELRRQFDFILIDSPAGIEQGFRNSIAGADEVVVVTNPEVSSVRDADRIIGLVEA---A 171

Query: 328 DKP-PYLVLNQVK---TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEV 383
           + P P L++N++      +   +S+ D    L I    I+P D  +   S N G+    +
Sbjct: 172 ELPTPRLIVNRLNPMLVRRGDMMSVEDVTDILSIPLLGIVPDDETIV-TSTNRGEP-AAL 229

Query: 384 DPKSAIANLLVDFSRVLMGR----VTVSKPQSAMYTKIKKI 420
           DP+S       + +  L G+    + + +P  A    ++ I
Sbjct: 230 DPRSRAGQAFRNIAARLTGQDVPLMVMEEPDGAFRRFLRAI 270


>gi|288575822|ref|ZP_05977666.2| septum site-determining protein MinD [Neisseria mucosa ATCC 25996]
 gi|288566805|gb|EFC88365.1| septum site-determining protein MinD [Neisseria mucosa ATCC 25996]
          Length = 276

 Score = 44.7 bits (104), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 106/235 (45%), Gaps = 34/235 (14%)

Query: 169 SRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTANINFDKDPINSISDAI 222
            +GGVG +T + + A  +A      +V   +  L +LDL  G        D IN I D  
Sbjct: 15  GKGGVGKTTTSASIAAGLALRGHKTAVIDFDVGLRNLDLIMGCER-RVVYDLINVIQDE- 72

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI------FP 276
                +++A +        ENL IL A    S+T D D      V  +++++      F 
Sbjct: 73  ---ATLNQALIKDKN---CENLFILPA----SQTRDKDALTREGVEKVMQELSSDKMGFE 122

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK-KLRPADKPPYLVL 335
            +I D P          L  +D+ ++TT+ +++ +R+S  ++ +L+ K R A++   +  
Sbjct: 123 YIICDSPAGIEQGALMALYFADEAIVTTNPEVSSVRDSDRILGILQSKSRKAEQGGTVKE 182

Query: 336 NQVKTPKKPE-------ISISDFCAPLGITPSAIIPFDGAVFGMSANSGK-MIHE 382
           + + T   PE       +S+ D C  L I    +IP    V   ++N+G+ +IH+
Sbjct: 183 HLLITRYSPERVSKGEMLSVQDICDILRIPLLGVIPESQNVL-QASNAGEPVIHQ 236


>gi|254245565|ref|ZP_04938886.1| Flp pilus assembly protein, ATPase CpaE [Burkholderia cenocepacia
           PC184]
 gi|124870341|gb|EAY62057.1| Flp pilus assembly protein, ATPase CpaE [Burkholderia cenocepacia
           PC184]
          Length = 247

 Score = 44.7 bits (104), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 84/197 (42%), Gaps = 6/197 (3%)

Query: 193 ETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAM 252
           +T L DL LP G   +  +        DA++ + RID+ FV+     +   +++ T PA 
Sbjct: 11  QTALVDLGLPAGDGALFLNTRCEFHFIDAVHNLRRIDRTFVNTALTRHESGVALTTLPAD 70

Query: 253 LSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWN-SWTQEVLTLSDKVVITTSLDLAGL 311
           L    D        +L+     F   I+D+    N  +  ++ + +D+  +     +A +
Sbjct: 71  LGGLRDVSYASCAGLLNRFRAFFDQQIVDLGGFSNREFVAQITSSADEAWLVCDQGVASI 130

Query: 312 RNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFG 371
            ++ +L+  L+          LV+NQ       +++ +     LG++    +P      G
Sbjct: 131 VSAADLLTGLRDAGVETDRIRLVVNQYD--PALDLTPAQIAERLGLSLVGTLPSRRVAIG 188

Query: 372 MSANSGKMI---HEVDP 385
            +AN G++I    E DP
Sbjct: 189 HAANQGRLIVDMAERDP 205


>gi|269798283|ref|YP_003312183.1| cobyrinic acid ac-diamide synthase [Veillonella parvula DSM 2008]
 gi|269094912|gb|ACZ24903.1| Cobyrinic acid ac-diamide synthase [Veillonella parvula DSM 2008]
          Length = 307

 Score = 44.7 bits (104), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 102/242 (42%), Gaps = 25/242 (10%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLAD-------LDLPYGTANINFDKDPIN 216
           I  +  +GGVG +TI   C  S  S      LL D       LDL  G AN     D ++
Sbjct: 5   IGIVSGKGGVGKTTIT-ACLGSALSYAGHRVLLCDGDFGLRDLDLVLGVAN-EIIYDALD 62

Query: 217 SISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFP 276
           +  D  Y    +D A VS      AENL  L A +  +R  D   K    ++  L + + 
Sbjct: 63  ASEDKDY----MDDAVVS-----IAENLDFLPA-SQSARWEDIGRKKYKKLVRRLCEEYD 112

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLN 336
            +++D P       + +L L ++ ++ T      LRN   +I V ++    D    +V N
Sbjct: 113 YILIDAPAGIGKGIEAILELVNRCIVVTHPLWVSLRNGARMIQVCQEHNIRDYA--IVFN 170

Query: 337 QVKTPKKPEISISDFCAPLGITP-SAIIPFDGAVFGMSANSGKMIHEVDPK-SAIANLLV 394
            V    + +I + D    L      A+IP+D  V  +    G+++  V  +  A+   LV
Sbjct: 171 AVPIDGE-DIHLYDMLEVLRAEYVGAMIPYDEDV-QVYTQDGRLLEFVSSELKAVLAPLV 228

Query: 395 DF 396
           D+
Sbjct: 229 DY 230


>gi|294668163|ref|ZP_06733270.1| septum site-determining protein MinD [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291309871|gb|EFE51114.1| septum site-determining protein MinD [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 270

 Score = 44.7 bits (104), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 109/248 (43%), Gaps = 33/248 (13%)

Query: 169 SRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTANINFDKDPINSISDAI 222
            +GGVG +T + + A  +A      +V   +  L +LDL  G      ++  +  + + I
Sbjct: 10  GKGGVGKTTTSASIASGLALRGHKTAVIDFDVGLRNLDLIMGC-----ERRVVYDLINVI 64

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYD-FDEKMIVPVLDIL--EQIFPLVI 279
                +++A +      + + L IL  PA  +R  D   ++ +  VL+ L  E  F  VI
Sbjct: 65  QGEATLNQALIKDK---HCDKLFIL--PASQTRDKDALTKEGVEKVLNTLTGEMGFEFVI 119

Query: 280 LDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQV 338
            D P          L  +D+ ++TT+ +++ +R+S  ++ +L+ K R +++   +  + +
Sbjct: 120 CDSPAGIEQGALMALYFADEAIVTTNPEVSSVRDSDRILGILQSKSRKSEQGGKVKEHLL 179

Query: 339 KTPKKPE-------ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDP------ 385
            T   PE       +S+ D C  L I    +IP    V   S     +IH+ D       
Sbjct: 180 ITRYSPERVEKGEMLSVDDICDILRIPLIGVIPESQNVLQASNAGMPVIHQQDAVAAEAY 239

Query: 386 KSAIANLL 393
           K  IA LL
Sbjct: 240 KDVIARLL 247


>gi|148241536|ref|YP_001226693.1| septum site-determining protein MinD [Synechococcus sp. RCC307]
 gi|147849846|emb|CAK27340.1| Septum site-determining protein MinD [Synechococcus sp. RCC307]
          Length = 272

 Score = 44.7 bits (104), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 121/281 (43%), Gaps = 23/281 (8%)

Query: 158 GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLL-ADLDLPYGTANINFDKDPIN 216
           GSS  +I     +GGVG +T+  N   ++AS      +L AD  L      +  +   + 
Sbjct: 3   GSSTRTILICSGKGGVGKTTLTANLGIALASQGVRTAVLDADFGLRNLDLLLGLENRIVY 62

Query: 217 SISDAIYPVGRIDKAFVSRLPVFYAENLSILTA--PAMLSRTYDFDEKMIVPVLDILEQI 274
           +  + +    R+++A V         NL++L A  P ML      D + IV    +++  
Sbjct: 63  TAQEVLAGNCRLEQAMVKH---KLQPNLALLPAGNPRMLEWLKPEDMQKIV---GLIQPH 116

Query: 275 FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLV 334
           F +V++D P       +     +D+ ++ T+ +++ +R++  +I +L       +P  LV
Sbjct: 117 FDVVLIDAPAGIEDGFKNAAAAADEAIVVTTPEVSAVRDADRVIGLLNTR--GVEPIQLV 174

Query: 335 LNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFG-----MSANSGKMIHEVDPKSAI 389
           LN+V+ PK   +   +      +T    +P  G VF      +S N G+ +      S  
Sbjct: 175 LNRVR-PKM--MQSQEMLGVTDVTDILALPLLGLVFEDEQVIVSTNRGEPLTLNGSSSPA 231

Query: 390 ANLLVDFSRVLMGRVT----VSKPQSAMYTKIKKIFNMKCF 426
           A    + ++ L G        +K +  +  K++++   K F
Sbjct: 232 AIAYRNVAKRLQGEEVPLPDPTKQRRGLRAKMRQLMQTKLF 272


