BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780727|ref|YP_003065140.1| putative pilus assembly
protein [Candidatus Liberibacter asiaticus str. psy62]
         (474 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780727|ref|YP_003065140.1| putative pilus assembly protein [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040404|gb|ACT57200.1| putative pilus assembly protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 474

 Score =  961 bits (2483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/474 (100%), Positives = 474/474 (100%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL
Sbjct: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
           QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI
Sbjct: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
           AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS
Sbjct: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240
           SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS
Sbjct: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
           EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS
Sbjct: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTV 360
           STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTV
Sbjct: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTV 360

Query: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK
Sbjct: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420

Query: 421 PVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           PVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK
Sbjct: 421 PVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474


>gi|315121891|ref|YP_004062380.1| putative pilus assembly protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495293|gb|ADR51892.1| putative pilus assembly protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 471

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/474 (69%), Positives = 390/474 (82%), Gaps = 3/474 (0%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           M+  Q+T F +  IF+ SSN  +A+   +   NA+ I+I D  IG  KKI+IGL KV+IL
Sbjct: 1   MKNFQKTLFMLFVIFISSSNFLLAQSKLVDAKNASTIHIGDSAIGTSKKINIGLGKVVIL 60

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
            +P  VQDVLVSDPTKADVVVHS +T+Y+FGK+VGQANVILIGHD KQ+LN+DI IERDI
Sbjct: 61  HLPSRVQDVLVSDPTKADVVVHSSKTVYIFGKSVGQANVILIGHDEKQLLNIDIFIERDI 120

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
            +LEMT RRF++ SNI VEM+SD +VLHG VRTIQDSQ AVELS  FLS    N Y  +S
Sbjct: 121 RNLEMTFRRFLSGSNIHVEMLSDNLVLHGEVRTIQDSQHAVELSNMFLSNERNNLYKTAS 180

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240
             KV+NLLNI  EDQVTLKVTIAEVRRD+LKQIGFQH+I  SS GPSK    DF G    
Sbjct: 181 GSKVINLLNIGAEDQVTLKVTIAEVRRDVLKQIGFQHTI--SSGGPSKGKRIDFDGSLGG 238

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
           +G DF++  +LDRF+F++VL+ALERATAIRTLAEPTLTAISGQ+A+F SGG  LY++V +
Sbjct: 239 QGADFAMTTILDRFTFKSVLNALERATAIRTLAEPTLTAISGQNATFRSGGTRLYRSVGA 298

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTV 360
           + G +++T HDYGVVL FTPTVLSPGRIGLRI+TEVSEPV+GV+    P YR+RKADTTV
Sbjct: 299 N-GTSTITPHDYGVVLTFTPTVLSPGRIGLRIETEVSEPVLGVSTTGEPEYRMRKADTTV 357

Query: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           ELPSGGTIVLAGLLKDDIQQ + G+PLLSKIPILGALFR++ F+REETEIFI+ATPFLVK
Sbjct: 358 ELPSGGTIVLAGLLKDDIQQKRGGVPLLSKIPILGALFRSNSFSREETEIFISATPFLVK 417

Query: 421 PVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           PVAM +LSRPDD+Y +E+DAKAF FNRVNKIYGPKEA++  GQNYKGAIGFIYK
Sbjct: 418 PVAMNELSRPDDNYDIENDAKAFLFNRVNKIYGPKEAAQGNGQNYKGAIGFIYK 471


>gi|241207157|ref|YP_002978253.1| type II and III secretion system protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240861047|gb|ACS58714.1| type II and III secretion system protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 499

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 231/476 (48%), Positives = 315/476 (66%), Gaps = 28/476 (5%)

Query: 22  SVAKLPPIKEANA---AVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKAD 78
           S A L    EA A   +++ IS       +++ +GLNK +++ +P D  D+LVSDPT AD
Sbjct: 29  SFAPLFGAGEARADSDSLVRISQTGSNAHRRLKLGLNKAVVVDLPEDAHDILVSDPTMAD 88

Query: 79  VVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRV 138
            V  + R +YLFGK VGQ N+ + G  G++++NLDI IERD++ LE+ LRRFI DSNI V
Sbjct: 89  AVTRTSRRIYLFGKKVGQTNIFVFGAGGQEIVNLDIEIERDVSGLEVNLRRFIPDSNINV 148

Query: 139 EMVSDTVVLHGMVRTIQDSQRAVELSETFL---SQSGRNQYANSS--------------S 181
           E+VSD +VL G VRT QD+ +A +L++ FL     + R + A+ +              S
Sbjct: 149 EIVSDNIVLTGTVRTPQDATQAADLAQVFLKGGEATTRTETASGTGGDSSVALFAEGRQS 208

Query: 182 KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS---GPSKSFAADFGGKF 238
            +V+NLL I GEDQVTLKVTIAEVRR++LKQ+GF + ++ SS        S +AD     
Sbjct: 209 SQVVNLLQIEGEDQVTLKVTIAEVRREVLKQLGFDNLVSNSSGMTVAQLGSPSADSAAST 268

Query: 239 VSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV 298
           V  G     K  + ++   T L+ALE+A  ++TLAEPTLTAISGQ+A+F SGGQ LY T 
Sbjct: 269 VGGGLAALFKSSIGKYDISTYLNALEQAKVVKTLAEPTLTAISGQAATFNSGGQQLYST- 327

Query: 299 SSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADT 358
           + S G  +V   +YG+ L F P VLS GRI L+I+T VSEPV G  +G+  +Y+ R A+T
Sbjct: 328 TDSDGNVTVVPFNYGISLAFKPVVLSSGRISLQIKTNVSEPVAG--SGNA-TYQRRSAET 384

Query: 359 TVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFL 418
           +VELPSGG+I LAGL++D++ Q   G P +SKIP+LG LFR   F R+ETE+ I ATP+L
Sbjct: 385 SVELPSGGSIALAGLIRDNVSQTMGGTPGVSKIPLLGTLFRQKGFERQETELVIIATPYL 444

Query: 419 VKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           V+PVA   L+RPDD++S E+D   FF NRVNK+YG +EA   + Q + G+IGFIYK
Sbjct: 445 VRPVARNQLNRPDDNFSPENDGATFFLNRVNKVYGRREAPVADAQ-FHGSIGFIYK 499


>gi|116249981|ref|YP_765819.1| pilus assembly protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254629|emb|CAK05703.1| putative pilus assembly protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 501

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 231/476 (48%), Positives = 315/476 (66%), Gaps = 28/476 (5%)

Query: 22  SVAKLPPIKEANA---AVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKAD 78
           S A L    EA A   +++ IS       +++ +GLNK +++ +P D  D+LVSDPT AD
Sbjct: 31  SFATLFAAGEARADSDSLVRISQTGSNAHRRLKLGLNKAVVVDLPEDAHDILVSDPTMAD 90

Query: 79  VVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRV 138
            V  + R +YLFGK VGQ N+ + G  G++++NLDI IERD++ LE+ LRRFI DSNI V
Sbjct: 91  AVTRTSRRIYLFGKKVGQTNIFVFGAGGQEIVNLDIEIERDVSGLEVNLRRFIRDSNINV 150

Query: 139 EMVSDTVVLHGMVRTIQDSQRAVELSETFL---SQSGRNQYANSS--------------S 181
           E+VSD +VL G VRT QD+ +A +L++ FL     + R + A+ +              S
Sbjct: 151 EIVSDNIVLTGTVRTPQDATQAADLAQVFLKGGEATTRTETASGTGGDSSVALFAEGRQS 210

Query: 182 KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS---GPSKSFAADFGGKF 238
            +V+NLL I GEDQVTLKVTIAEVRR++LKQ+GF + ++ SS        S +AD     
Sbjct: 211 SQVVNLLQIEGEDQVTLKVTIAEVRREVLKQLGFDNLVSNSSGMTVAQLGSPSADSATAT 270

Query: 239 VSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV 298
           V  G     K  + ++   T L+ALE+A  ++TLAEPTLTAISGQ+A+F SGGQ LY T 
Sbjct: 271 VGGGLAALFKSSIGKYDISTYLNALEQAKVVKTLAEPTLTAISGQAATFNSGGQQLYST- 329

Query: 299 SSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADT 358
           + S G  +V   +YG+ L F P VLS GRI L+I+T VSEPV G  +G+  +Y+ R A+T
Sbjct: 330 TDSDGNVTVVPFNYGINLAFKPVVLSSGRISLQIKTNVSEPVAG--SGNA-TYQRRSAET 386

Query: 359 TVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFL 418
           +VELPSGG+I LAGL++D++ Q   G P +SKIP+LG LFR   F R+ETE+ I ATP+L
Sbjct: 387 SVELPSGGSIALAGLIRDNVSQTMGGTPGVSKIPLLGTLFRQKGFERQETELVIIATPYL 446

Query: 419 VKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           V+PVA   L+RPDD++S E+D   FF NRVNK+YG +EA   + Q + G+IGFIYK
Sbjct: 447 VRPVARNQLNRPDDNFSPENDGATFFLNRVNKVYGRREAPVADAQ-FHGSIGFIYK 501


>gi|86355864|ref|YP_467756.1| pilus assembly secretion protein [Rhizobium etli CFN 42]
 gi|86279966|gb|ABC89029.1| pilus assembly secretion protein [Rhizobium etli CFN 42]
          Length = 498

 Score =  422 bits (1084), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 227/473 (47%), Positives = 312/473 (65%), Gaps = 37/473 (7%)

Query: 29  IKEANAA--VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRT 86
           + EA AA  ++ IS       +++ +GLNK +++ +P D  D+LVSDPT AD V  + R 
Sbjct: 36  VNEARAAESLVRISQTGPDAHRRLKLGLNKAVVVDLPEDAHDILVSDPTMADAVTRTSRR 95

