HHsearch alignment for GI: 254780727 and conserved domain: COG2823

>COG2823 OsmY Predicted periplasmic or secreted lipoprotein [General function prediction only].
Probab=95.34  E-value=0.029  Score=31.39  Aligned_cols=51  Identities=35%  Similarity=0.479  Sum_probs=41.4

Q ss_pred             HCCCCCEEEEEECCEEEEEEEECCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEECC
Q ss_conf             57877169998389499999719999999999999986122345555566544303554327
Q gi|254780727|r  130 FIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIA  191 (474)
Q Consensus       130 ~~p~~~i~v~~~~~~vvl~G~v~~~~~~~~~~~ia~~~~~~~~~~~~~~~~~~~vvn~l~v~  191 (474)
T Consensus       145 ~v~s~~IkV~t~~g~V~L~G~V~s~~e~~~A~~~A~~v~GV-----------k~V~~~l~i~  195 (196)
T COG2823         145 NVKSSNIKVETENGEVYLSGLVDSQEEAERAEEIASKVSGV-----------KKVVNDLKIK  195 (196)
T ss_pred             CCCCCEEEEEEECCEEEEEEEECCHHHHHHHHHHHHCCCCH-----------HHHHHHHCCC
T ss_conf             78730489999898999987748999999999998629778-----------8886444406