>gi|194099943|ref|YP_002003081.1| MinD [Neisseria gonorrhoeae NCCP11945]
 gi|239997954|ref|ZP_04717878.1| MinD [Neisseria gonorrhoeae 35/02]
 gi|240015068|ref|ZP_04721981.1| MinD [Neisseria gonorrhoeae DGI18]
 gi|240017516|ref|ZP_04724056.1| MinD [Neisseria gonorrhoeae FA6140]
 gi|240081660|ref|ZP_04726203.1| MinD [Neisseria gonorrhoeae FA19]
 gi|240116672|ref|ZP_04730734.1| MinD [Neisseria gonorrhoeae PID18]
 gi|240118894|ref|ZP_04732956.1| MinD [Neisseria gonorrhoeae PID1]
 gi|240122139|ref|ZP_04735101.1| MinD [Neisseria gonorrhoeae PID24-1]
 gi|240124432|ref|ZP_04737388.1| MinD [Neisseria gonorrhoeae PID332]
 gi|240124699|ref|ZP_04737585.1| MinD [Neisseria gonorrhoeae SK-92-679]
 gi|240129108|ref|ZP_04741769.1| MinD [Neisseria gonorrhoeae SK-93-1035]
 gi|254494693|ref|ZP_05107864.1| septum site-determining protein MinD [Neisseria gonorrhoeae 1291]
 gi|260439570|ref|ZP_05793386.1| MinD [Neisseria gonorrhoeae DGI2]
 gi|268593804|ref|ZP_06127971.1| septum site-determining protein minD [Neisseria gonorrhoeae 35/02]
 gi|268597757|ref|ZP_06131924.1| septum site-determining protein minD [Neisseria gonorrhoeae FA19]
 gi|268602339|ref|ZP_06136506.1| septum site-determining protein [Neisseria gonorrhoeae PID18]
 gi|268604603|ref|ZP_06138770.1| septum site-determining protein MinD [Neisseria gonorrhoeae PID1]
 gi|268683060|ref|ZP_06149922.1| septum site-determining protein MinD [Neisseria gonorrhoeae PID332]
 gi|268683273|ref|ZP_06150135.1| septum site-determining protein MinD [Neisseria gonorrhoeae
           SK-92-679]
 gi|268687490|ref|ZP_06154352.1| septum site-determining protein MinD [Neisseria gonorrhoeae
           SK-93-1035]
 gi|291042805|ref|ZP_06568546.1| septum site-determining protein minD [Neisseria gonorrhoeae DGI2]
 gi|293398174|ref|ZP_06642379.1| septum site-determining protein MinD [Neisseria gonorrhoeae F62]
 gi|13560601|gb|AAK30126.1|AF345908_2 MinD [Neisseria gonorrhoeae]
 gi|193935233|gb|ACF31057.1| MinD [Neisseria gonorrhoeae NCCP11945]
 gi|226513733|gb|EEH63078.1| septum site-determining protein MinD [Neisseria gonorrhoeae 1291]
 gi|268547193|gb|EEZ42611.1| septum site-determining protein minD [Neisseria gonorrhoeae 35/02]
 gi|268551545|gb|EEZ46564.1| septum site-determining protein minD [Neisseria gonorrhoeae FA19]
 gi|268586470|gb|EEZ51146.1| septum site-determining protein [Neisseria gonorrhoeae PID18]
 gi|268588734|gb|EEZ53410.1| septum site-determining protein MinD [Neisseria gonorrhoeae PID1]
 gi|268623344|gb|EEZ55744.1| septum site-determining protein MinD [Neisseria gonorrhoeae PID332]
 gi|268623557|gb|EEZ55957.1| septum site-determining protein MinD [Neisseria gonorrhoeae
           SK-92-679]
 gi|268627774|gb|EEZ60174.1| septum site-determining protein MinD [Neisseria gonorrhoeae
           SK-93-1035]
 gi|291013239|gb|EFE05205.1| septum site-determining protein minD [Neisseria gonorrhoeae DGI2]
 gi|291611437|gb|EFF40507.1| septum site-determining protein MinD [Neisseria gonorrhoeae F62]
          Length = 271

 Score = 44.7 bits (104), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 109/233 (46%), Gaps = 30/233 (12%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF----DKDPINSISDAIYP 224
            +GGVG +T + + A  +A +   +T + D D+  G  N++     ++  +  + + I  
Sbjct: 10  GKGGVGKTTTSASIATGLA-LRGYKTAVIDFDV--GLRNLDLIMGCERRVVYDLINVIQG 66

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI------FPLV 278
              +++A +        ENL IL A    S+T D D      V  +++++      F  +
Sbjct: 67  EATLNQALIKDKN---CENLFILPA----SQTRDKDALTREGVEKVMQELSGKKMGFEYI 119

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQ 337
           I D P          L  +D+ ++TT+ +++ +R+S  ++ +L+ K R A++   +  + 
Sbjct: 120 ICDSPAGIEQGALMALYFADEAIVTTNPEVSSVRDSDRILGILQSKSRKAEQGGSVKEHL 179

Query: 338 VKTPKKPE-------ISISDFCAPLGITPSAIIPFDGAVFGMSANSGK-MIHE 382
           + T   PE       +S+ D C  L I    +IP    V   ++NSG+ +IH+
Sbjct: 180 LITRYSPERVAKGEMLSVQDICDILRIPLLGVIPESQNVL-QASNSGEPVIHQ 231


>gi|312139256|ref|YP_004006592.1| flp pilus assembly atpase cpae-like [Rhodococcus equi 103S]
 gi|311888595|emb|CBH47907.1| putative Flp pilus assembly ATPase CpaE-like [Rhodococcus equi
           103S]
          Length = 399

 Score = 44.7 bits (104), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 47/223 (21%), Positives = 90/223 (40%), Gaps = 3/223 (1%)

Query: 155 EGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDP 214
           E     G  I     +GG G +T+A N A  +A+     T+L DLD+ +G         P
Sbjct: 134 EQHAVQGKVIVVASPKGGTGKTTVATNLAVGLAAAAPHSTVLVDLDVQFGDVASALQLVP 193

Query: 215 INSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI 274
            + ++DA+      D   +  +   ++  L  L      +       + +  +L  L   
Sbjct: 194 EHCLTDAVAGPASQDMIVLKTVLTPHSTGLHALCGSDSPAAGDSITGEQVSTLLTQLAAE 253

Query: 275 FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLV 334
           F  V++D        T   L L+  VV+ + +D+  +R     + +L +L       ++V
Sbjct: 254 FRYVVVDTAPGLLEHTLAALDLATDVVLVSGMDVPSVRGMHKELQLLTELNLGPVVRHVV 313

Query: 335 LNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSG 377
           LN     ++  +++ D    +G+ P+ I+        +S N G
Sbjct: 314 LNFAD--RREGLTVQDIQNTIGV-PADIVIKRSKAVALSTNRG 353


>gi|328950598|ref|YP_004367933.1| septum site-determining protein MinD [Marinithermus hydrothermalis
           DSM 14884]
 gi|328450922|gb|AEB11823.1| septum site-determining protein MinD [Marinithermus hydrothermalis
           DSM 14884]
          Length = 267

 Score = 44.7 bits (104), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 60/253 (23%), Positives = 115/253 (45%), Gaps = 28/253 (11%)

Query: 163 SISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYG-TANINFDKDPI 215
           +I     +GGVG +T   N   ++A      +V  ++  L +LD+  G    + FD    
Sbjct: 5   AIVVTSGKGGVGKTTTTANVGTALARLGEKVAVIDVDVGLRNLDVVMGLEGRVVFD---- 60

Query: 216 NSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYD-FDEKMIVPVLDIL--E 272
             + D +    ++ +A +    V   ENL +L  PA  +R  +  D +    V+  L  E
Sbjct: 61  --LIDVLEGRCKLRQALIRDKRV---ENLYLL--PASQTRDKEALDAERFREVVRRLLEE 113

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY 332
           + F  V++D P       Q     +D  ++  + +++ +R++  +I +L+      +  Y
Sbjct: 114 EGFDRVLIDSPAGIERGFQTAAAPADGALVVVNPEVSSVRDADRIIGLLEA--GEVRENY 171

Query: 333 LVLNQVK---TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAI 389
           LV+N+++     +   +S+ D    LG+ P  IIP D  +  +S N G+ +  +   SA 
Sbjct: 172 LVINRLRPDMVRRGDMLSVEDILEILGLRPIGIIPEDEQIL-VSTNVGEPLV-LKNASAA 229

Query: 390 ANLLVDFSRVLMG 402
           A   +D +R + G
Sbjct: 230 AKAFMDTARRIRG 242


>gi|156743348|ref|YP_001433477.1| septum site-determining protein MinD [Roseiflexus castenholzii DSM
           13941]
 gi|156234676|gb|ABU59459.1| septum site-determining protein MinD [Roseiflexus castenholzii DSM
           13941]
          Length = 270

 Score = 44.7 bits (104), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 60/283 (21%), Positives = 116/283 (40%), Gaps = 43/283 (15%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIA------SVFAMETLLADLDLPYGTAN-INFDKDPIN 216
           I+    +GGVG +T   N   ++A      +V   +  L +LD+  G  N I +D     
Sbjct: 5   ITITSGKGGVGKTTSTANLGTALALQGLKVAVVDADIGLRNLDVVLGLENRIVYD----- 59

Query: 217 SISDAIYPVGRIDKAFVSR--------LPVFYAENLSILTAPAMLSRTYDFDEKMIVPVL 268
            + D +    R+ +A +          LP     +   +TA  M++ T            
Sbjct: 60  -LVDVVEGRCRLRQALIKDKHFPDLCLLPAAQTRDKDAVTADDMIALTNQ---------- 108

Query: 269 DILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPAD 328
             L   F  V++D P    +  +  +  +D+V+I T+ ++A +R++  +I +++      
Sbjct: 109 --LRAEFDYVLIDSPAGIEAGFRNAIAGADEVLIVTTPEVAAVRDADRIIGLVEAFEKG- 165

Query: 329 KPPYLVLNQVK---TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDP 385
             P L++N++K     +   +SI D    L I    ++P D  +   S N G+ +  +D 
Sbjct: 166 -HPRLIINRLKPRMVSRGEMMSIDDVLQILAIDLIGVVPDDEQIV-TSTNRGE-VAVLDR 222

Query: 386 KSAIANLLVDFSRVLMGR---VTVSKPQSAMYTKIKKIFNMKC 425
            S       + +R L G    +TV      +  +I   F ++ 
Sbjct: 223 SSRAGRAFAEIARRLAGEDVPITVFDDSPGLLNRIFGAFGIRA 265


>gi|240113938|ref|ZP_04728428.1| MinD [Neisseria gonorrhoeae MS11]
 gi|268600002|ref|ZP_06134169.1| septum site-determining protein MinD [Neisseria gonorrhoeae MS11]
 gi|268584133|gb|EEZ48809.1| septum site-determining protein MinD [Neisseria gonorrhoeae MS11]
 gi|317165394|gb|ADV08935.1| MinD [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 271

 Score = 44.7 bits (104), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 109/233 (46%), Gaps = 30/233 (12%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF----DKDPINSISDAIYP 224
            +GGVG +T + + A  +A +   +T + D D+  G  N++     ++  +  + + I  
Sbjct: 10  GKGGVGKTTTSASIATGLA-LRGYKTAVIDFDV--GLRNLDLIMGCERRVVYDLINVIQG 66

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI------FPLV 278
              +++A +        ENL IL A    S+T D D      V  +++++      F  +
Sbjct: 67  EATLNQALIKDKN---CENLFILPA----SQTRDKDALTREGVEKVMQELSGKKMGFEYI 119

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQ 337
           I D P          L  +D+ ++TT+ +++ +R+S  ++ +L+ K R A++   +  + 
Sbjct: 120 ICDSPAGIEQGALMALYFADEAIVTTNPEVSSVRDSDRILGILQSKSRKAEQGGSVKEHL 179

Query: 338 VKTPKKPE-------ISISDFCAPLGITPSAIIPFDGAVFGMSANSGK-MIHE 382
           + T   PE       +S+ D C  L I    +IP    V   ++NSG+ +IH+
Sbjct: 180 LITRYSPERVAKGEMLSVQDICDILRIPLLGVIPESQNVL-QASNSGEPVIHQ 231


>gi|225376063|ref|ZP_03753284.1| hypothetical protein ROSEINA2194_01700 [Roseburia inulinivorans DSM
           16841]
 gi|225212083|gb|EEG94437.1| hypothetical protein ROSEINA2194_01700 [Roseburia inulinivorans DSM
           16841]
          Length = 264

 Score = 44.3 bits (103), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 81/179 (45%), Gaps = 21/179 (11%)