Query: 87  MYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVV 146
           +YLFGK VGQ N+ + G  G++++NLDI IERD++ LE  LRRFI DSNI+VE+VSD +V
Sbjct: 96  IYLFGKKVGQTNIFVFGAGGQEVVNLDIEIERDVSGLETNLRRFIPDSNIKVEIVSDNIV 155

Query: 147 LHGMVRTIQDSQRAVELSETFL---SQSGRNQYANSS--------------SKKVMNLLN 189
           L G VRT QD+ +A +L++ FL     + R + A+ +              + +V+NLL 
Sbjct: 156 LTGTVRTPQDATQAADLAQVFLKGGEATTRTETASGTGGDSSVALFAEGRQTSQVVNLLQ 215

Query: 190 IAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS--------SGPSKSFAADFGGKFVSE 241
           I GEDQVTLKVTI EVRR++LKQ+GF + ++ SS        S  + S  A  GG   + 
Sbjct: 216 IQGEDQVTLKVTITEVRREVLKQLGFDNLVSNSSGMTVAQLGSPNADSATATVGGGLAA- 274

Query: 242 GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS 301
                 K  + ++   T L+ALE+A  +RTLAEPTLTAISGQ+A+F SGGQ LY T + +
Sbjct: 275 ----LFKSSIGKYDISTYLNALEQAKVVRTLAEPTLTAISGQAATFNSGGQQLYST-TDN 329

Query: 302 TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVE 361
            G  +V   +YG+ L F P VLS GRI L I+T VSEPV G  +G+  +Y+ R A+T+VE
Sbjct: 330 NGNVTVVPFNYGINLAFKPVVLSSGRISLEIKTNVSEPVAG--SGNA-TYQRRSAETSVE 386

Query: 362 LPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
           LPSGG+I LAGL++D++ Q   G P +SKIP+LG LFR   F R+ETE+ I ATP+LV+P
Sbjct: 387 LPSGGSIALAGLIRDNVSQTMGGTPGVSKIPLLGTLFRQKGFERQETELVIIATPYLVRP 446

Query: 422 VAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           VA   L+RPDD++S E+D   FF NRVNK+YG +EA   + Q + G+IGFIYK
Sbjct: 447 VARNQLNRPDDNFSPENDGATFFLNRVNKVYGRREAPVADAQ-FHGSIGFIYK 498


>gi|209551759|ref|YP_002283676.1| type II and III secretion system protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209537515|gb|ACI57450.1| type II and III secretion system protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 499

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 220/447 (49%), Positives = 301/447 (67%), Gaps = 25/447 (5%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           +++ +GLNK +++ +P D  D+LVSDPT AD V  + R +YLFGK VGQ N+ + G  G+
Sbjct: 58  RRLKLGLNKAVVVDLPEDAHDILVSDPTMADAVTRTSRRIYLFGKKVGQTNIFVFGAGGQ 117

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
           +++NLDI IERD++ LE+ L RFI DSNI VE+VSD +VL G VRT QD+ +A +L++ F
Sbjct: 118 EIVNLDIEIERDVSGLEVNLHRFIPDSNINVEIVSDNIVLTGTVRTPQDATQAADLAQVF 177

Query: 168 L---SQSGRNQYANSS--------------SKKVMNLLNIAGEDQVTLKVTIAEVRRDIL 210
           L     + R + A+ +              + +V+NLL I GEDQVTLKVTIAEVRR++L
Sbjct: 178 LKGGEATTRTETASGTGGDSSVALFAEGRQTSQVVNLLQIEGEDQVTLKVTIAEVRREVL 237

Query: 211 KQIGFQHSITGSSS---GPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERAT 267
           KQ+GF + ++ SS        S +AD     V  G     K  + ++   T L+ALE+A 
Sbjct: 238 KQLGFDNLVSNSSGMTVAQLGSPSADSATSVVGGGLAALFKSSIGKYDISTYLNALEQAK 297

Query: 268 AIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGR 327
            ++TLAEPTLTAISGQ+A+F SGGQ LY T + S G  +V   +YG+ L F P VLS GR
Sbjct: 298 VVKTLAEPTLTAISGQAATFNSGGQQLYST-TDSNGNVTVVPFNYGINLAFKPVVLSSGR 356

Query: 328 IGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           I L+I+T VSEPV G +     +Y+ R A+T+VELPSGG+I LAGL++D++ Q   G P 
Sbjct: 357 ISLQIKTNVSEPVAGSSGA---TYQRRSAETSVELPSGGSIALAGLIRDNVSQTMGGTPG 413

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR 447
           +SKIP+LG LFR   F R+ETE+ I ATP+LV+PVA   L+RPDD++S E+D   FF NR
Sbjct: 414 VSKIPLLGTLFRQKGFERQETELVIIATPYLVRPVARNQLNRPDDNFSPENDGATFFLNR 473

Query: 448 VNKIYGPKEASEVEGQNYKGAIGFIYK 474
           VNK+YG +EA   + Q + G+IGFIYK
Sbjct: 474 VNKVYGRREAPVADAQ-FHGSIGFIYK 499


>gi|190889881|ref|YP_001976423.1| pilus assembly secretion protein [Rhizobium etli CIAT 652]
 gi|190695160|gb|ACE89245.1| pilus assembly secretion protein [Rhizobium etli CIAT 652]
 gi|327194694|gb|EGE61540.1| pilus assembly secretion protein [Rhizobium etli CNPAF512]
          Length = 499

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 221/447 (49%), Positives = 301/447 (67%), Gaps = 25/447 (5%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           +++ +GLNK +++ +P D  D+LVSDP+ AD V  + R +YLFGK VGQ N+ + G  G+
Sbjct: 58  RRLKLGLNKAVVVDLPEDAHDILVSDPSMADAVTRTSRRIYLFGKKVGQTNIFVFGAGGQ 117

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
           +++NLDI IERD++ LE  LRRFI DSNI VE+VSD +VL G VRT QD+ +A +L++ F
Sbjct: 118 EIINLDIEIERDVSGLEANLRRFIPDSNINVEIVSDNIVLTGTVRTPQDATQAADLAQVF 177

Query: 168 L---SQSGRNQYANSS--------------SKKVMNLLNIAGEDQVTLKVTIAEVRRDIL 210
           L     + R + A+ +              + +V+NLL I GEDQVTLKVTIAEVRR++L
Sbjct: 178 LKGGEATTRTETASGTGGDSAVALFAEGRQTSQVVNLLKIEGEDQVTLKVTIAEVRREVL 237

Query: 211 KQIGFQHSITGSSSGPSKSF---AADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERAT 267
           KQ+GF + I+ SS          +AD     V  G     K  + ++   T L+ALE+A 
Sbjct: 238 KQLGFDNLISNSSGMTVAQLGTPSADSATATVGGGLAALFKSSIGKYDISTYLNALEQAK 297

Query: 268 AIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGR 327
            +RTLAEPTLTAISGQ+A+F SGGQ LY T + + G  +V   +YG+ L F P VLS GR
Sbjct: 298 VVRTLAEPTLTAISGQAATFNSGGQQLYST-TDNDGNVTVVPFNYGINLAFKPVVLSSGR 356

Query: 328 IGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           I L I+T VSEPV G  +G+  +Y+ R A+T+VELPSGG+I LAGL++D++ Q   G P 
Sbjct: 357 ISLEIKTNVSEPVAG--SGNA-TYQRRSAETSVELPSGGSIALAGLIRDNVSQTMGGTPG 413

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR 447
           +SKIP+LG LFR   F R+ETE+ I ATP+LV+PVA   L+RPDD++S E+D   FF NR
Sbjct: 414 VSKIPLLGTLFRQKGFERQETELVIIATPYLVRPVARNQLNRPDDNFSPENDGATFFLNR 473

Query: 448 VNKIYGPKEASEVEGQNYKGAIGFIYK 474
           VNK+YG +EA   + Q + G+IGFIYK
Sbjct: 474 VNKVYGRREAPVADAQ-FHGSIGFIYK 499


>gi|222084469|ref|YP_002542998.1| pilus assembly secretion protein [Agrobacterium radiobacter K84]
 gi|221721917|gb|ACM25073.1| pilus assembly secretion protein [Agrobacterium radiobacter K84]
          Length = 505

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 216/448 (48%), Positives = 300/448 (66%), Gaps = 26/448 (5%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           + + +GLNK +++ +P D  D+LVSDP  AD V  + R +YLFGK VGQ N+ + G +G+
Sbjct: 63  RTLKLGLNKALVVDLPADAHDILVSDPKMADAVTRTSRRIYLFGKTVGQTNIFVFGANGQ 122

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
           ++++LD+ IERDI+ L+  L+RFI DS+I VE+VSD +VL G VRT QDS RA +L+  F
Sbjct: 123 EIVSLDLQIERDISGLQANLKRFIPDSDINVEIVSDNIVLTGSVRTPQDSSRAQQLAGAF 182

Query: 168 L---SQSGRNQYANSS--------------SKKVMNLLNIAGEDQVTLKVTIAEVRRDIL 210
           L     + R + A+ +              + +++NLL I GEDQVTLKVT+AEV+R +L
Sbjct: 183 LKGGEATTRTETASGTGGDSSVALFAEGRQTSQIVNLLQIEGEDQVTLKVTVAEVKRSVL 242

Query: 211 KQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSV----KGVLDRFSFETVLHALERA 266
           KQIGF + ++ +SSG + +   +      +  G+  +    K  L +++  + L+A+E+A
Sbjct: 243 KQIGFDNLVS-NSSGLTVAQLGNISSDSTAATGNGGLSALFKTALGKYNVSSYLNAMEQA 301

