RPSBLAST alignment for GI: 254780725 and conserved domain: COG1192

>gnl|CDD|31385 COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 259
 Score = 57.9 bits (139), Expect = 5e-09
 Identities = 57/240 (23%), Positives = 96/240 (40%), Gaps = 17/240 (7%)

Query: 164 ISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDP-INSISDAI 222
           I+    +GGVG +T A N A ++A     + LL DLD P G+        P +      +
Sbjct: 5   IAVANQKGGVGKTTTAVNLAAALAKRGGKKVLLIDLD-PQGSLTSWLGLRPDLEGDLYNL 63

Query: 223 YPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFD------EKMIVPVLDILEQIFP 276
               +     +    V   E L ++ +   L+   + +      E ++  +LD ++  + 
Sbjct: 64  LSGLKERPDILDYTVVI--EGLDLIPSNIDLAEGAEIELNAVAKELLLKRLLDPVKDDYD 121

Query: 277 LVILDVPHVWNSWTQEVLTLSDKVVI---TTSLDLAGLRNSKNLIDVLKKLRPADKPPY- 332
            +I+D P      T   L  +D V+I      LDL GL    N ++ L KLR        
Sbjct: 122 YIIIDTPPSLGVLTLNALAAADHVLIPVQPEFLDLEGLEQLLNTLEDLLKLRRNKLIVVG 181

Query: 333 LVLNQVKTPKKPEISISDFCAPLGITP--SAIIPFDGAVFGMSANSGKMIHEVDPKSAIA 390
           +++ +  +  K    +      L   P     IP     +  +A  GK ++E DPKS  A
Sbjct: 182 ILITRFDSRTKLADEVLQELKQLLGDPVLKTKIPRR-VAYREAAAEGKPLYEYDPKSKAA 240