Query: 160 SGC---SISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPIN 216
           +GC   +I F  ++GG G ST   N AF +AS    + LL D D+    +   FD++ + 
Sbjct: 2   AGCKTKTICFTNNKGGSGKSTTCANLAFELASA-GKKVLLIDGDMQLNLSLSFFDEERVL 60

Query: 217 SISDA----IYPVG--RIDKAFVSRLPVFYAENLSILTAPAMLSR-TYDF-----DEKMI 264
            +++      Y +   R    ++   P    ENL ++ +  ++S+  Y+       E ++
Sbjct: 61  EMAECEENLYYAIKNKRDLSGYIVHTPY---ENLDLIPSSTLMSQIEYELFTMIQREYVL 117

Query: 265 VPVLDIL--EQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL 321
              L  +  ++++  V++D P    +W   +L  +D V++       GL    N+ D L
Sbjct: 118 KKCLRSIYEKELYDYVLIDAPPTLGTWVINILCAADYVIVPVEASPWGLFGLANMFDFL 176


>gi|296840734|ref|ZP_06863334.2| septum site-determining protein MinD [Neisseria polysaccharea ATCC
           43768]
 gi|296840104|gb|EFH24042.1| septum site-determining protein MinD [Neisseria polysaccharea ATCC
           43768]
          Length = 280

 Score = 44.3 bits (103), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 109/233 (46%), Gaps = 30/233 (12%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF----DKDPINSISDAIYP 224
            +GGVG +T + + A  +A +   +T + D D+  G  N++     ++  +  + + I  
Sbjct: 19  GKGGVGKTTTSASIATGLA-LRGYKTAVIDFDV--GLRNLDLIMGCERRVVYDLINVIQG 75

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI------FPLV 278
              +++A +        ENL IL A    S+T D D      V  +++++      F  +
Sbjct: 76  EATLNQALIKDKN---CENLFILPA----SQTRDKDALTREGVEKVMQELSGKKMGFEYI 128

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQ 337
           I D P          L  +D+ ++TT+ +++ +R+S  ++ +L+ K R A++   +  + 
Sbjct: 129 ICDSPAGIEQGALMALYFADEAIVTTNPEVSSVRDSDRILGILQSKSRKAEQGGSVKEHL 188

Query: 338 VKTPKKPE-------ISISDFCAPLGITPSAIIPFDGAVFGMSANSGK-MIHE 382
           + T   PE       +S+ D C  L I    +IP    V   ++NSG+ +IH+
Sbjct: 189 LITRYSPERVAKGEMLSVQDICDILRIPLLGVIPESQNVL-QASNSGEPVIHQ 240


>gi|320162209|ref|YP_004175434.1| putative response regulator receiver protein [Anaerolinea
           thermophila UNI-1]
 gi|319996063|dbj|BAJ64834.1| putative response regulator receiver protein [Anaerolinea
           thermophila UNI-1]
          Length = 410

 Score = 44.3 bits (103), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 71/350 (20%), Positives = 148/350 (42%), Gaps = 24/350 (6%)

Query: 67  EAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALIS 126
           EA+   S++  PD+++V+  +   + +S  E +     +   +IV  D +  ++ RAL  
Sbjct: 43  EALEMVSETK-PDVMLVEEHLPDIDGISFTEIIRRDYPATQVIIVSQDKHYDTVLRAL-R 100

Query: 127 NHVSEYLIEPLSVADIINSI--------------SAIFTPQEEGK----GSSGCSISFIG 168
           N  S++L   +S+ +   +I              S   T +   +    G     I+   
Sbjct: 101 NGASDFLAHDVSIGEFREAILRASELAARERVSYSPYATVENRSELPELGMRADVITVYS 160

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRI 228
            RGG G++TIA+N A ++    + +  L D  L YG  +I F++    S+ D       +
Sbjct: 161 PRGGSGTTTIANNLALALRDNES-QIALIDACLQYGDVDILFNELGRLSLMDLTPIAYDL 219

Query: 229 DKAFVSRLPVFY-AENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWN 287
           D   V    + + +  L +L AP     +     + I  VL+    ++  ++++     N
Sbjct: 220 DPKVVKECMILHRSSGLYLLAAPKHPVISEALSGEQICRVLEYTRNLYNHMVINTSSYIN 279

Query: 288 SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEIS 347
             T   L L+D +V+  + ++A +++ ++ ++V   L        LV+N+ +   +  ++
Sbjct: 280 ESTLAALDLADLIVLVGTQEIACIKSLRSFLEVWDSLGMKRDRLMLVINKYRA--ESPLT 337

Query: 348 ISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFS 397
                  L       IP D      +AN G  +   +P + I+  + + +
Sbjct: 338 TKKISETLNHPVELFIPEDQESALRAANLGNPLMISNPNADISQAIAELA 387


>gi|212711899|ref|ZP_03320027.1| hypothetical protein PROVALCAL_02974 [Providencia alcalifaciens DSM
           30120]
 gi|212685421|gb|EEB44949.1| hypothetical protein PROVALCAL_02974 [Providencia alcalifaciens DSM
           30120]
          Length = 271

 Score = 44.3 bits (103), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 104/226 (46%), Gaps = 25/226 (11%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF----DKDPINSISDAIYP 224
            +GGVG +T +   A  +A     +T++ D D+  G  N++     ++  +    + I  
Sbjct: 10  GKGGVGKTTSSAAIATGLAQK-GNKTVVIDFDI--GLRNLDLIMGCERRVVYDFVNVIQG 66

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYD-FDEKMIVPVLDIL--EQIFPLVILD 281
              +++A +        ENL IL  PA  +R  D    + +  VLD L  E  F  +I D
Sbjct: 67  DATLNQALIKDK---RTENLYIL--PASQTRDKDALTREGVEKVLDELSNEMAFDFIICD 121

Query: 282 VPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL-KKLRPADK-----PPYLVL 335
            P    S     L  +D+ +ITT+ +++ +R+S  ++ +L  K R A+K       +L+L
Sbjct: 122 SPAGIESGALMALYFADEAIITTNPEVSSVRDSDRILGILSSKSRRAEKGQDPIKEHLLL 181

Query: 336 ---NQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
              N  +  +   +S+ D    L I    +IP D +V   S+N G+
Sbjct: 182 TRYNPGRVTRGDMLSMEDVLEILCIPLIGVIPEDQSVL-RSSNQGE 226


>gi|325294427|ref|YP_004280941.1| septum site-determining protein MinD [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064875|gb|ADY72882.1| septum site-determining protein MinD [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 265

 Score = 44.3 bits (103), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 99/209 (47%), Gaps = 24/209 (11%)

Query: 169 SRGGVGSSTIAHNCAFSIAS----VFAMET--LLADLDLPYGTAN-INFDKDPINSISDA 221
            +GGVG STI  N A ++A+    V A++    L +LDL  G  N I +D   I  +++ 
Sbjct: 11  GKGGVGKSTITGNLATALAAKGYKVVAIDADIGLRNLDLILGLENRIVYD---IVHVAEG 67

Query: 222 IYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILD 281
           + PV   +KA V        +NL +L A     +     E + V +++ L + F  + +D
Sbjct: 68  VCPV---EKALVKDK---RTKNLHLLPAAQTKDKNAISPEDL-VNIVESLREKFDFIFID 120

Query: 282 VPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP-PYLVLNQV-- 338
            P       +  +T +D +++  + ++A +R++  +  + + +    KP P L++N++  
Sbjct: 121 SPAGIEEGFKTAVTPADTILVVANPEMASIRDADRVTGLCETM---GKPEPKLIVNRLDP 177

Query: 339 -KTPKKPEISISDFCAPLGITPSAIIPFD 366
            K  K   +   D    LG+    I+P D
Sbjct: 178 KKVAKGDMLDAEDVVQILGLELIGIVPED 206


>gi|198284412|ref|YP_002220733.1| response regulator receiver domain-containing protein (CheY-like)
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218666628|ref|YP_002427080.1| pilus assembly protein CpaE, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198248933|gb|ACH84526.1| response regulator receiver domain protein (CheY-like)
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218518841|gb|ACK79427.1| pilus assembly protein CpaE, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 409

 Score = 44.3 bits (103), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 101/240 (42%), Gaps = 20/240 (8%)

Query: 176 STIAHNCAFSIASVFAMET-LLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVS 234
           +T+A N A S++++      LL D   P GTA       P  + ++A+  + R DK ++ 
Sbjct: 156 TTLACNLAASLSALHPQSAELLLDFGAPVGTAATYMGIAPRVAFAEAVRNLERCDKTYLD 215

Query: 235 RLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPH-VWNSWTQEV 293
                    L +L   A        +   +  +L I+  I+ LV+ D+   V++  +Q +
Sbjct: 216 TAIAQNTRGLGVLPLFAAARDLRGLNLSEVFQMLAIILSIYHLVVADIGGAVFSEVSQYL 275

Query: 294 LTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISI----- 348
           L  +D++V+     +AG+   K +   L++         +V+N      +P + +     
Sbjct: 276 LQAADEIVVVCDQSVAGILEGKKIAANLREKIGTRLQASVVVNHY----EPALGVDAVHV 331

Query: 349 -SDFCAPL---GITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRV 404
                 PL   GI P   +P   A+     N G +  +  PK A +  +   + +L GR+
Sbjct: 332 GEALGLPLLGQGIVPERRLPLIQAM-----NGGALAVDALPKDAYSRAVQQCAGLLAGRI 386


>gi|319941900|ref|ZP_08016221.1| hypothetical protein HMPREF9464_01440 [Sutterella wadsworthensis
           3_1_45B]
 gi|319804553|gb|EFW01423.1| hypothetical protein HMPREF9464_01440 [Sutterella wadsworthensis
           3_1_45B]
          Length = 389

 Score = 44.3 bits (103), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 53/103 (51%), Gaps = 5/103 (4%)

Query: 89  SREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVA--DIINSI 146
           S +++ A++ LA+  D+GT +I++G  + V  Y  L     ++Y   PL+ A  +I   +
Sbjct: 69  SGDLIEAVKALAKHLDAGTSLILLGRESSVVFYHQLKRAGATDYY--PLTTAPEEIAYGV 126

Query: 147 SAIFTPQEEGKGSSGCS-ISFIGSRGGVGSSTIAHNCAFSIAS 188
            A   PQ+E +   G   I+  G+  G+G+ T A   A  +A 
Sbjct: 127 KASLEPQQEQEAPDGGRVIAVFGAGYGIGAGTTATVLAAELAQ 169


>gi|16760705|ref|NP_456322.1| cell division inhibitor MinD [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29141537|ref|NP_804879.1| cell division inhibitor MinD [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213023063|ref|ZP_03337510.1| cell division inhibitor MinD [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
 gi|213052596|ref|ZP_03345474.1| cell division inhibitor MinD [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213426611|ref|ZP_03359361.1| cell division inhibitor MinD [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213580024|ref|ZP_03361850.1| cell division inhibitor MinD [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213609543|ref|ZP_03369369.1| cell division inhibitor MinD [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213648382|ref|ZP_03378435.1| cell division inhibitor MinD [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|289828972|ref|ZP_06546672.1| cell division inhibitor MinD [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25300129|pir||AH0724 septum site determining protein [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16503002|emb|CAD05498.1| septum site determining protein [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29137164|gb|AAO68728.1| septum site determining protein [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 270