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
            A+RTLAEPTLTAISGQ+A+F SGGQ LY  + S  G  ++T + YG+ L FTP VLS G
Sbjct: 302 GAVRTLAEPTLTAISGQAATFNSGGQTLYSVIDSD-GNVTITPYTYGISLAFTPVVLSAG 360

Query: 327 RIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           RI L +QT+VSEP     A    +Y  R ADT+VELPSGG+I LAGLL D++QQ   G P
Sbjct: 361 RISLHVQTQVSEPTGTTGAA---TYNRRAADTSVELPSGGSIALAGLLSDNVQQSTTGTP 417

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
             SKIPILGALFR   F R+E+E+ I ATP+LV+PVA   ++RPDD++S  +DA  FF N
Sbjct: 418 GASKIPILGALFRQKTFQRDESELVIIATPYLVRPVARNQIARPDDNFSPTNDAGVFFMN 477

Query: 447 RVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           RVNKIYG K+A  V   ++ G +GFIYK
Sbjct: 478 RVNKIYGRKDAPPVADADFHGTVGFIYK 505


>gi|218516388|ref|ZP_03513228.1| pilus assembly secretion protein [Rhizobium etli 8C-3]
          Length = 436

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 219/441 (49%), Positives = 296/441 (67%), Gaps = 25/441 (5%)

Query: 54  LNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLD 113
           +NK +++ +P D  D+LVSDP+ AD V  + R +YLFGK VGQ N+ + G  G++++NLD
Sbjct: 1   MNKAVVVDLPEDAHDILVSDPSMADAVTRTSRRIYLFGKKVGQTNIFVFGAGGQEIINLD 60

Query: 114 ILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL---SQ 170
           I IERD++ LE  LRRFI DSNI VE+VSD +VL G VRT QD+ +A +L++ FL     
Sbjct: 61  IEIERDVSGLEANLRRFIPDSNINVEIVSDNIVLTGTVRTPQDATQAADLAQVFLKGGEA 120

Query: 171 SGRNQYANSS--------------SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ 216
           + R + A+ +              + +V+NLL I GEDQVTLKVTIAEVRR++LKQ+GF 
Sbjct: 121 TTRTETASGTGGDSAVALFAEGRQTSQVVNLLKIEGEDQVTLKVTIAEVRREVLKQLGFD 180

Query: 217 HSITGSSSGPSKSF---AADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLA 273
           + I+ SS          +AD     V  G     K  + ++   T L+ALE+A  +RTLA
Sbjct: 181 NLISNSSGMTVAQLGTPSADSATATVGGGLAALFKSSIGKYDISTYLNALEQAKVVRTLA 240

Query: 274 EPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQ 333
           EPTLTAISGQ+A+F SGGQ LY T + + G  +V   +YG+ L F P VLS GRI L I+
Sbjct: 241 EPTLTAISGQAATFNSGGQQLYST-TDNDGNVTVVPFNYGINLAFKPVVLSSGRISLEIK 299

Query: 334 TEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPI 393
           T VSEPV G  +G+  +Y+ R A+T+VELPSGG+I LAGL++D++ Q   G P +SKIP+
Sbjct: 300 TNVSEPVAG--SGNA-TYQRRSAETSVELPSGGSIALAGLIRDNVSQTMGGTPGVSKIPL 356

Query: 394 LGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYG 453
           LG LFR   F R+ETE+ I ATP+LV+PVA   L+RPDD++S E+D   FF NRVNK+YG
Sbjct: 357 LGTLFRQKGFERQETELVIIATPYLVRPVARNQLNRPDDNFSPENDGATFFLNRVNKVYG 416

Query: 454 PKEASEVEGQNYKGAIGFIYK 474
            +EA   + Q + G+IGFIYK
Sbjct: 417 RREAPVADAQ-FHGSIGFIYK 436


>gi|218680971|ref|ZP_03528868.1| putative pilus assembly protein [Rhizobium etli CIAT 894]
          Length = 434

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 218/438 (49%), Positives = 297/438 (67%), Gaps = 25/438 (5%)

Query: 52  IGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLN 111
           +GLNK +++ +P D  D+LVSDPT AD V  + R +YLFGK VGQ N+ + G  G++++N
Sbjct: 2   LGLNKAVVVDLPEDAHDILVSDPTMADAVTRTSRRIYLFGKKVGQTNIFVFGAGGQEIVN 61

Query: 112 LDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL--- 168
           LDI IERD++ LE+ LRRFI DSNI VE+VSD +VL G VRT QD+ +A +L++ FL   
Sbjct: 62  LDIEIERDVSGLEVNLRRFIPDSNINVEIVSDNIVLTGTVRTPQDATQAADLAQVFLKGG 121

Query: 169 SQSGRNQYANSS--------------SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
             + R + A+ +              + +V+NLL I GEDQVTLKVTIAEVRR++LKQ+G
Sbjct: 122 EATTRTETASGTGGDSSVALFAEGRQASQVVNLLQIEGEDQVTLKVTIAEVRREVLKQLG 181

Query: 215 FQHSITGSSS---GPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRT 271
           F + ++ SS        S +AD     V  G     K  + ++   T L+ALE+A  ++T
Sbjct: 182 FDNLVSNSSGMTVAQLGSPSADSATSTVGGGLAALFKSTIGKYDISTYLNALEQAKVVKT 241

Query: 272 LAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           LAEPTLTAISGQ+A+F SGGQ LY T + S G  +VT  +YG+ L F P VLS GRI L+
Sbjct: 242 LAEPTLTAISGQAATFNSGGQQLYST-TDSDGNVTVTPFNYGINLAFKPVVLSSGRISLQ 300

Query: 332 IQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKI 391
           I+T VSEPV G  +G+  +Y+ R A+T+VELPSGG+I LAGL++D++ Q   G P +SKI
Sbjct: 301 IKTNVSEPVAG--SGNA-TYQRRSAETSVELPSGGSIALAGLIRDNVSQTMGGTPGVSKI 357

Query: 392 PILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKI 451
           P+LG LFR   F R+ETE+ I ATP+LV+PVA   L+RPDD++S E+D   FF NRVNK+
Sbjct: 358 PLLGTLFRQKGFERQETELVIIATPYLVRPVARNQLNRPDDNFSPENDGATFFLNRVNKV 417

Query: 452 YGPKEASEVEGQNYKGAI 469
           YG +EA   + Q + G+I
Sbjct: 418 YGRREAPVADAQ-FHGSI 434


>gi|325291659|ref|YP_004277523.1| component of type IV pilus [Agrobacterium sp. H13-3]
 gi|325059512|gb|ADY63203.1| component of type IV pilus [Agrobacterium sp. H13-3]
          Length = 527

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 222/499 (44%), Positives = 322/499 (64%), Gaps = 51/499 (10%)

Query: 20  NPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADV 79
           +P+  ++   +  +A+++ I++   G  K++ +GLNK +++ +P D  D+LV+DP+ AD 
Sbjct: 36  SPAFLRISEAEAQSASIVRITESGSGIRKRLKLGLNKALVIDLPEDAHDILVADPSLADA 95

Query: 80  VVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVE 139
           V  + + +YLFGK VGQ N+ + G  G+++++LD+ +ERDI+ LE  +RRFI +S+I+VE
Sbjct: 96  VTRTSKRIYLFGKTVGQTNIFIFGDGGREIVSLDLEVERDISGLEANIRRFIPESDIKVE 155

Query: 140 MVSDTVVLHGMVRTIQDSQRAVELSETFL----------SQSGRNQYA-------NSSSK 182
           +VSD +VL G VRT QDS RAV+L+E FL          S +G N          N  + 
Sbjct: 156 IVSDNIVLTGSVRTPQDSARAVQLAEAFLKGGEATTRNISLTGGNNGGDAAIFAENRQTS 215

Query: 183 KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS-------SGPSKSFAADFG 235
           +++N+L I GEDQVTLKVT+AEV R +LKQ+GF  SI+ S+       S PS    A  G
Sbjct: 216 QIVNMLTIEGEDQVTLKVTVAEVSRQVLKQLGFNGSISSSTSNNGFEFSNPSNLGNAISG 275

Query: 236 GKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLY 295
              ++ G   S  G L+   F + L+A+E+A  +RTLAEP+LTAISG+ A F  GG    
Sbjct: 276 ASRIASGAIGS--GSLN---FASYLNAMEQAGVVRTLAEPSLTAISGEQAKFYVGGDFRL 330

Query: 296 K-----TVSSSTGATSVT----THDYGVVLHFTPTVLSPGRIGLRIQTEVSEP-----VI 341
                 T+   TG  ++T    T DYG+ L+F P VLSPGRI L+I+T VSEP     V+
Sbjct: 331 PAEQEVTIDKDTGQPTITRTTNTVDYGITLNFRPVVLSPGRISLKIETNVSEPTYEGNVV 390

Query: 342 GVNAG-DMP-----SYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILG 395
             NAG  +P     S R R+  TTVELPSGG+IV+AGL++D+I+Q   G+P +SK+PI G
Sbjct: 391 TGNAGRTIPGSTYMSIRKRETSTTVELPSGGSIVIAGLVQDNIRQAMSGLPGISKVPIFG 450

Query: 396 ALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPK 455
            LFR+  F R ETE+ I ATP+LV+PVA   ++RPDD+++ E+DA  +F NRVNK+YG K
Sbjct: 451 TLFRSKDFIRNETELVIIATPYLVRPVARNQIARPDDNFNPENDAAMYFMNRVNKVYGRK 510

