HHsearch alignment for GI: 254780727 and conserved domain: pfam04972

>pfam04972 BON Putative phospholipid-binding domain. This domain is found in a family of osmotic shock protection proteins. It is also found in some Secretins and a group of potential haemolysins. Its likely function is attachment to phospholipid membranes.
Probab=97.37  E-value=0.00092  Score=40.04  Aligned_cols=60  Identities=25%  Similarity=0.378  Sum_probs=50.1

Q ss_pred             HHHHHHHHH--HCCCCCEEEEEECCEEEEEEEECCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEECC
Q ss_conf             478999998--57877169998389499999719999999999999986122345555566544303554327
Q gi|254780727|r  121 AHLEMTLRR--FIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIA  191 (474)
Q Consensus       121 ~~l~~~l~~--~~p~~~i~v~~~~~~vvl~G~v~~~~~~~~~~~ia~~~~~~~~~~~~~~~~~~~vvn~l~v~  191 (474)
T Consensus         2 ~~i~~~l~~~~~~~~~~I~V~v~~g~V~L~G~v~s~~~~~~a~~~a~~~~Gv-----------~~V~n~l~v~   63 (64)
T pfam04972         2 AKVKAALLADPGLPASDIKVTVENGVVTLSGTVDSEEEKEKAEEIARNVKGV-----------KKVVNEITVR   63 (64)
T ss_pred             HHHHHHHHCCCCCCCCCEEEEEECCEEEEEEECCCHHHHHHHHHHHHCCCCC-----------CEEEEEEEEE
T ss_conf             7899988349899857169999896999999859999999999999669698-----------5899617992