 Score = 44.3 bits (103), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 105/225 (46%), Gaps = 24/225 (10%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF----DKDPINSISDAIYP 224
            +GGVG +T +   A  +A     +T++ D D+  G  N++     ++  +    + I  
Sbjct: 10  GKGGVGKTTSSAAIATGLAQK-GKKTVVIDFDI--GLRNLDLIMGCERRVVYDFVNVIQG 66

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYD-FDEKMIVPVLDILEQI-FPLVILDV 282
              +++A +        ENL IL  PA  +R  D    + +  VLD L+ + F  ++ D 
Sbjct: 67  DATLNQALIKDK---RTENLFIL--PASQTRDKDALTREGVAKVLDSLKAMDFEFIVCDS 121

Query: 283 PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL----KKLRPADKP--PYLVL- 335
           P    +     L  +D+ +ITT+ +++ +R+S  ++ +L    ++    ++P   YL+L 
Sbjct: 122 PAGIETGALMALYFADEAIITTNPEVSSVRDSDRILGILASKSRRAENGEEPIKEYLLLT 181

Query: 336 --NQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
             N  +  K   +S+ D    L I    +IP D +V   ++N G+
Sbjct: 182 RYNPGRVNKGDMLSMEDVLEILRIKLVGVIPEDQSVL-RASNQGE 225


>gi|329943873|ref|ZP_08292144.1| response regulator receiver domain protein [Actinomyces sp. oral
           taxon 170 str. F0386]
 gi|328531579|gb|EGF58415.1| response regulator receiver domain protein [Actinomyces sp. oral
           taxon 170 str. F0386]
          Length = 539

 Score = 44.3 bits (103), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 92/223 (41%), Gaps = 5/223 (2%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISD 220
           G  ++ +G++GGVG+S +A     +        T L DLDL  G         P  S++D
Sbjct: 141 GRVVAVVGAKGGVGTSLLA--LLLARELAHRAPTCLIDLDLRNGDLAAYCGARPRRSVAD 198

Query: 221 AIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVIL 280
            +     I +  +          + +L AP          E  I  V+      +  ++L
Sbjct: 199 LVGVGENIGRRELDEASFPVPGGIMLLAAPKYGEAGEAMGEPQIRRVIQATRYQYAAIVL 258

Query: 281 DVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY-LVLNQVK 339
           D     +      L  +D+V++  + D+  LR ++ L + +++L  A   P  L+LN+V 
Sbjct: 259 DCGSRLDDVQAAALDFADEVLVVATPDIPSLRAARRLHESMERLDIARSTPLSLILNKVD 318

Query: 340 TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHE 382
             +K EI  S      G+  +  IP    +   S N+  ++ +
Sbjct: 319 --RKAEIQPSAAGRLTGLAVAMEIPGAERLLESSMNTATVLEQ 359


>gi|269213695|ref|ZP_05982642.2| septum site-determining protein MinD [Neisseria cinerea ATCC 14685]
 gi|269145518|gb|EEZ71936.1| septum site-determining protein MinD [Neisseria cinerea ATCC 14685]
          Length = 287

 Score = 44.3 bits (103), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 109/233 (46%), Gaps = 30/233 (12%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF----DKDPINSISDAIYP 224
            +GGVG +T + + A  +A +   +T + D D+  G  N++     ++  +  + + I  
Sbjct: 26  GKGGVGKTTTSASIATGLA-LRGYKTAVIDFDV--GLRNLDLIMGCERRVVYDLINVIQG 82

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI------FPLV 278
              +++A +        ENL IL A    S+T D D      V  +++++      F  +
Sbjct: 83  EATLNQALIKDKN---CENLFILPA----SQTRDKDALTREGVEKVMKELGSKKMGFEYI 135

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQ 337
           I D P          L  +D+ ++TT+ +++ +R+S  ++ +L+ K R A++   +  + 
Sbjct: 136 ICDSPAGIEQGALMALYFADEAIVTTNPEVSSVRDSDRILGILQSKSRKAEQGGSVKEHL 195

Query: 338 VKTPKKPE-------ISISDFCAPLGITPSAIIPFDGAVFGMSANSGK-MIHE 382
           + T   PE       +S+ D C  L I    +IP    V   ++NSG+ +IH+
Sbjct: 196 LITRYSPERVAKGEMLSVQDICDILRIPLIGVIPESQNVL-QASNSGEPVIHQ 247


>gi|94967072|ref|YP_589120.1| chromosome segregation ATPase [Candidatus Koribacter versatilis
           Ellin345]
 gi|94549122|gb|ABF39046.1| chromosome segregation ATPase [Candidatus Koribacter versatilis
           Ellin345]
          Length = 273

 Score = 44.3 bits (103), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 80/187 (42%), Gaps = 23/187 (12%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAN--INFDKDPINSI 218
           G  I+    +GGVG +T A N A S+A+   + TLL D D P   A+  + F KDP N +
Sbjct: 2   GKVIAIANQKGGVGKTTTAINLAASLAAA-EVPTLLIDCD-PQSNASSGLGFGKDP-NRL 58

Query: 219 SDAIYPVGRIDKAFVSRLPVFYAENLSILTAPA-----------MLSRTYDFDEKMIVPV 267
           S     +G    + V +      E L ++ A             M  R Y   +      
Sbjct: 59  SSYELLMGTAPASDVLQHTAL--EELQLIPASKNLIGANIELVMMERREYRLRD-----A 111

Query: 268 LDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPA 327
           + +L++ F  +++D P   +  T   L  +D V++    +   L     L+D ++++R +
Sbjct: 112 IQVLKENFEFIVIDCPPALDLLTLNSLVAADSVLVPMQAEYFALEGVSELLDTVERIRES 171

Query: 328 DKPPYLV 334
             P   V
Sbjct: 172 YNPELAV 178


>gi|15615589|ref|NP_243893.1| septum site-determining protein [Bacillus halodurans C-125]
 gi|10175649|dbj|BAB06746.1| septum site-determining protein [Bacillus halodurans C-125]
          Length = 264

 Score = 44.3 bits (103), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 55/272 (20%), Positives = 123/272 (45%), Gaps = 17/272 (6%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI--NFDKDPINSI 218
           G +I     +GGVG +T + N   ++A +   +  L D D+     ++    +   I  +
Sbjct: 2   GEAIVITSGKGGVGKTTTSANIGTALA-LSGKKVCLVDTDIGLRNLDVVMGLENRIIYDL 60

Query: 219 SDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLV 278
            D +    R+ +A +        E L++L A     ++    E+M   +++ L+Q +  V
Sbjct: 61  VDVVEGRCRLKQALIKDKRF---ECLNLLPAAQTKDKSAVTPEQM-KEIVEELKQEYDYV 116

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQV 338
           ++D P       +  +  +DK ++ T+ +++ +R++  +I +L+K     + P LV+N++
Sbjct: 117 LIDCPAGIEQGFKNAVAGADKAIVVTTPEISSVRDADRIIGLLEK--EEVEAPRLVVNRI 174

Query: 339 KTP--KKPE-ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVD 395
           +    K  E + + +  + L I    I+  D  V   S     +    D K+++A    +
Sbjct: 175 RGHMMKNGEMLDVDEIVSILAIELLGIVVDDENVIKFSNKGEPIALHPDSKASVA--YRN 232

Query: 396 FSRVLMGR---VTVSKPQSAMYTKIKKIFNMK 424
            +R ++G    +   + +  +  KIK  F ++
Sbjct: 233 IARRILGETVPLMSFEQEKGVLAKIKSFFGVR 264


>gi|253827084|ref|ZP_04869969.1| septum site-determining protein minD [Helicobacter canadensis MIT
           98-5491]
 gi|253510490|gb|EES89149.1| septum site-determining protein minD [Helicobacter canadensis MIT
           98-5491]
          Length = 266

 Score = 44.3 bits (103), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 49/231 (21%), Positives = 110/231 (47%), Gaps = 20/231 (8%)

Query: 160 SGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN----FDKDPI 215
           SG  I+    +GGVG ST   N A  +A+  A + ++A +D   G  N++     +   +
Sbjct: 2   SGTIITITSGKGGVGKSTTTANLAVGLAN--AGKKVVA-VDFDIGLRNLDMILGLENRIV 58

Query: 216 NSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIF 275
             I + +     + +A ++      A+NL  L A     +T   D++ +  +++ L++ F
Sbjct: 59  YDIVNVMEGECNLSQALINDK---RAKNLYFLPASQSKDKTI-LDKEKVAKLIEKLKEEF 114

Query: 276 PLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL----KKLRPADK-P 330
             ++LD P       +  + L+D+ +I ++ +++ +R++  +I ++    KK +   +  
Sbjct: 115 EYILLDSPAGIEGGFEHSIFLADEALIVSTPEVSSVRDADRVIGIIDAKSKKAQMGQEVK 174

Query: 331 PYLVLNQVK---TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK 378
            ++++N++K     K   + + D    L +    +IP D  +   S N+G+
Sbjct: 175 KHIIINRLKPEMAEKGEMLGVDDVLKILSLPLIGVIPEDEKIVS-STNTGE 224


>gi|148655695|ref|YP_001275900.1| septum site-determining protein MinD [Roseiflexus sp. RS-1]
 gi|148567805|gb|ABQ89950.1| septum site-determining protein MinD [Roseiflexus sp. RS-1]
          Length = 270

 Score = 44.3 bits (103), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 61/275 (22%), Positives = 122/275 (44%), Gaps = 27/275 (9%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETL-LADLDLPYGTANIN----FDKDPINSI 218
           I+    +GGVG +T   N    + +  AM+ L +A +D   G  N++     +   +  +
Sbjct: 5   ITITSGKGGVGKTTSTAN----LGAALAMQGLKVAVVDADIGLRNLDVVLGLENRIVYDL 60

Query: 219 SDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYD-FDEKMIVPVLDILEQIFPL 277
            D +    R+ +A +      +  +L +L  PA  +R  D      ++ + + L   F  
Sbjct: 61  VDVVEGRCRLRQALIKDK---HFPDLCLL--PAAQTRDKDAVTADDMIALANQLRAEFDY 115

Query: 278 VILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP-PYLVLN 336
           V++D P    +  +  +  +D+V+I T+ ++A +R++  +I +++     DK  P L++N
Sbjct: 116 VLIDSPAGIEAGFRNAIAGADEVLIVTTPEVAAVRDADRIIGLVEAF---DKGHPRLIIN 172

Query: 337 QVK---TPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
           ++K     +   +SI D    L I    ++P D  +   S N G+ +  +D  S      
Sbjct: 173 RLKPRMVSRGEMMSIDDVLQILAIDLIGVVPDDEQIV-TSTNRGE-VAVLDRSSRAGRAF 230