Query: 456 EASEVEGQNYKGAIGFIYK 474
           +  +V+   Y+G++GFIYK
Sbjct: 511 D--QVQAAPYQGSVGFIYK 527


>gi|15887573|ref|NP_353254.1| component of type IV pilus [Agrobacterium tumefaciens str. C58]
 gi|15155110|gb|AAK86039.1| component of type IV pilus [Agrobacterium tumefaciens str. C58]
          Length = 527

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 217/496 (43%), Positives = 317/496 (63%), Gaps = 45/496 (9%)

Query: 20  NPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADV 79
           +P   +    +  +A+++ I++   G  K++ +GLNK +++ +P D  D+LV+DP+ AD 
Sbjct: 36  SPDFLRTSEAEAQSASIVRITESGTGIRKRLKLGLNKALVIDLPEDAHDILVADPSLADA 95

Query: 80  VVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVE 139
           V  + R +YLFGK VGQ N+ + G  G+++++LD+ +ERDI+ LE  +RRFI +S+I+VE
Sbjct: 96  VTRTSRRIYLFGKMVGQTNIFIFGDGGREIVSLDLEVERDISGLEANIRRFIPESDIKVE 155

Query: 140 MVSDTVVLHGMVRTIQDSQRAVELSETFL----------SQSGRNQYANSS-------SK 182
           +VSD +VL G VRT QDS RAV+L++ FL          S +G N   +++         
Sbjct: 156 IVSDNIVLTGSVRTPQDSARAVQLADAFLKGGEATTRNISLTGGNNGGDAAIFAERRQVS 215

Query: 183 KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFA--ADFGGKFVS 240
           +++N+L I GEDQVTLKVT+AEV R +LKQ+GF  SI+ S+SG    FA  ++ G     
Sbjct: 216 QIVNMLTIEGEDQVTLKVTVAEVSRQVLKQLGFNGSISSSTSGNGFEFANPSNLGNAI-- 273

Query: 241 EGGDFSVKGVLDRFS--FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKT- 297
           +G      G +   S  F + L+A+E+A  +RTLAEP+LTAISG+ A F  GG       
Sbjct: 274 DGASRIASGAIGSGSLRFASYLNAMEQAGVMRTLAEPSLTAISGEQAKFYVGGDFRLAAE 333

Query: 298 ----VSSSTGATSVT----THDYGVVLHFTPTVLSPGRIGLRIQTEVSEP------VIGV 343
               +   TG  ++T    T DYG+ L+F P VLSPGRI L+I+T VSEP      V G 
Sbjct: 334 QEVDIDKETGRPTITRTTNTVDYGITLNFKPVVLSPGRISLKIETNVSEPTYEGNVVTGN 393

Query: 344 NAGDMP-----SYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALF 398
               +P     S R R+  TTVELPSGG+IV+AGL++D+++Q   G+P +SKIPI G LF
Sbjct: 394 GGRTIPGSTYMSVRKRETSTTVELPSGGSIVIAGLVQDNVRQAMSGLPGMSKIPIFGTLF 453

Query: 399 RNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEAS 458
           R+  F R ETE+ I ATP+LV+PVA   ++RPDD+++ E+DA  +F NRVNK+YG K+  
Sbjct: 454 RSKEFLRNETELVIIATPYLVRPVARNQIARPDDNFNPENDAAMYFMNRVNKVYGRKD-- 511

Query: 459 EVEGQNYKGAIGFIYK 474
           +V+   Y+G++GFIYK
Sbjct: 512 QVQAAPYQGSVGFIYK 527


>gi|222147182|ref|YP_002548139.1| component of type IV pilus [Agrobacterium vitis S4]
 gi|221734172|gb|ACM35135.1| component of type IV pilus [Agrobacterium vitis S4]
          Length = 525

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 225/522 (43%), Positives = 315/522 (60%), Gaps = 51/522 (9%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPP----IKEANA------AVINISDVEIGKGKKI 50
           MR      F MM     S   S++ LP     +  A+A      +++ I+    G  + +
Sbjct: 7   MRLSSARLFRMMITGSLSLGLSISGLPGENMLVWRADALAAGAQSLVRIAQTGPGVRRDL 66

Query: 51  SIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQML 110
            +GLNK I++ +P D  D+LV+DP  AD V  + R +YLFGK VGQ N+ + G DG++++
Sbjct: 67  KLGLNKAIVVDLPEDAHDILVADPELADAVTRTSRRIYLFGKKVGQTNIFIFGADGREIV 126

Query: 111 NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL-- 168
           +LD+ IERDI  L+  L RFI +SNI+VE++SD VVL G VRT QDS RAV L++ FL  
Sbjct: 127 SLDLQIERDIEGLQTNLSRFIPESNIKVEIISDNVVLSGTVRTPQDSSRAVSLAKAFLQG 186

Query: 169 ---SQSGRNQYANSS-------------SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQ 212
              +  G    +NSS             + +++N+L I GEDQVTLKVT+AEV R +LKQ
Sbjct: 187 GEATTRGETATSNSSGDGAVAIYAEDRQTSQIVNMLTIEGEDQVTLKVTVAEVSRQVLKQ 246

Query: 213 IGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTL 272
           +G   S T  +SG S +  ++ G   V  GG  ++      F     ++A+E+A  +RTL
Sbjct: 247 LGVSASATDGTSGISYANPSNLGNS-VDVGGTATISKTFGSFGISAYVNAMEQAGVMRTL 305

Query: 273 AEPTLTAISGQSASFTSGGQHLYK-----TVSSSTGATSV----TTHDYGVVLHFTPTVL 323
           AEP+LTAISG+ A F  GG++        +  S+TG  +V    +T DYG+ L+F P VL
Sbjct: 306 AEPSLTAISGEQAKFYVGGEYRLAAGQEISTDSTTGQKTVSRTTSTVDYGIQLNFRPVVL 365

Query: 324 SPGRIGLRIQTEVSEP------VIGVNAGDMP-----SYRVRKADTTVELPSGGTIVLAG 372
           SPGRI L I+T VSEP      V G +   +P     S R R+A TTVELPSGG+IV+AG
Sbjct: 366 SPGRISLAIETNVSEPTYEGSVVEGNSDSSIPGSTYLSIRKREASTTVELPSGGSIVIAG 425

Query: 373 LLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDD 432
           L++D+++Q   G+P +SKIPI G LFR+  F R ETE+ I ATP+LV+PV    L+RPDD
Sbjct: 426 LVQDNVRQAMSGLPGISKIPIFGTLFRSKDFVRNETELVIIATPYLVRPVTRNALARPDD 485

Query: 433 HYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           +++   D   +F NRVNK+YG KEA+      Y G +G+IYK
Sbjct: 486 NFNPAGDGAMYFLNRVNKVYGRKEAT--ANGAYHGTVGYIYK 525


>gi|15963894|ref|NP_384247.1| putative pilus assembly transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|307315791|ref|ZP_07595305.1| type II and III secretion system protein [Sinorhizobium meliloti
           BL225C]
 gi|307320426|ref|ZP_07599843.1| type II and III secretion system protein [Sinorhizobium meliloti
           AK83]
 gi|15073069|emb|CAC41528.1| Pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|306893992|gb|EFN24761.1| type II and III secretion system protein [Sinorhizobium meliloti
           AK83]
 gi|306898559|gb|EFN29232.1| type II and III secretion system protein [Sinorhizobium meliloti
           BL225C]
          Length = 511

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 218/498 (43%), Positives = 315/498 (63%), Gaps = 37/498 (7%)

Query: 12  MSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLV 71
           +S  L  S  ++  LP  + A+++V+ I D   G  K I++GLNK +++ +P D  D+LV
Sbjct: 16  LSFCLTFSGMALPTLPAAEAASSSVVRIVDSGPGARKTINLGLNKAVVVDLPSDAHDILV 75

Query: 72  SDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFI 131
           +DP+ AD +  + R +YLFGK+VGQ N+ + G  G+++++L++ +ERD+A LE  LRRFI
Sbjct: 76  ADPSLADAITRTSRRIYLFGKSVGQTNIFVFGPGGEEIVSLEVAVERDVAGLEANLRRFI 135

Query: 132 ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL----------SQSGRNQYA---- 177
            D++I VE++SD VVL G VRT  DS RAV+L+  FL          +  G N  A    
Sbjct: 136 PDADINVEIISDNVVLTGTVRTPLDSTRAVDLARAFLKGGEATTRNITAQGNNGDADIFA 195

Query: 178 -NSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGG 236
            +  + +++NLL I G+DQVTLKVT+AEV R +LKQ+GF   ++   SG S    A+  G
Sbjct: 196 EDRQNSQIVNLLTIEGDDQVTLKVTVAEVSRQVLKQLGFNGRVSDGESGISFRNPANL-G 254

Query: 237 KFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYK 296
             ++ G +  +KG +   +  + ++A+E+A  +RTLAEP+LTAISGQ A F  GG+    
Sbjct: 255 DAIAVGTNALIKGSIGPTTISSYINAMEQAGVMRTLAEPSLTAISGQEAKFYVGGEFRLA 314

Query: 297 TVSS-----STGATSVTTH----DYGVVLHFTPTVLSPGRIGLRIQTEVSEP------VI 341
            V        TG T+V       +YG+ L+F P VL PGRI L+I+T+VSEP      V 
Sbjct: 315 GVQEVSTDDETGQTTVEREVNDVEYGIRLNFKPVVLGPGRISLQIETDVSEPTYEGSVVT 374

Query: 342 GVNAGDMP-----SYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
           G +   +P       R R+A T+VELPSGG+IV+AGL++D+I+Q   G+P  SKIPILG 
Sbjct: 375 GNSMTAIPGNTFLGIRRREASTSVELPSGGSIVIAGLVQDNIRQAMSGLPGASKIPILGT 434