Query: 394 VDFSRVLMGR---VTVSKPQSAMYTKIKKIFNMKC 425
            + +R L G    +TV      +  KI   F ++ 
Sbjct: 231 SEIARRLAGEDVPITVFDENPGILNKIFGAFGIRA 265


>gi|90411625|ref|ZP_01219635.1| putative septum site-determining protein MinD [Photobacterium
           profundum 3TCK]
 gi|90327515|gb|EAS43868.1| putative septum site-determining protein MinD [Photobacterium
           profundum 3TCK]
          Length = 270

 Score = 43.9 bits (102), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 105/242 (43%), Gaps = 33/242 (13%)

Query: 169 SRGGVG--SSTIAHNCAFSIA----SVFAMETLLADLDLPYG-TANINFD-KDPIN---S 217
            +GGVG  +S+ A  C  ++A    +V   +  L +LDL  G    + +D  + IN   S
Sbjct: 10  GKGGVGKTTSSAAIACGLALAGKKTAVIDFDIGLRNLDLIMGCERRVVYDFVNVINGEAS 69

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
           ++ A+    R+D  FV  LP     +   LT   +    +D DE             F  
Sbjct: 70  LNQALIKDKRVDNLFV--LPASQTRDKDALTKEGVARILHDLDEMG-----------FEF 116

Query: 278 VILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL----KKLRPADKP--P 331
           VI D P    +     L  +D+ ++TT+ +++ +R+S  ++ +L    ++   A++P   
Sbjct: 117 VICDSPAGIETGALMALYFADEAIVTTNPEVSSVRDSDRILGILDSKSRRAEQAEEPVKQ 176

Query: 332 YLVL---NQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSA 388
           +L+L   N  +      +S+ D    L I    +IP   AV   S     +I + +  + 
Sbjct: 177 HLLLTRYNPARVTNGDMLSVQDVEDILHIPLLGVIPESQAVLNASNKGEPVIFDTESDAG 236

Query: 389 IA 390
           +A
Sbjct: 237 LA 238


>gi|323525747|ref|YP_004227900.1| response regulator receiver protein [Burkholderia sp. CCGE1001]
 gi|323382749|gb|ADX54840.1| response regulator receiver protein [Burkholderia sp. CCGE1001]
          Length = 413

 Score = 43.9 bits (102), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 60/308 (19%), Positives = 116/308 (37%), Gaps = 6/308 (1%)

Query: 106 GTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSIS 165
           G +++  G   +     A +   V +++      AD +     +     E     G   +
Sbjct: 87  GLQIVATGSLAEPESALAALRAGVRDFIDLSAPAADALRITQQVLDNLVEPVSRHGRVTA 146

Query: 166 FIGSRGGVGSSTIAHNCAFSIASVFAM---ETLLADLDLPYGTANINFDKDPINSISDAI 222
            IG+R G+G ST+A N A  +    A    +  L DL LP G   +  +        +A+
Sbjct: 147 LIGARVGMGVSTLATNLAVMLQRRDAQQGRQAALLDLGLPAGDGLLMLNTRSDFHFVEAV 206

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDV 282
             + R D+ FV      +A  L+  T P  L+   +      + +L+ L   F   I+D+
Sbjct: 207 RNLRRFDQTFVHTALSHHASGLAFTTLPPNLADMREISYSSSIGLLNRLRAFFDQQIVDL 266

Query: 283 PHVWN-SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTP 341
               N  +   V+  SD+  +     +A + ++  +++ L++         L++N+    
Sbjct: 267 GGFSNMEFIAHVVRASDEAWLVCDQGVASIVSAVGVLEALREAGADTANVRLIVNRFDAD 326

Query: 342 KKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLM 401
               +  +     L +   A +P      G +AN G ++ +   +      L      L 
Sbjct: 327 LG--LGAAQIAERLDLPLVASLPDRRVALGQTANQGLLLADAAARDPYVRALEPLIERLA 384

Query: 402 GRVTVSKP 409
           G    S P
Sbjct: 385 GPAHASAP 392


>gi|302542851|ref|ZP_07295193.1| putative septum site-determining protein [Streptomyces
           hygroscopicus ATCC 53653]
 gi|302460469|gb|EFL23562.1| putative septum site-determining protein [Streptomyces
           himastatinicus ATCC 53653]
          Length = 583

 Score = 43.9 bits (102), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 100/239 (41%), Gaps = 9/239 (3%)

Query: 158 GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  G  ++  G++GGVG+ T+        A        L DLDL  G      D     S
Sbjct: 147 GPGGTLVAVAGAKGGVGT-TVTAVQLALAARAAGRTVALVDLDLQSGDVASYLDVQFRRS 205

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
           I+D +  +  I    +      +   L +L AP    R  +  ++    V+  L   F L
Sbjct: 206 IAD-LAQITDISPRVLQDAVFTHHTGLGLLLAPGEGERGEEVTDRAARQVVGALRTRFEL 264

Query: 278 VILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL--RPADKPPYLVL 335
           V++D      S    ++  +D  ++ T+ D+  +R +K ++ +  +L  R A++   +V 
Sbjct: 265 VVVDCGTQMTSAGAAIVEQADTALLVTTPDVVAVRAAKRMVRLWDRLQVRKAEETVTVVN 324

Query: 336 NQVKTPK-KPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLL 393
              ++ + +P++        +  T    IP        + +SG+M  ++D KSA+   L
Sbjct: 325 RHTRSAEIQPQLVARATGTAVART---AIPAGFKELQPAVDSGRM-QDLDAKSAVKQAL 379


>gi|206603136|gb|EDZ39616.1| Protein of unknown function [Leptospirillum sp. Group II '5-way
           CG']
          Length = 292

 Score = 43.9 bits (102), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 57/264 (21%), Positives = 115/264 (43%), Gaps = 25/264 (9%)

Query: 155 EGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDP 214
           E K S    IS    +GGVG + +  N A++ +  F  + L+ D D+  G  ++ F+  P
Sbjct: 19  EKKSSPPRIISVTSGKGGVGKTNVTANLAYAFSETFGKKVLVLDADMGLGNMDVLFNLRP 78

Query: 215 INSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKM---IVPVLDIL 271
             ++ D ++     D   +S + V     + IL A + +        +    ++   D L
Sbjct: 79  RWTLRDFLF-----DNRSLSDVLVEGPAGIRILPAASGVEEMTALSPEQNLKLISAFDQL 133

Query: 272 EQIFPLVILDVPHVWNSWTQEVLTL---SDKVVITTSLDLAGLRNSKNLIDVLKKLRPAD 328
           E  F ++++D        ++ VLT    S + +I  + +     ++  L+ VL + R + 
Sbjct: 134 EADFDILLID---TGAGISENVLTFNLASQETLIVVTPEPTSRTDAFALMKVLNR-RYSG 189

Query: 329 KPPYLVLNQVKTPKKPEISISD--------FCAPLGITPSAIIPFDGAVFGMSANSGKMI 380
           KP   + N V+  ++  + + D        F   L ++ +  +P D +V   +  S K +
Sbjct: 190 KPLLFLSNMVRD-RREGLELFDLVSRVADRFLPDLNLSFAGFLPQDPSV-TQAVRSQKAL 247

Query: 381 HEVDPKSAIANLLVDFSRVLMGRV 404
            E+ P +  +  +   +R L+ RV
Sbjct: 248 SEMLPGAPFSAAIRQVARDLLARV 271


>gi|319639587|ref|ZP_07994334.1| septum site-determining protein minD [Neisseria mucosa C102]
 gi|317399158|gb|EFV79832.1| septum site-determining protein minD [Neisseria mucosa C102]
          Length = 271

 Score = 43.9 bits (102), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 113/241 (46%), Gaps = 30/241 (12%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF----DKDPINSISDAIYP 224
            +GGVG +T + + A  +A +   +T + D D+  G  N++     ++  +  + + I  
Sbjct: 10  GKGGVGKTTTSASIATGLA-LRGHKTAVIDFDV--GLRNLDLIMGCERRVVYDLINVIQG 66

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI------FPLV 278
              +++A +        ENL IL A    S+T D D      V  +++++      F  +
Sbjct: 67  EATLNQALIKDKN---CENLYILPA----SQTRDKDALTRDGVDKVMKELSSKKMGFEFI 119

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQ 337
           I D P          L  +D+ +ITT+ +++ +R+S  ++ +L+ K R A++   +  + 
Sbjct: 120 ICDSPAGIEQGALMALYFADEAIITTNPEVSSVRDSDRILGILQSKSRKAEQGGTVKEHL 179

Query: 338 VKTPKKPE-------ISISDFCAPLGITPSAIIPFDGAVFGMSANSGK-MIHEVDPKSAI 389
           + T   PE       +S+ D C  L I    +IP    V   ++N+G+ +IH+ +  +A 
Sbjct: 180 LITRYSPERVAKGEMLSVQDICDILRIPLIGVIPESQNVL-QASNAGEPVIHQDNAAAAE 238

Query: 390 A 390
           A
Sbjct: 239 A 239


>gi|260893382|ref|YP_003239479.1| septum site-determining protein MinD [Ammonifex degensii KC4]
 gi|260865523|gb|ACX52629.1| septum site-determining protein MinD [Ammonifex degensii KC4]
          Length = 264

 Score = 43.9 bits (102), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 56/248 (22%), Positives = 109/248 (43%), Gaps = 16/248 (6%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI--NFDKDPINSI 218
           G +I     +GGVG +T   N    +  +   +  L D D+     ++    +   +  +
Sbjct: 2   GEAIVITSGKGGVGKTTATANIGAGLV-LLGHKVALVDADIGLRNLDVVLGLENRIVYDL 60

Query: 219 SDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLV 278
            D  +   R+ +A + R   F  E L +L A     +T    E+M   +   L++ F  V
Sbjct: 61  VDVAHGHCRLKQALI-RDKRF--EGLYLLPAAQTKDKTAVKPEQM-REICQQLKEEFDYV 116

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQV 338
           I+D P       +  +  +DK ++ T+ ++A +R++  +I +L+        P LV+N++
Sbjct: 117 IVDCPAGIEQGFKNAIAGADKAIVVTTPEVAAVRDADRVIGLLEA--AGLNEPKLVINRL 174

Query: 339 KTPKKPE----ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLV 394
           + PK       + I D    L +    ++P D  +  +S N G+ I + +  S  A    
Sbjct: 175 R-PKMVRQGDMMDIEDILDILAVDLLGVVPEDERII-VSTNRGEPIVQ-ERNSLAAEAFR 231

Query: 395 DFSRVLMG 402
           + SR ++G
Sbjct: 232 NISRRILG 239


>gi|54308271|ref|YP_129291.1| putative septum site-determining protein MinD [Photobacterium
           profundum SS9]
 gi|46912699|emb|CAG19489.1| putative septum site-determining protein MinD [Photobacterium
           profundum SS9]
          Length = 270

 Score = 43.9 bits (102), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 105/242 (43%), Gaps = 33/242 (13%)

Query: 169 SRGGVG--SSTIAHNCAFSIA----SVFAMETLLADLDLPYG-TANINFD-KDPIN---S 217
            +GGVG  +S+ A  C  ++A    +V   +  L +LDL  G    + +D  + IN   S
Sbjct: 10  GKGGVGKTTSSAAIACGLALAGKKTAVIDFDIGLRNLDLIMGCERRVVYDFVNVINGEAS 69

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
           ++ A+    R+D  FV  LP     +   LT   +    +D DE             F  
Sbjct: 70  LNQALIKDKRVDNLFV--LPASQTRDKDALTKEGVARILHDLDEMG-----------FEF 116

Query: 278 VILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL----KKLRPADKP--P 331
           VI D P    +     L  +D+ ++TT+ +++ +R+S  ++ +L    ++   A++P   
Sbjct: 117 VICDSPAGIETGALMALYFADEAIVTTNPEVSSVRDSDRILGILDSKSRRAEQAEEPVKQ 176

Query: 332 YLVL---NQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSA 388
           +L+L   N  +      +S+ D    L I    +IP   AV   S     +I + +  + 
Sbjct: 177 HLLLTRYNPARVASGDMLSVQDVEDILHIPLLGVIPESQAVLNASNKGEPVIFDTESDAG 236

Query: 389 IA 390
           +A
Sbjct: 237 LA 238


>gi|78185419|ref|YP_377854.1| septum site-determining protein MinD [Synechococcus sp. CC9902]
 gi|78169713|gb|ABB26810.1| septum site-determining protein MinD [Synechococcus sp. CC9902]
          Length = 270

 Score = 43.9 bits (102), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 64/280 (22%), Positives = 120/280 (42%), Gaps = 23/280 (8%)

Query: 159 SSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLL-ADLDLPYGTANINFDKDPINS 217
           S+  +I     +GGVG +T   N   ++A + A   +L AD  L      +  +   + +
Sbjct: 2   STTRTILICSGKGGVGKTTTTANLGIALARLGARTVVLDADFGLRNLDLLLGLENRIVFT 61

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTA--PAMLSRTYDFDEKMIVPVLDILEQIF 275
             + +    R+++A V         NL++L A  P ML      D K IV    +LE+ F
Sbjct: 62  AQEVLAETCRLEQALVKH---KQEPNLALLPAGNPRMLEWLTPKDMKAIV---SLLEEQF 115

Query: 276 PLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVL 335
             V++D P       +     + + V+ T+ ++A +R++  +I +L        P  LVL
Sbjct: 116 DYVLIDCPAGIEDGFKNAAAAAREAVVVTTPEVAAVRDADRVIGLLNT--QGVTPVQLVL 173

Query: 336 NQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFG-----MSANSGKMIHEVDPKSAIA 390
           N+V+ PK   +S  +      +T    +P  G VF      +S N G+ +   +  S  A
Sbjct: 174 NRVR-PKM--MSNQEMLTVDDVTDILALPLLGLVFEDEQVIVSTNRGEPLTLGESGSPAA 230

Query: 391 NLLVDFSRVLMGR----VTVSKPQSAMYTKIKKIFNMKCF 426
               + +R L G     +  S+ +     +++++   + F
Sbjct: 231 RAYNNIARRLQGEDIPLMDPSEARKGFRARVRQLMQTRLF 270


>gi|331268118|ref|YP_004347767.1| septum-site determining protein [Chlorella variabilis]
 gi|325296295|gb|ADZ05015.1| septum-site determining protein [Chlorella variabilis]
          Length = 300

 Score = 43.9 bits (102), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 125/264 (47%), Gaps = 20/264 (7%)

Query: 169 SRGGVGSSTIAHNCAFSIASV-FAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGR 227
            +GGVG +T   N   SIA + + +  + AD+ L      +  +   + +  D +    R
Sbjct: 42  GKGGVGKTTTTANLGMSIARLGYRVALIDADIGLRNLDLLLGLENRVLYTAMDIVEGQCR 101

Query: 228 IDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI-FPLVILDVPHVW 286
           +D+A +        +NL++L A +   + Y+   K +  ++D ++++ F  +++D P   
Sbjct: 102 LDQALIRDK---RWKNLALL-AISKNRQKYNVTRKNMQNLIDSVKELGFHFILIDCPAGI 157

Query: 287 NSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVK---TPKK 343
           +      +  + + VI T+ ++  +R++  +  +L+          L++N+V+     K 
Sbjct: 158 DVGFINAIAPAQEAVIVTTPEITAIRDADRVAGLLEA--NGIYNVKLIVNRVRPDMIQKN 215

Query: 344 PEISISDFCAPLGITPSAIIPFDGAVFGMSANSGK--MIHEVDPKSAIANLLVDFSRVLM 401
             +S+ D    LGI     IP D  V  +S N G+  ++++    S IA    + +R L+
Sbjct: 216 DMMSVRDVQEMLGIPLLGAIPEDTNVI-ISTNRGEPLVLNKKLTLSGIA--FENAARRLI 272

Query: 402 GR----VTVSKPQSAMYTKIKKIF 421
           G+    + ++ PQ  M+ K+++ F
Sbjct: 273 GKQDYFIDLTSPQKGMFQKLQEFF 296


>gi|189501007|ref|YP_001960477.1| Cobyrinic acid ac-diamide synthase [Chlorobium phaeobacteroides
           BS1]
 gi|189496448|gb|ACE04996.1| Cobyrinic acid ac-diamide synthase [Chlorobium phaeobacteroides
           BS1]
          Length = 265

 Score = 43.9 bits (102), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 80/177 (45%), Gaps = 21/177 (11%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISD 220
           G  I+    +GGVG +T A N A SIA +   +TLL D+D P   A   F  D  + I +
Sbjct: 2   GRVIAIANQKGGVGKTTTAVNIAASIA-ISEFKTLLIDID-PQANATSGFGLDTEDEIEN 59

Query: 221 AIYPV----GRIDKA-------FVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLD 269
             Y V    G I++A       ++  LP     N++++     L    +  E ++   L+
Sbjct: 60  TFYHVMVQGGDINEAIRSSSLEYLDVLP----SNVNLVGMEVELVNMRE-REYVMQKALE 114

Query: 270 ILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLD---LAGLRNSKNLIDVLKK 323
            + + +  +I+D P      T   LT +D V+I    +   L GL    N I +++K
Sbjct: 115 KVREKYDYIIIDCPPSLGLITLNSLTAADSVLIPVQAEYYALEGLGKLLNTISIVRK 171


>gi|157964124|ref|YP_001498948.1| ATPase involved in chromosome partitioning [Rickettsia massiliae
           MTU5]
 gi|157843900|gb|ABV84401.1| ATPase involved in chromosome partitioning [Rickettsia massiliae
           MTU5]
          Length = 255

 Score = 43.9 bits (102), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 84/181 (46%), Gaps = 23/181 (12%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF---DKDPINSISD 220
           I+ +  +GGV  +T   N A + A+V   + L+ DLD P G ++  F    +   N+I  
Sbjct: 4   IAIVNQKGGVAKTTTTVNLATAFAAV-NKKILVIDLD-PQGNSSTGFGISQQQRKNTIYQ 61

Query: 221 AIYPVGRIDKAFVSR-LPVFYAENLSILTAPAMLSRTYDFD-------EKMIVPVLDILE 272
            +  +  +  A +S  +P     NL I+T+   LS   + D       E +++ +L+ ++
Sbjct: 62  VLTNLIELKDAIISTDIP-----NLEIITSNTNLSAA-ELDLTKLKDREYILMKLLEEIK 115

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL----KKLRPAD 328
            ++  +I+D P   N  T   L  SD+V+I    D   L    +L+  +    KKL P  
Sbjct: 116 ILYDYIIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIVEKKLNPKI 175

Query: 329 K 329
           K
Sbjct: 176 K 176


>gi|153871618|ref|ZP_02000743.1| SpoOJ regulator protein [Beggiatoa sp. PS]
 gi|152071916|gb|EDN69257.1| SpoOJ regulator protein [Beggiatoa sp. PS]
          Length = 444

 Score = 43.9 bits (102), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 92/195 (47%), Gaps = 30/195 (15%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLD----LPYGTANINF---DKDPIN 216
           I+   ++GGVG +T   N A + +     + L+ DLD      + T  +NF   +KD + 
Sbjct: 164 IAVYHNKGGVGKTTTVVNLAATFSKA-GKKVLVIDLDSQANTTFATGLLNFGDEEKDDLK 222

Query: 217 ------------SISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMI 264
                       SIS+ + P  R     +  +P     +++++T    L++  DF ++++
Sbjct: 223 DNYVYHVLCDDASISEVLKP-SRFSSHEIDVVP----SHINLMTKETDLNQ-LDFTKRIL 276

Query: 265 VPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDL---AGLRNSKNLIDVL 321
           +  L+ +E  + +V++D P   N + +  L  +D ++I + L      GL N K+ I  +
Sbjct: 277 LEKLEEVEDKYDIVLIDTPPSLNLYARIGLITADYLIIPSDLKAFANEGLTNVKDFIRQI 336

Query: 322 KKLRPAD-KPPYLVL 335
            + R  D + P +VL
Sbjct: 337 NRFRKQDNRKPIMVL 351


>gi|239946971|ref|ZP_04698724.1| chromosome partitioning protein ParA [Rickettsia endosymbiont of
           Ixodes scapularis]
 gi|239921247|gb|EER21271.1| chromosome partitioning protein ParA [Rickettsia endosymbiont of
           Ixodes scapularis]
          Length = 255

 Score = 43.9 bits (102), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 84/181 (46%), Gaps = 23/181 (12%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF---DKDPINSISD 220
           I+ +  +GGV  +T   N A + A+V   + L+ DLD P G ++  F    +   N+I  
Sbjct: 4   IAIVNQKGGVAKTTTTVNLATAFAAV-NKKILVIDLD-PQGNSSTGFGISQQQRKNTIYQ 61

Query: 221 AIYPVGRIDKAFVSR-LPVFYAENLSILTAPAMLSRTYDFD-------EKMIVPVLDILE 272
            +  +  +  A +S  +P     NL I+T+   LS   + D       E +++ +L+ ++
Sbjct: 62  VLTNLIELKDAIISTDIP-----NLEIITSNTNLSAA-ELDLTKLKDREYILMKLLEEIK 115

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL----KKLRPAD 328
            ++  +I+D P   N  T   L  SD+V+I    D   L    +L+  +    KKL P  
Sbjct: 116 ILYDYIIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIIEKKLNPKI 175

Query: 329 K 329
           K
Sbjct: 176 K 176


>gi|295699624|ref|YP_003607517.1| cobyrinic acid ac-diamide synthase [Burkholderia sp. CCGE1002]
 gi|295438837|gb|ADG18006.1| Cobyrinic acid ac-diamide synthase [Burkholderia sp. CCGE1002]
          Length = 400

 Score = 43.9 bits (102), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 44/211 (20%), Positives = 93/211 (44%), Gaps = 3/211 (1%)