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKE 456
           LFR+  F R ETE+ I ATP+LV+PVA   +SRPDD+++  +D ++FF  RVN+IYG  E
Sbjct: 435 LFRSKDFQRSETELVIIATPYLVRPVARSAISRPDDNFNPANDLESFFLGRVNRIYGRPE 494

Query: 457 ASEVEGQNYKGAIGFIYK 474
           A    G+ Y G +GFIYK
Sbjct: 495 AQPPAGR-YHGNVGFIYK 511


>gi|241518288|ref|YP_002978916.1| type II and III secretion system protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240862701|gb|ACS60365.1| type II and III secretion system protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 512

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 206/463 (44%), Positives = 290/463 (62%), Gaps = 31/463 (6%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVG 95
           VI++++  +   + +SIGLNK +I+++P D  D++VSDP  +D +V + RT++LFGK VG
Sbjct: 57  VISVTETGVNVTRHVSIGLNKTLIVELPQDAHDIVVSDPGVSDAIVRATRTIFLFGKKVG 116

Query: 96  QANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
           Q N+ ++  + + ++N+DI +ERDIA LE  LRR I D+ I+VE++SD +VL G VR+ Q
Sbjct: 117 QTNIFILDANKRPIVNIDIAVERDIAGLETDLRRLIPDAAIKVEIISDNIVLTGTVRSAQ 176

Query: 156 DSQRAVELSETFLSQSGRNQYA-----------------NSSSKKVMNLLNIAGEDQVTL 198
           DS +A +L+  F+                          +    K++NLL IA +DQV L
Sbjct: 177 DSAQAADLASAFVKGGEATTRTQSASSGGSQGSVALVAEDRQESKIINLLRIAADDQVML 236

Query: 199 KVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG-----GKFVSEGGDFSV--KGVL 251
           K+TIAEV+R+ILKQ+GF + +  +      S  A  G         + GG  S    G  
Sbjct: 237 KMTIAEVKREILKQLGFDNELKNAGG----STIAQLGTASTDATTATSGGGLSALFSGSF 292

Query: 252 DRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHD 311
            +    T L+ALE+A  +RTLAEPTLTA+SGQSASF +GG+ LY   +   G T+ T + 
Sbjct: 293 GKHGLSTTLNALEQAKVVRTLAEPTLTAVSGQSASFQAGGEVLYSN-TDRDGNTTQTPYS 351

Query: 312 YGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLA 371
           YG+ L F P VL+ GRI L+I TEVSEPV  + +G  P+Y  R   TTVELPSGG+I LA
Sbjct: 352 YGISLSFKPIVLTSGRISLQISTEVSEPVTSI-SGSSPTYGKRSTSTTVELPSGGSIALA 410

Query: 372 GLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           GL++D+  +   G P+L+KIP  GALFR + F R ETE+ I ATP+LV+PVA +DL+RPD
Sbjct: 411 GLIRDNFNRTSNGTPVLNKIPGFGALFRQTSFERNETELVIIATPYLVRPVAAKDLNRPD 470

Query: 432 DHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           D+ S  DDA     +R+NK+YG  +  E   Q Y G +GFIYK
Sbjct: 471 DNLSPADDASQGLLDRINKLYGNGKTLEPTAQ-YHGTVGFIYK 512


>gi|163757627|ref|ZP_02164716.1| putative pilus assembly transmembrane protein [Hoeflea
           phototrophica DFL-43]
 gi|162285129|gb|EDQ35411.1| putative pilus assembly transmembrane protein [Hoeflea
           phototrophica DFL-43]
          Length = 496

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 219/473 (46%), Positives = 300/473 (63%), Gaps = 25/473 (5%)

Query: 20  NPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADV 79
           +P+  +L    +A+  +I I     G  K++ +GLNK I++ +P D  D+LV+DP  AD 
Sbjct: 31  DPTTGRLATPAQASQNIIKIKKSGPGVSKRVKLGLNKAIVVDLPTDAHDILVADPALADA 90

Query: 80  VVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVE 139
           V  + R +YLFGK VGQ N+ + G +G++++ +++ IERD+A LE+ L RF+ DSNI+VE
Sbjct: 91  VTRTSRRLYLFGKTVGQTNIFVFGPNGEEIIAIELEIERDVAGLEVHLARFLPDSNIQVE 150

Query: 140 MVSDTVVLHGMVRTIQDSQRAVELSETFL------------SQSGRNQYANSSSK---KV 184
           ++SD +VL G VRT QD+ +A  L+E FL            +  G +   N+  +   K+
Sbjct: 151 IISDNIVLTGSVRTPQDASQAARLAEIFLTGGEATTRVTTATSEGGDAAINAEDRQKSKI 210

Query: 185 MNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG---SSSGPSKSFAADFGGKFVSE 241
           +NLL I GEDQVTLKVTIAEV R +LKQ+GF  +I+G   SS G S S      G   S 
Sbjct: 211 VNLLKIDGEDQVTLKVTIAEVSRQVLKQLGFNTTISGDGSSSFGNSPSPWLSVPG-LASV 269

Query: 242 GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS 301
           G   SV G +        + ALERA  IRTLAEP+LTAISG+ A F+ GG    ++    
Sbjct: 270 G---SVAGTISGARISADISALERAGVIRTLAEPSLTAISGEVARFSVGGSFEIESERDE 326

Query: 302 TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVE 361
            G T     +YG+ L FTP VL+PGRI LRI+TEVSEP        +PS + R+A+T+VE
Sbjct: 327 DG-TIFEEKEYGIKLEFTPVVLAPGRISLRIKTEVSEPTF-EGQSPLPSIQKREAETSVE 384

Query: 362 LPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
           LPSGG++VLAGL++D  +Q   G+P  SKIP+LG+LFR+  F R ETE+ I ATP+LVKP
Sbjct: 385 LPSGGSMVLAGLVRDSYRQTISGMPGASKIPVLGSLFRSKEFLRNETELVIIATPYLVKP 444

Query: 422 VAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           VA  +LSRPDD+++   D   FF  RVN++YG  E     G+ Y GA+GFIYK
Sbjct: 445 VARNELSRPDDNFNAPSDGAGFFLGRVNRVYGQMETGLPAGR-YHGAVGFIYK 496


>gi|227823971|ref|YP_002827944.1| pilus assembly protein CpaC, contains signal peptide [Sinorhizobium
           fredii NGR234]
 gi|227342973|gb|ACP27191.1| pilus assembly protein CpaC, contains signal peptide [Sinorhizobium
           fredii NGR234]
          Length = 515

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 225/518 (43%), Positives = 319/518 (61%), Gaps = 47/518 (9%)

Query: 1   MRYLQRTFFTMMSIFL-FSSNPSVAKLPPIKEANAA---VINISDVEIGKGKKISIGLNK 56
           M+    TF T ++  L FS   S   LP +  A AA   V+ I +   G  +K+++GLNK
Sbjct: 1   MKRSGNTFRTCLAAGLSFSLTFSGLMLPAVPTAQAAASSVVRIVESGPGVKRKVNLGLNK 60

Query: 57  VIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILI 116
            +++ +P D  D+LV+DP  AD V  + R +YLFGK VGQ N+ + G +G+++++L++ +
Sbjct: 61  AVVVDLPTDAHDILVADPVLADAVTRTSRRIYLFGKTVGQTNIFVFGPNGEEIVSLEVAV 120

Query: 117 ERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSG---- 172
           ERD+A LE  LRRFI +++I VE++SD VVL G VRT  DS +AV+L+  FL Q G    
Sbjct: 121 ERDVAGLEANLRRFIPEADINVEIISDNVVLTGTVRTPLDSTKAVDLARAFL-QGGEATT 179

Query: 173 RNQYANSS------------SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           RN  A  +            + +++NLL + GEDQVTLKVT+AEV R +LKQ+GF   I+
Sbjct: 180 RNITAQGTNGDADIFAEERQTSQIVNLLTVEGEDQVTLKVTVAEVSRQVLKQLGFNGRIS 239

Query: 221 GSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAI 280
              SG S    A+  G  +  G +  +KG +   +  + ++A+E+A  +RTLAEP+LTAI
Sbjct: 240 DGESGLSFRNPANL-GDAIGVGANALIKGSIGPTTISSYINAMEQAGVMRTLAEPSLTAI 298

Query: 281 SGQSASFTSGG-------QHLYKTVSSSTGAT------SVTTHDYGVVLHFTPTVLSPGR 327
           SGQ A F  GG       Q +      +TG +       V   +YG+ L+F P VL  GR
Sbjct: 299 SGQEAKFYVGGEFRLAGVQEITTEEDEATGESVPVVEREVEDAEYGIRLNFKPVVLGAGR 358

Query: 328 IGLRIQTEVSEP------VIGVNAGDMP-----SYRVRKADTTVELPSGGTIVLAGLLKD 376
           I L I+TEVSEP      V G +  D+P       R R+A T+VELPSGG+IV+AGL++D
Sbjct: 359 ISLAIETEVSEPTYEGSVVTGNSFRDIPGNTFLGIRRREASTSVELPSGGSIVIAGLVQD 418

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSV 436
           +I+Q   G+P  SKIPILG LFR+  F R E+E+ I ATP+LV+PVA   LSRPDD+++ 
Sbjct: 419 NIRQAMSGLPGASKIPILGTLFRSKDFQRNESELVIIATPYLVRPVARSALSRPDDNFNP 478

Query: 437 EDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
            +D ++FF  RVN+IYG  EA+   G+ Y G +GFIYK
Sbjct: 479 ANDLESFFVGRVNRIYGRPEAAPPVGR-YHGNVGFIYK 515


>gi|150398541|ref|YP_001329008.1| type II and III secretion system protein [Sinorhizobium medicae
           WSM419]
 gi|150030056|gb|ABR62173.1| type II and III secretion system protein [Sinorhizobium medicae
           WSM419]
          Length = 524

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 211/474 (44%), Positives = 302/474 (63%), Gaps = 37/474 (7%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVG 95
           V+ I +   G  K I++GLNK +++ +P D  D+LV+DP+ AD +  + R +YLFGK+VG
Sbjct: 53  VVRIVNSGPGARKTINLGLNKAVVVDLPSDAHDILVADPSLADAITRTSRRIYLFGKSVG 112

Query: 96  QANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
           Q N+ + G  G+++++L++ +ERD+A LE  LRRFI D++I+VE++SD VVL G VRT  
Sbjct: 113 QTNIFVFGPGGEEIVSLEVAVERDVAGLESNLRRFIPDADIKVEIISDNVVLTGTVRTPL 172

Query: 156 DSQRAVELSETFL----------SQSGRNQYA-----NSSSKKVMNLLNIAGEDQVTLKV 200
           DS RAV+L+  FL          +  G N  A     +  S +++NLL I G+DQVTLKV
Sbjct: 173 DSTRAVDLARAFLKGGEATTRNITAQGNNGDADIFAEDRQSSQIVNLLTIEGDDQVTLKV 232

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVL 260
           T+AEV R +LKQ+GF   ++   SG S    A+  G  +  G +  +KG +   +  + +
Sbjct: 233 TVAEVSRQVLKQLGFNGRVSDGESGISFRNPANL-GDMIGIGTNALIKGSIGGTTISSYI 291

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS-----STGATSVTTH----D 311
           +A+E+A  +RTLAEP+LTAISGQ A F  GG+     V        +G T+V       +
Sbjct: 292 NAMEQAGVMRTLAEPSLTAISGQEAKFYVGGEFRLAGVQEVSTDDDSGETTVEREVNDVE 351

Query: 312 YGVVLHFTPTVLSPGRIGLRIQTEVSEP------VIGVNAGDMP-----SYRVRKADTTV 360
           YG+ L+F P VL PGRI L+I+T+VSEP      V G    ++P       R R+A T+V
Sbjct: 352 YGIRLNFKPVVLGPGRISLQIETDVSEPTYEGSVVTGNGTVNIPGNTFLGIRRREASTSV 411

Query: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           ELPSGG+IV+AGL++D+I+Q   G+P  SKIPILG LFR+  F R ETE+ I ATP+LV+
Sbjct: 412 ELPSGGSIVIAGLVQDNIRQAMSGLPAASKIPILGTLFRSKDFQRSETELVIIATPYLVR 471

Query: 421 PVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           PVA   +SRPDD+++  +D ++FF  RVN+IYG  EA    G+ Y G +GFIYK
Sbjct: 472 PVARSAISRPDDNFNPANDLESFFLGRVNRIYGRAEAQPPAGR-YHGNVGFIYK 524


>gi|260461949|ref|ZP_05810194.1| type II and III secretion system protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259032196|gb|EEW33462.1| type II and III secretion system protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 505

 Score =  359 bits (921), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 196/471 (41%), Positives = 297/471 (63%), Gaps = 51/471 (10%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           +++ +GLNK +++ +P D  D+LV++P+ AD V  + R +YLFGK VG+ N+ + G +G+
Sbjct: 42  QRVKLGLNKSVVIDLPSDAYDILVANPSVADAVTRTARRIYLFGKAVGETNIFVFGPNGE 101

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
           Q+ +LD+ +ERD+A LE  +RRFI  S+I+VE+++D VVL G V T  DS+RAV+L+  F
Sbjct: 102 QIASLDLAVERDVAGLEDYIRRFIPTSDIKVELLNDNVVLTGTVDTPLDSKRAVDLATIF 161

Query: 168 LS--QSGRNQYANSS-------------------SKKVMNLLNIAGEDQVTLKVTIAEVR 206
           +S  ++   QY+ ++                   + K++NLL I G+DQVTLKVT+AEV 
Sbjct: 162 VSGGEATTGQYSQTAAGGSAQSGVDINNPDQERRTSKIVNLLQIIGDDQVTLKVTVAEVS 221

Query: 207 RDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGV-LDRFSFETVLHALER 265
           R ++KQ+G     +G S+G S    +D    F   G   S  G  ++    +  ++A+E+
Sbjct: 222 RSVMKQLGVNMVGSGGSNGISYGALSD---PFTGLGKPLSNAGFSINASGLQAYINAMEQ 278

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQH-LYKTVSSSTGAT--------SVTTHDYGVVL 316
           +  ++TLAEPTLTA+SG+ A+F  GG++ +   VS++  A         SV   +YG+ L
Sbjct: 279 SGVMKTLAEPTLTAVSGEKATFKVGGEYNMVTGVSANVSADNQTGLKTYSVDKIEYGIGL 338

Query: 317 HFTPTVLSPGRIGLRIQTEVSEPVI-------------GVNAGDMPSYRVRKADTTVELP 363
            F P VLSPGRI L+++T VSEP               G+NA    S R R ADTTVELP
Sbjct: 339 EFQPVVLSPGRISLKVRTSVSEPTTEGSVSSSTSNTSVGMNA---LSLRKRLADTTVELP 395

Query: 364 SGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA 423
           SGG++++AGL++DD++Q   G+P L+KIP+LGALFR+  F R ETE+ I  TP+LVKPVA
Sbjct: 396 SGGSMMIAGLVRDDVRQAVNGLPGLTKIPVLGALFRSRDFVRNETELVIIITPYLVKPVA 455

Query: 424 MRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
             DL++PDD+++   D  A F  +VN++YG  +  +  G+ Y G +G+IYK
Sbjct: 456 RNDLAKPDDNFNAASDGAAMFLGKVNRVYGTMQTDKPNGR-YHGVVGYIYK 505


>gi|13474660|ref|NP_106229.1| exporter protein, cpaC [Mesorhizobium loti MAFF303099]
 gi|14025415|dbj|BAB52015.1| exporter protein; CpaC [Mesorhizobium loti MAFF303099]
          Length = 471

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 195/468 (41%), Positives = 298/468 (63%), Gaps = 45/468 (9%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           +++ +GLNK +++ +P D  D+LV++PT AD V  + R +YLFGK+VG+ N+ + G +G+
Sbjct: 8   QRVKLGLNKSVVIDLPSDAYDILVANPTVADAVTRTARRIYLFGKSVGETNIFVFGPNGE 67

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
           Q+ +LD+ +ERD+A LE  +RRF+  S+++VE+++D VVL G V T  D++RAV+L+  F
Sbjct: 68  QIASLDLAVERDVAGLEDYIRRFLPTSDVKVELLNDNVVLTGTVDTPLDAKRAVDLATIF 127

Query: 168 LS--QSGRNQYANSSS-------------------KKVMNLLNIAGEDQVTLKVTIAEVR 206
           +S  ++   QY+ +++                    K++NLL I G+DQVTLKVT+AEV 
Sbjct: 128 VSGGEATTGQYSQTAAGGSAQGGVDINNPDQERRVSKIVNLLQIIGDDQVTLKVTVAEVS 187

Query: 207 RDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGV-LDRFSFETVLHALER 265
           R ++KQ+G      G S+G S    +D    F   G   S  G  +   +    ++A+E+
Sbjct: 188 RSVMKQLGVNMVGNGGSNGISYGALSD---NFTGLGKQLSHSGFNIGNSALMAYINAMEQ 244

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQH-LYKTVS---SSTGATSVTTH-----DYGVVL 316
           +  ++TLAEPTLTA+SG+ A+F  GG++ L   VS   SS   T +TT+     +YG+ L
Sbjct: 245 SGVMKTLAEPTLTAVSGEKATFKVGGEYNLLTGVSQNVSSDNQTGLTTYTINKIEYGIGL 304

Query: 317 HFTPTVLSPGRIGLRIQTEVSEPVI--------GVNA--GDMPSYRVRKADTTVELPSGG 366
            F P VLSPGRI L+++T VSEP          GV +   +M S R R ADTTVELPSGG
Sbjct: 305 EFQPVVLSPGRISLKVRTSVSEPTTEGSVALSNGVTSPGANMLSLRKRLADTTVELPSGG 364

Query: 367 TIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRD 426
           ++++AGL++DD++Q   G+P L+KIP+LGALFR+  F R E+E+ I  TP+L KPVA  D
Sbjct: 365 SMMIAGLVRDDVRQAVNGLPGLTKIPVLGALFRSRDFVRNESELVIIITPYLAKPVARND 424

Query: 427 LSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           L++PDD+++   D  A F  +VN++YG  +  +  G+ Y G +G+IYK
Sbjct: 425 LAKPDDNFNPASDGAANFLGKVNRVYGTMQTDKPNGR-YHGVVGYIYK 471


>gi|319785608|ref|YP_004145084.1| type II and III secretion system protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317171496|gb|ADV15034.1| type II and III secretion system protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 506

 Score =  352 bits (903), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 191/468 (40%), Positives = 293/468 (62%), Gaps = 45/468 (9%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           +++ +GLNK +++ +P D  D+LV++P  AD V  + R +YLFGK VG+ N+ + G +G+
Sbjct: 43  QRVKLGLNKSVVIDLPSDAYDILVANPAVADAVTRTARRIYLFGKAVGETNIFVFGPNGE 102