Query: 129 VSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIAS 188
           V + L  PL    + ++++ I   +   +      ++   S+GG G++ IA N A ++A+
Sbjct: 100 VRQVLSWPLDAQAVGDALAQIEARRRAPQRRRARVVTLASSKGGSGTTLIAVNLACALAA 159

Query: 189 VFAMETLLADLDLPYGTANINF-DKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSIL 247
                 LL DL   +  A++   ++ P  +++D      ++D A      +    NL +L
Sbjct: 160 RRERRVLLIDLSQQFADASLLMANRPPPMTLADLCSRNEQLDAALFDACAMHVRPNLDLL 219

Query: 248 TAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLD 307
                  +  +     +  +L ++   +  V++DV    N  T   L  SD + +    +
Sbjct: 220 AGAGDPLKAAELLPGQLERILTLVRGRYDAVLIDVGPSLNPLTIRALAHSDAICMVVRQN 279

Query: 308 LAGLRNSKNLIDVLKKL-RPADKPPYLVLNQ 337
              L  ++ ++D+ ++L  PA K   +V+NQ
Sbjct: 280 PLYLHGARRMLDIFRELGHPASK-VRVVVNQ 309


>gi|218782957|ref|YP_002434275.1| cobyrinic acid ac-diamide synthase [Desulfatibacillum alkenivorans
           AK-01]
 gi|218764341|gb|ACL06807.1| Cobyrinic acid ac-diamide synthase [Desulfatibacillum alkenivorans
           AK-01]
          Length = 254

 Score = 43.9 bits (102), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 86/198 (43%), Gaps = 29/198 (14%)

Query: 167 IGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI----NFDKDPINSISDAI 222
              +GGVG STIA N A ++ +     TLL DLD P G A      N D D   ++++  
Sbjct: 6   FNQKGGVGKSTIASNLA-AMGASKGKRTLLVDLD-PQGNATQYLLGNGDLDSRETLAEFF 63

Query: 223 YPVGRID------KAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKM-----IVPVLDIL 271
             + RI       +A++   P    +NL +L A   ++   D   K+     I  + + L
Sbjct: 64  QDMLRISLRRKGAEAYIHHTPF---DNLDVLPAHGEMA---DLSSKLEARYKIYKLKEAL 117

Query: 272 EQI--FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADK 329
           +QI  +  V +D P   N +T   L  +D  +I    D    R    L+  ++++R    
Sbjct: 118 DQIPYYDAVFMDTPPALNFFTLSALIAADSCLIPFDCDDFSRRALYTLMGSVQEIREDHN 177

Query: 330 PPY----LVLNQVKTPKK 343
           P      +++NQ +   K
Sbjct: 178 PKLRVEGIIVNQFQARAK 195


>gi|71281148|ref|YP_271683.1| parA family protein [Colwellia psychrerythraea 34H]
 gi|71146888|gb|AAZ27361.1| parA family protein [Colwellia psychrerythraea 34H]
          Length = 268

 Score = 43.5 bits (101), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 75/173 (43%), Gaps = 15/173 (8%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANI--NFDKDPINSI 218
           G  I+    +GGVG +T A N A S+A+    + LL DLD P G A +    DK  +++ 
Sbjct: 2   GKIIAVANQKGGVGKTTTAVNLAASLAAT-KRKVLLIDLD-PQGNATMASGVDKYQVHAT 59

Query: 219 S-DAIYPVGRIDKAFVSRLPVFY---AENLSILTAPAMLSRTYDFDEKM---IVPVLDIL 271
             + +     ++   +      Y   + N  +  A   L   Y  ++++   + PV D  
Sbjct: 60  CYELLVEEQSVEDVVIKETSGLYHLISANADVTAAEIKLMEVYAREQRLKNALAPVKDF- 118

Query: 272 EQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL 324
              +  +I+D P   N  T   +T +D V++    +   L     L+D + KL
Sbjct: 119 ---YDFIIIDCPPSLNMLTVNAMTAADSVLVPMQCEYYALEGLTALMDTITKL 168


>gi|239979685|ref|ZP_04702209.1| septum site-determining protein [Streptomyces albus J1074]
          Length = 528

 Score = 43.5 bits (101), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 76/168 (45%), Gaps = 2/168 (1%)

Query: 158 GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  G  ++  G++GGVG+ T+        A      T L DLDL  G      D     S
Sbjct: 149 GGGGRVVTVSGAKGGVGT-TLTAVQLALAAQASGRSTALLDLDLQSGDTASYLDVQFRRS 207

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
           ++D +  +  +    ++ +   +   L+++ APA   R  D  ++    V+ +L   + +
Sbjct: 208 VAD-LAAIRDVTPRVLADVVFTHESGLAVIPAPAEGERGEDVTDRTARQVVTVLRGRYDV 266

Query: 278 VILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
           VI+D      +     + L+D+ ++  + D+  +R +K  I + ++L+
Sbjct: 267 VIVDCGTQMAAANAAAVELADEALLVLTPDVVAVRAAKRQIRLWERLQ 314


>gi|225351390|ref|ZP_03742413.1| hypothetical protein BIFPSEUDO_02984 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225157734|gb|EEG71017.1| hypothetical protein BIFPSEUDO_02984 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 279

 Score = 43.5 bits (101), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 80/176 (45%), Gaps = 14/176 (7%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIY 223
           I+    +GGVG +T + N A ++ S +    L+ D D P G A +    +  N++ D +Y
Sbjct: 28  IAMCNQKGGVGKTTSSINIAGAL-SQYGRRVLIVDFD-PQGAATVGLGINA-NTVEDTVY 84

Query: 224 PV---GRIDKAFVSRLPVFYAENLSILTAPAMLSR------TYDFDEKMIVPVLDILEQI 274
                 R+D   V R   F  ENL I+ A   LS       T    E+++  VL  ++  
Sbjct: 85  TALFNPRMDVHDVIRHTDF--ENLDIMPANIDLSAAEVQLVTEVGREQVLAGVLRQVKDE 142

Query: 275 FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKP 330
           + ++I+D        T   LT +D V+I  + +   LR    L+  ++K++    P
Sbjct: 143 YDVIIVDCQPSLGLLTVNALTAADGVIIPVAAEFFALRGVALLMQSIEKVQSRINP 198


>gi|167719681|ref|ZP_02402917.1| putative CpaE protein [Burkholderia pseudomallei DM98]
          Length = 185

 Score = 43.5 bits (101), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 38/183 (20%), Positives = 68/183 (37%), Gaps = 1/183 (0%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRI 228
           +RGGVG ++IA   A  +A          D D   G A           + + +    R+
Sbjct: 1   ARGGVGVTSIAVALARHLADRTRRRVAYVDFDCHGGAACSMLGVVSNQGLVELLQNPQRL 60

Query: 229 DKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNS 288
           D   + +  V  ++ L +L+A         +    +  ++  L   F  V+LD+P     
Sbjct: 61  DAQLIHQAMVAQSDRLFVLSAELPYDSEAPWRAGAVAGLVGALRHQFHYVLLDLPERAGR 120

Query: 289 WTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISI 348
              E L     V +     +   R +  L+    + R  D    L+LN  + P +  +  
Sbjct: 121 LVDEALAACASVYVVADRSVHAAREAARLLH-HAQARDGDAHVSLILNNAQQPVRGRVEP 179

Query: 349 SDF 351
           +DF
Sbjct: 180 ADF 182


>gi|58038876|ref|YP_190840.1| cell division inhibitor MinD [Gluconobacter oxydans 621H]
 gi|58001290|gb|AAW60184.1| Cell division inhibitor MinD [Gluconobacter oxydans 621H]
          Length = 270

 Score = 43.5 bits (101), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 66/258 (25%), Positives = 110/258 (42%), Gaps = 29/258 (11%)

Query: 169 SRGGVGSSTIAHNCAFSIAS------VFAMETLLADLDLPYGTAN-INFDKDPINSISDA 221
            +GGVG +T       ++A       V   +  L +LDL  G    + FD      + + 
Sbjct: 10  GKGGVGKTTSTAALGAALAQSGQNVVVVDFDVGLRNLDLVMGAERRVVFD------LINV 63

Query: 222 IYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYD-FDEKMIVPVLDILEQIFPLVIL 280
           +    R+ +A +        E LSIL  PA  +R  D    + +  V+D L + F  VI 
Sbjct: 64  VQGDARLSQALIRD---KRCETLSIL--PASQTRDKDALTSEGVARVMDELSEKFDWVIC 118

Query: 281 DVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL----KKLRPADK-PPYLVL 335
           D P       Q  +  +D  VI T+ +++ +R+S  +I +L    +K    +K   +L+L
Sbjct: 119 DSPAGIERGAQLAMYHADMAVIVTNPEVSSVRDSDRIIGLLDSKTQKAEQGEKVEKHLLL 178

Query: 336 NQ---VKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANL 392
            +    +  +K  +S+ D    L I    I+P    V   S+N G  +    P S  A  
Sbjct: 179 TRYDPARAARKEMLSVEDVLEILSIPLLGIVPESEDVL-KSSNVGAPVTLAAPTSLPARA 237

Query: 393 LVDFSRVLMG-RVTVSKP 409
             + +R L G ++ VS P
Sbjct: 238 YFEAARRLSGEKLEVSVP 255


>gi|78186210|ref|YP_374253.1| ParaA family ATPase [Chlorobium luteolum DSM 273]
 gi|78166112|gb|ABB23210.1| chromosome segregation ATPase [Chlorobium luteolum DSM 273]
          Length = 265

 Score = 43.5 bits (101), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 75/174 (43%), Gaps = 15/174 (8%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISD 220
           G  I+    +GGVG +T A N A SIA +    TLL D+D P   A   F  D    I +
Sbjct: 2   GRVIAIANQKGGVGKTTTAVNIAASIA-ISEFRTLLIDID-PQANATSGFGIDNGEEIDN 59

Query: 221 AIYPV----GRIDKAFVSRLPVFYAE----NLSILTAPAMLSRTYDFDEKMIVPVLDILE 272
             Y V    G I  A V R  + Y +    N++++     L    D  E ++   L  + 
Sbjct: 60  TFYQVMVKGGEIKDA-VMRSSLEYLDVLPSNVNLVGMEVELVNMRD-REYVMQKALKAVR 117

Query: 273 QIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLD---LAGLRNSKNLIDVLKK 323
             +  +I+D P      T   LT +D V+I    +   L GL    N I +++K
Sbjct: 118 NDYDYIIIDCPPSLGLITLNALTAADSVLIPVQAEYYALEGLGKLLNTISIVRK 171


>gi|288553584|ref|YP_003425519.1| septum site-determining protein [Bacillus pseudofirmus OF4]
 gi|288544744|gb|ADC48627.1| septum site-determining protein [Bacillus pseudofirmus OF4]
          Length = 264

 Score = 43.5 bits (101), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 54/276 (19%), Positives = 122/276 (44%), Gaps = 25/276 (9%)