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
           Q+++LD+ +ERD+A LE  +RRF+  S ++VE+++D VVL G V T  D++RA +L+  F
Sbjct: 103 QIVSLDLAVERDVAGLEDYIRRFLPTSAVKVELLNDNVVLTGTVDTPLDAKRAEQLANMF 162

Query: 168 LS--QSGRNQYANSS-------------------SKKVMNLLNIAGEDQVTLKVTIAEVR 206
           +S  ++   QY+ ++                   + +++NL+ I G+DQVTLKVT+AEV 
Sbjct: 163 VSGGEATTGQYSQTAAGGSAQSGVDINNPDQERRTSQIVNLIQIIGDDQVTLKVTVAEVS 222

Query: 207 RDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGV-LDRFSFETVLHALER 265
           R ++KQ+G     +G S+G S    +D    F   G   S  G  +     +  ++A+E+
Sbjct: 223 RSVMKQLGVNMVGSGGSNGISYGAISD---NFTGLGKQLSNSGFQIGASGLQAYVNAMEQ 279

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS-------TG--ATSVTTHDYGVVL 316
           +  ++TLAEPTLTA+SG+ A+F  GG++   T  S+       TG    SV   +YG+ L
Sbjct: 280 SGVMKTLAEPTLTAVSGEKATFKVGGEYNMVTGVSANVSQDNQTGLKTYSVEKIEYGIGL 339

Query: 317 HFTPTVLSPGRIGLRIQTEVSEPVI--------GVNAGDMPSYRVRK--ADTTVELPSGG 366
            F P VLSPGRI L+++T VSEP          GV +  M +  +RK  ADTTVELPSGG
Sbjct: 340 EFQPVVLSPGRISLKVRTSVSEPTTEGSVSFSSGVTSPGMNALSLRKRLADTTVELPSGG 399

Query: 367 TIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRD 426
           ++++AGL++DD++Q   G+P L+KIP+LGALFR+  F R ETE+ I  TP+LVKPVA  D
Sbjct: 400 SMMIAGLVRDDVRQAVNGLPGLTKIPVLGALFRSRDFVRNETELVIIITPYLVKPVARND 459

Query: 427 LSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           L++PDD+++   D    F  RVN++YG  +  +  G+ Y G +GFIYK
Sbjct: 460 LAKPDDNFNAASDGAGMFLGRVNRVYGTMQTDKPNGR-YHGVVGFIYK 506


>gi|239833237|ref|ZP_04681566.1| type II and III secretion system protein [Ochrobactrum intermedium
           LMG 3301]
 gi|239825504|gb|EEQ97072.1| type II and III secretion system protein [Ochrobactrum intermedium
           LMG 3301]
          Length = 507

 Score =  348 bits (894), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 209/521 (40%), Positives = 303/521 (58%), Gaps = 61/521 (11%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIG---KGKKISIGLNKV 57
           MR   R       I L +   +   LP       A   I  V++G   + + I +GLNK 
Sbjct: 1   MRKTNRVRPYSARIALLAGALATVSLPLADMTAMAAAGI--VKVGSQQRSQTIKLGLNKS 58

Query: 58  IILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIE 117
           ++L +P D  DVLVS+PT AD V  + R +YLFGK VGQ N+ + G +G+Q+ ++D+ IE
Sbjct: 59  VVLDLPQDAYDVLVSNPTIADAVTRTSRRIYLFGKQVGQTNIFVFGQNGEQVASIDVEIE 118

Query: 118 RDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS--QSGRNQ 175
           RD++ L   L+R I  S+IRVE+++D VVL G V+T QDS +A +L+  F+S  ++   Q
Sbjct: 119 RDVSGLSSQLKRLIPGSDIRVELINDNVVLTGTVQTPQDSAQAAKLAGLFVSGGEATTGQ 178

Query: 176 YANSSS-------------------KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ 216
           Y+ ++S                     ++N+L I GEDQVTLKVT+AEV R ++KQ+G  
Sbjct: 179 YSTTASAPTDGGGVAINNPDWGRRQSAIVNMLTIVGEDQVTLKVTVAEVSRSVMKQLGVN 238

Query: 217 HSITGSSSGPSKSFAADFGGKFVSE------GGDFSVKGV-LDRFSFETVLHALERATAI 269
            + +G S+G S      +GG  +SE      G + S  G  L   +F   L A+E A  +
Sbjct: 239 MTGSGVSNGIS------YGG--ISENIAGAIGNNLSDTGFGLATSNFSAYLRAMESAGVM 290

Query: 270 RTLAEPTLTAISGQSASFTSGGQHLYKTVSSST------GATSVTTHDYGVVLHFTPTVL 323
           +TLAEPTLTAISG+ A+F  GG+  Y  ++S T          +   +YG+ L F PTVL
Sbjct: 291 KTLAEPTLTAISGEKAAFNVGGE--YNVINSVTYDDDGKRTNQLAKINYGIGLEFMPTVL 348

Query: 324 SPGRIGLRIQTEVSEPVI----------GVNAGDMPSYRVRKADTTVELPSGGTIVLAGL 373
            PGRI L+I+T VSEP            GV A  + S R R ADTTVELPSGG++++ GL
Sbjct: 349 GPGRISLKIRTSVSEPTTEGAGTTNKMEGVGASVL-SLRKRVADTTVELPSGGSMMIGGL 407

Query: 374 LKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDH 433
           ++D+++Q   G P L+KIP+LGALFR+  F R E+E+ +  TP+L +PVA + L+RPDD+
Sbjct: 408 IRDEVRQSVSGFPGLTKIPVLGALFRSKDFIRNESELVVIVTPYLARPVARQQLARPDDN 467

Query: 434 YSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
            +   D   +   +VN++YG  E     G+ Y G +G+IYK
Sbjct: 468 LNPASDGAGYILGKVNRVYGTMETKLPPGR-YNGVVGYIYK 507


>gi|110636321|ref|YP_676529.1| type II and III secretion system protein [Mesorhizobium sp. BNC1]
 gi|110287305|gb|ABG65364.1| type II and III secretion system protein [Chelativorans sp. BNC1]
          Length = 516

 Score =  348 bits (892), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 197/476 (41%), Positives = 290/476 (60%), Gaps = 54/476 (11%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           +++ +GLNK ++L +P D  D+LV++P  AD V  + R +YLFGK VG+ N+ + G  G+
Sbjct: 46  ERLKLGLNKTLVLDLPSDAYDILVANPAVADAVTRTARRIYLFGKQVGETNIFVFGAGGE 105

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
           Q+  +D+ +ERD+A LE  L+RFI +SNI VE+++D VVL G V T  D+ RA +L+  F
Sbjct: 106 QIARIDVAVERDVAGLEQYLKRFIPNSNIDVELINDNVVLTGTVETPLDASRAAQLATIF 165

Query: 168 LS--QSGRNQYANSSS-------------------KKVMNLLNIAGEDQVTLKVTIAEVR 206
           ++  ++   QY+ +++                    K++N+L I GEDQVTLKVT+AEV 
Sbjct: 166 VTGGEATTGQYSQTAAAPTDGGGVAISNPDSARQVSKIVNMLQIIGEDQVTLKVTVAEVS 225

Query: 207 RDILKQIGFQHSITGSSSGPSKSFAAD--FGGKFVSEGGDFSVKGVLDRFSFETVLHALE 264
           R ++KQ+G     +GS  G S     D  +G    +     ++ G L     +  L+A+E
Sbjct: 226 RSVMKQLGVNMIGSGSLDGISWGAIVDSPYGLGAPASASQLALGGSL----LQGYLNAME 281

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGG-------QHLYKTVSSSTGATSVTTH----DYG 313
           +A  ++TL+EPTLTAISG+ A+F  GG       Q + +  +S   A  +T      DYG
Sbjct: 282 QAGVMKTLSEPTLTAISGEKATFKVGGEFNLVTGQKVEQGDASKGQADQLTYEVEKIDYG 341

Query: 314 VVLHFTPTVLSPGRIGLRIQTEVSEPV-----------IG--VNAGDMPSYRVRK--ADT 358
           + L FTPTVLSPGRI L+++T VSEP            IG   N+  M +  +RK  ADT
Sbjct: 342 IGLEFTPTVLSPGRISLKVRTSVSEPTFEGSFSLGSPSIGGRFNSPGMNALSIRKRLADT 401

Query: 359 TVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFL 418
           TVELPSGG++++AGL++DD++Q   G+P LSKIPILG LFR+  F R ETE+ I  TP+L
Sbjct: 402 TVELPSGGSMMIAGLVRDDVRQTINGLPGLSKIPILGTLFRSRDFVRNETELVIIITPYL 461

Query: 419 VKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
            +PVA   L+RPDD+++   D    F  RVN+IYG  + +  +G+ Y G +G+IYK
Sbjct: 462 ARPVARTALARPDDNFNPPSDGAGIFLGRVNRIYGAMKTNLPKGR-YHGVVGYIYK 516


>gi|153008059|ref|YP_001369274.1| type II and III secretion system protein [Ochrobactrum anthropi
           ATCC 49188]
 gi|151559947|gb|ABS13445.1| type II and III secretion system protein [Ochrobactrum anthropi
           ATCC 49188]
          Length = 507

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 205/521 (39%), Positives = 304/521 (58%), Gaps = 61/521 (11%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIG---KGKKISIGLNKV 57
           MR  +R       + L +S  +   LP    +  A   +  V++G   + + I +GLNK 
Sbjct: 1   MRKTKRVRPYSAKVALLTSALAAFSLPLTDMSAMAAAGV--VKVGSQQRSQTIKLGLNKS 58

Query: 58  IILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIE 117
           ++L +P D  DVLVS+PT AD V  + R +YLFGK VGQ N+ + G +G+Q+ ++D+ IE
Sbjct: 59  VVLDLPQDAYDVLVSNPTIADAVTRTSRRIYLFGKQVGQTNIFVFGPNGEQVASIDVEIE 118