Query: 161 GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANIN----FDKDPIN 216
           G +I     +GGVG +T + N   S+A +   +  L D D+  G  N++     +   I 
Sbjct: 2   GEAIVITSGKGGVGKTTTSANIGTSLA-LNGKKVCLIDTDI--GLRNLDVVMGLENRIIY 58

Query: 217 SISDAIYPVGRIDKAFVS--RLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI 274
            + D +    ++ +A +   R    Y      L   A        + + +  +++ L+Q 
Sbjct: 59  DLVDVVEGRCKLKQALIKDKRFECLY------LLPAAQTKDKLSVEPEQMKEIVNELKQE 112

Query: 275 FPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLV 334
           +  V++D P       +  +  +DK ++ T+ +++ +R++  +I +L++     + P LV
Sbjct: 113 YDYVLIDCPAGIEQGFKNAVAGADKAIVVTTPEVSAVRDADRIIGLLEQ--EEIEAPKLV 170

Query: 335 LNQVKTP--KKPE-ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIAN 391
           +N+++    K  E + + +  + L I    I+  D  V   S     +      K++IA 
Sbjct: 171 VNRIRGHMMKNGEMLDVDEISSILAIDLIGIVVDDEDVIKYSNKGEPIALHTGSKASIA- 229

Query: 392 LLVDFSRVLMGR---VTVSKPQSAMYTKIKKIFNMK 424
              + +R ++G    +   + +  ++ KIK+ F ++
Sbjct: 230 -YRNIARRILGEAVPLMSLEEEKGLFAKIKQFFGVR 264


>gi|307324475|ref|ZP_07603683.1| response regulator receiver protein [Streptomyces violaceusniger Tu
           4113]
 gi|306890206|gb|EFN21184.1| response regulator receiver protein [Streptomyces violaceusniger Tu
           4113]
          Length = 405

 Score = 43.5 bits (101), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 101/241 (41%), Gaps = 13/241 (5%)

Query: 158 GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  G  ++  G++GGVG+ T+        A     +  L DLDL  G      D     S
Sbjct: 147 GPGGQLVAVAGAKGGVGT-TVTAVQLALAARAAGRKVALVDLDLQSGDIASYLDVQFRRS 205

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
           I+D +  +  I    +      +   L +L AP    R  +  ++    V+  L   F L
Sbjct: 206 IAD-LAQISDISPRVLQDAVFTHQTGLGLLLAPGEGERGEEVTDRTARQVIGALRSRFEL 264

Query: 278 VILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKL--RPADKPPYLVL 335
           V++D      S     +  +D  ++ T+ D+  +R +K ++ +  +L  R A++   +V 
Sbjct: 265 VVVDCGTQMTSAGAAAVETADIALLVTTPDVVAVRAAKRMVRLWDRLQIRKAEETVTVVN 324

Query: 336 NQVKTPK-KPEISISDFCAPLGIT--PSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANL 392
              ++ + +P++        +  T  P+       AV     +SG+M  ++D KSA+   
Sbjct: 325 RHTRSAEIQPQLVQRATGTTVARTAIPAGFKELQPAV-----DSGRM-QDLDAKSAVKQA 378

Query: 393 L 393
           L
Sbjct: 379 L 379


>gi|261400080|ref|ZP_05986205.1| septum site-determining protein MinD [Neisseria lactamica ATCC
           23970]
 gi|313667469|ref|YP_004047753.1| septum site-determining protein [Neisseria lactamica ST-640]
 gi|269210305|gb|EEZ76760.1| septum site-determining protein MinD [Neisseria lactamica ATCC
           23970]
 gi|309379131|emb|CBX22262.1| septum site-determining protein MinD [Neisseria lactamica Y92-1009]
 gi|313004931|emb|CBN86357.1| septum site-determining protein [Neisseria lactamica 020-06]
          Length = 271

 Score = 43.5 bits (101), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 109/233 (46%), Gaps = 30/233 (12%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF----DKDPINSISDAIYP 224
            +GGVG +T + + A  +A +   +T + D D+  G  N++     ++  +  + + I  
Sbjct: 10  GKGGVGKTTTSASIATGLA-LRGYKTAVIDFDV--GLRNLDLIMGCERRVVYDLINVIQG 66

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQI------FPLV 278
              +++A +        ENL IL A    S+T D D      V  +++++      F  +
Sbjct: 67  EATLNQALIKDKN---CENLFILPA----SQTRDKDALTRDGVEKVMKELSGKKMGFEYI 119

Query: 279 ILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLK-KLRPADKPPYLVLNQ 337
           I D P          L  +D+ ++TT+ +++ +R+S  ++ +L+ K R A++   +  + 
Sbjct: 120 ICDSPAGIEQGALMALYFADEAIVTTNPEVSSVRDSDRILGILQSKSRKAEQGGSVKEHL 179

Query: 338 VKTPKKPE-------ISISDFCAPLGITPSAIIPFDGAVFGMSANSGK-MIHE 382
           + T   PE       +S+ D C  L I    +IP    V   ++NSG+ +IH+
Sbjct: 180 LITRYSPERVAKGEMLSVQDICDILRIPLLGVIPESQNVL-QASNSGEPVIHQ 231


>gi|41614915|ref|NP_963413.1| hypothetical protein NEQ119 [Nanoarchaeum equitans Kin4-M]
 gi|40068639|gb|AAR38974.1| NEQ119 [Nanoarchaeum equitans Kin4-M]
          Length = 244

 Score = 43.5 bits (101), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 54/233 (23%), Positives = 105/233 (45%), Gaps = 25/233 (10%)

Query: 163 SISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAI 222
           +I+ +  +GGVG +TI+ N A  +++ F   TLL D +L      I    +P+ +++D +
Sbjct: 3   AIAILSGKGGVGKTTISVNLAKVLSTKF--RTLLIDGNLTTPNVAIFLGLNPLYTLNDVL 60

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDV 282
                + +A V +      +NL +L A   L      + + I  V++ L++ +  +I+D 
Sbjct: 61  RGDINVSEAIVKK------DNLYVLPASIRLKDLQGINPEKIKDVIESLKEHYDYIIIDT 114

Query: 283 -PHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPY----LVLNQ 337
            P +       +L   + + ITT+       ++ +L+D  K +  A++        ++N 
Sbjct: 115 APGLGREMRYSILGADEAIAITTT-------DASSLVDTTKAMALAEQKGISIKGAIINM 167

Query: 338 VKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIA 390
                 P  +I DF   L  +   IIP+D  +   +  + + I     K AIA
Sbjct: 168 YDGSVNPS-TIEDF---LETSILGIIPYDPTIKRYTMKN-QTIENKKTKGAIA 215


>gi|239995884|ref|ZP_04716408.1| septum site-determining protein MinD [Alteromonas macleodii ATCC
           27126]
          Length = 269

 Score = 43.1 bits (100), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 113/250 (45%), Gaps = 29/250 (11%)

Query: 169 SRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF----DKDPINSISDAIYP 224
            +GGVG +T +   +  +A +   +T++ D D+  G  N++     ++  +    + I  
Sbjct: 10  GKGGVGKTTSSAAISTGLA-LAGHKTVVIDFDV--GLRNLDLIMGCERRVVYDFVNVINK 66

Query: 225 VGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDE---KMIVPVLDILEQIFPLVILD 281
              + +A +        ENL IL A    S+T D D      +  VLD L++ F  +I D
Sbjct: 67  EASLKQALIKDK---RTENLFILPA----SQTRDKDALTVDGVQAVLDELKKDFEFIICD 119

Query: 282 VPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVL--KKLRPADKPP---YLVLN 336
            P       Q  L  +D+ ++ T+ +++ +R+S  ++ +L  K +R     P   +L+L 
Sbjct: 120 SPAGIEQGAQMALYFADEAIVVTNPEVSSVRDSDRILGILQSKSMRAEKGEPVKEHLLLT 179

Query: 337 QVKTPKKPE----ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANL 392
           +   P + E    +S++D    L I    +IP   AV   S N G+ +  +D ++     
Sbjct: 180 RY-NPSRVESAEMLSVADVEEILAIPLLGVIPESEAVLKAS-NQGQPVI-LDEEANAGQA 236

Query: 393 LVDFSRVLMG 402
             D  + L+G
Sbjct: 237 YADAVKRLLG 246


>gi|291451550|ref|ZP_06590940.1| MinD protein [Streptomyces albus J1074]
 gi|4160361|emb|CAA06604.1| MinD protein [Streptomyces griseus]
 gi|291354499|gb|EFE81401.1| MinD protein [Streptomyces albus J1074]
          Length = 396

 Score = 43.1 bits (100), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 76/168 (45%), Gaps = 2/168 (1%)

Query: 158 GSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINS 217
           G  G  ++  G++GGVG+ T+        A      T L DLDL  G      D     S
Sbjct: 17  GGGGRVVTVSGAKGGVGT-TLTAVQLALAAQASGRSTALLDLDLQSGDTASYLDVQFRRS 75

Query: 218 ISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPL 277
           ++D +  +  +    ++ +   +   L+++ APA   R  D  ++    V+ +L   + +
Sbjct: 76  VAD-LAAIRDVTPRVLADVVFTHESGLAVIPAPAEGERGEDVTDRTARQVVTVLRGRYDV 134

Query: 278 VILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLR 325
           VI+D      +     + L+D+ ++  + D+  +R +K  I + ++L+
Sbjct: 135 VIVDCGTQMAAANAAAVELADEALLVLTPDVVAVRAAKRQIRLWERLQ 182


>gi|91206165|ref|YP_538520.1| ATPase [Rickettsia bellii RML369-C]
 gi|157826533|ref|YP_001495597.1| ATPase [Rickettsia bellii OSU 85-389]
 gi|91069709|gb|ABE05431.1| ATPase [Rickettsia bellii RML369-C]
 gi|157801837|gb|ABV78560.1| ATPase [Rickettsia bellii OSU 85-389]
          Length = 257

 Score = 43.1 bits (100), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 83/180 (46%), Gaps = 21/180 (11%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINF---DKDPINSISD 220
           IS +  +GGV  +T   N A ++A+    + L+ DLD P G ++  F    +   N+I  
Sbjct: 6   ISVVNQKGGVAKTTTTVNLATALAA-MDKKVLVIDLD-PQGNSSTGFGVSQQQRKNTIYQ 63

Query: 221 AIYPVGRIDKAFVSR-LPVFYAENLSILTAPAMLSRT------YDFDEKMIVPVLDILEQ 273
           A+  + ++    +S  +P     NL I+T+   LS         +  E +++ +L+ ++ 
Sbjct: 64  ALTNIIKLKDTIISTDIP-----NLEIITSNTNLSAAELDLIKLEEREYILMKLLEGIKV 118

Query: 274 IFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLID----VLKKLRPADK 329
           ++  +I+D P   N  T   L   D+V+I    D   L    +L+     V K+L P  K
Sbjct: 119 LYDYIIIDCPPSLNLLTINALVAGDEVLIPMQCDFYSLEGLSHLLKTVEIVEKRLNPKIK 178


>gi|170724365|ref|YP_001752053.1| cobyrinic acid ac-diamid