Query: 118 RDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS--QSGRNQ 175
           RD++ +   L+R I  S+IRVE+++D VVL G V+T QDS +A +L+  F+S  ++   Q
Sbjct: 119 RDVSGISSQLKRLIPGSDIRVELINDNVVLTGTVQTPQDSAQAAKLAGLFVSGGEATTGQ 178

Query: 176 YANSSS-------------------KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ 216
           +  ++S                     ++N+L I GEDQVTLKVT+AEV R ++KQ+G  
Sbjct: 179 FTTTASAPTDGGGVAINNPDRNRRASAIVNMLTIVGEDQVTLKVTVAEVSRSVMKQLGVN 238

Query: 217 HSITGSSSGPSKSFAADFGGKFVSE------GGDFSVKGV-LDRFSFETVLHALERATAI 269
            + +G S+G S      +GG  +SE      G + S  G  L   +F   L A+E A  +
Sbjct: 239 MAGSGVSNGIS------YGG--ISESIAGAIGNNLSDTGFGLATSNFSAYLRAMESAGVM 290

Query: 270 RTLAEPTLTAISGQSASFTSGGQHLYKTVSS------STGATSVTTHDYGVVLHFTPTVL 323
           +TLAEPTLTAISG+ A+F  GG+  Y  ++S            +   +YG+ L F PTVL
Sbjct: 291 KTLAEPTLTAISGEKAAFNVGGE--YNVINSVKYDDDGKRTNELAKINYGIGLEFMPTVL 348

Query: 324 SPGRIGLRIQTEVSEPVI----------GVNAGDMPSYRVRKADTTVELPSGGTIVLAGL 373
            PGRI L+I+T VSEP            GV A  + S R R ADTTVELPSGG++++ GL
Sbjct: 349 GPGRISLKIRTSVSEPTTEGAGTTNKMDGVGASVL-SLRKRVADTTVELPSGGSMMIGGL 407

Query: 374 LKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDH 433
           ++D+++Q   G P L+KIP+LGALFR+  F R E+E+ +  TP+L +PVA + L+RPDD+
Sbjct: 408 IRDEVRQSVSGFPGLTKIPVLGALFRSKDFIRNESELVVIVTPYLARPVARQQLARPDDN 467

Query: 434 YSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
            +   D   +   +VN++YG  E     G+ Y G +G+IYK
Sbjct: 468 LNPASDGAGYILGKVNRVYGTMETKLPPGR-YNGVVGYIYK 507


>gi|90419764|ref|ZP_01227673.1| Flp pilus assembly protein, secretin CpaC (type II and type III
           secretion system) [Aurantimonas manganoxydans SI85-9A1]
 gi|90335805|gb|EAS49553.1| Flp pilus assembly protein, secretin CpaC (type II and type III
           secretion system) [Aurantimonas manganoxydans SI85-9A1]
          Length = 540

 Score =  331 bits (848), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 202/537 (37%), Positives = 302/537 (56%), Gaps = 74/537 (13%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           +R   R    +M+    +  P    LP   +A   V+N+        + I++GLNK  ++
Sbjct: 15  LRARLRKLVVVMAAASTALAPLATTLP--AQAEQTVVNVRQ----GSQSINLGLNKTKVI 68

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
            +  D  D+LV++P  AD V    R +Y+FGK +GQ N+++     +Q+ ++D+ IERDI
Sbjct: 69  VLEADAHDILVANPAVADAVTRDARRIYIFGKQIGQTNIVVFDRQNRQIASIDLKIERDI 128

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS--QSGRNQYAN 178
             LE T+R+++  S ++VEM++D VVL+G V+T QD+ +   L+  F++  +    QY  
Sbjct: 129 NGLEATIRKYVPSSVVQVEMLNDNVVLNGTVQTPQDAAKVERLARLFVTGGEGTTGQYIQ 188

Query: 179 SSS---------------------KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH 217
            ++                      +++NLL I GEDQVTLKVT+AEV+R ++KQ+G   
Sbjct: 189 QATASGGAGGGDGDVGFAQEDRRQSQIVNLLQIQGEDQVTLKVTVAEVQRSVVKQLGINS 248

Query: 218 SI-TGSSSGPSKS-FAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEP 275
           +   G + G + S FA    GK +S     +  G +  F     L+A+E+A  +RTLAEP
Sbjct: 249 TAGKGVTYGQTDSPFAL---GKALSSS-MLASAGSIGGFDITAQLNAMEQAGVMRTLAEP 304

Query: 276 TLTAISGQSASFTSGG---------------------------QHLYKTVSSSTGATSV- 307
           +LTAISG+ ASF  GG                           Q +Y T+ +     S+ 
Sbjct: 305 SLTAISGEKASFKVGGEFTVPDAQSYDPGTPARREFQGYDGSGQAIYDTIPAEPPTRSID 364

Query: 308 -TTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP-------VIGVNAGDMPSYRVRK--AD 357
            T  +YG+ L FTP VLSPGRI L+I+T VSEP       + G   G + +  +RK  AD
Sbjct: 365 KTRVEYGIGLDFTPVVLSPGRISLKIRTAVSEPTFEMPFNISGGKDGGVGTVGIRKRLAD 424

Query: 358 TTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPF 417
           TTVELPSGG++V+AGL++D+++Q+  G P LSKIP+LG LFR+  F R ETE+ I  TP+
Sbjct: 425 TTVELPSGGSLVIAGLVRDEVRQVMSGFPGLSKIPVLGTLFRSRDFQRYETELVIIVTPY 484

Query: 418 LVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           LV+PV  + L+RPDD +++  D  A F  RVN++YG  E     G+ Y G +GFIYK
Sbjct: 485 LVRPVPRQALARPDDGFALSSDGAANFLGRVNRVYGHMETKLPPGR-YHGVVGFIYK 540


>gi|114705456|ref|ZP_01438364.1| exporter protein, cpaC [Fulvimarina pelagi HTCC2506]
 gi|114540241|gb|EAU43361.1| exporter protein, cpaC [Fulvimarina pelagi HTCC2506]
          Length = 544

 Score =  327 bits (837), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 192/503 (38%), Positives = 286/503 (56%), Gaps = 77/503 (15%)

Query: 42  VEIGKGK-KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
           V+IG G  +I +GL+K  +L +  D  D+LV++P+ AD +    R +YLFGK VGQ N+I
Sbjct: 49  VQIGAGHTRIELGLDKSKVLVLSADAHDILVANPSIADALTRDRRHIYLFGKQVGQTNLI 108

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           +     +Q+ ++DI IERDIA L   + +++ DS+++VE+++D VVL G VRT  DS+R 
Sbjct: 109 VFDQANRQIASIDIQIERDIAGLSQAIAKYVPDSDVKVEIMNDNVVLTGRVRTPLDSKRV 168

Query: 161 VELSETFLS--QSGRNQYANSSS---------------------KKVMNLLNIAGEDQVT 197
            +++  +L+  ++   QY  S+S                      +++NLL I GEDQVT
Sbjct: 169 SQIASAYLTGGEATTGQYIRSASAGGESEGSNGDVAFASETRRESQIINLLQIEGEDQVT 228

Query: 198 LKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAAD--FGGKFVSEGGDFSVKGVLDRFS 255
           LKVT+AEV+R I+KQ+G   + +    G +     D  FG    +   +F + G +    
Sbjct: 229 LKVTVAEVQRSIIKQLGLNGATSSVIDGMTFGSLIDNPFGLGKAASNSNFGLAGTIGDTG 288

Query: 256 FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHL--------------------- 294
               L A+++A  +RTLAEP LTAISG+SASF  GG+ L                     
Sbjct: 289 IRAQLSAMDQAGVMRTLAEPNLTAISGESASFKVGGEFLLPTGQSYDYGEEAKREFKGFD 348

Query: 295 ------YKTVSSSTGATSVTTH--DYGVVLHFTPTVLSPGRIGLRIQTEVSEP------- 339
                 Y+ V ++    +V T   +YG+ L FTP VLSPGRI L+++T VSEP       
Sbjct: 349 GDGRAIYEEVPATRDVRTVETKTIEYGIGLDFTPVVLSPGRISLKVRTSVSEPTFETPFG 408

Query: 340 --------VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKI 391
                   V G+        R R ADTTVELPSGG++V+AGL++D+++Q+  G P LSK+
Sbjct: 409 SSGGFDGGVTGIG------IRKRLADTTVELPSGGSLVIAGLVRDEVRQVVSGFPGLSKL 462

Query: 392 PILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKI 451
           P+LG+LFR+  F R ETE+ +  TP+LV+PVA   L+RPDD  +   D  + F  ++N++
Sbjct: 463 PVLGSLFRSRDFQRYETELVVIVTPYLVRPVAREALARPDDGLAFASDGASNFLGKINRV 522

Query: 452 YGPKEASEVEGQNYKGAIGFIYK 474
           YG  E     G+ Y G +G+IYK
Sbjct: 523 YGHSETKLPPGR-YHGVVGYIYK 544


>gi|304392384|ref|ZP_07374325.1| type II and III secretion system protein [Ahrensia sp. R2A130]
 gi|303295488|gb|EFL89847.1| type II and III secretion system protein [Ahrensia sp. R2A130]
          Length = 544

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 182/446 (40%), Positives = 271/446 (60%), Gaps = 21/446 (4%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           K + +GL+K +++ +P    DVLV++P  AD V+ + + +YLFGK VGQ NV +  + G 
Sbjct: 101 KLVRLGLDKSLVVDLPSVANDVLVANPGVADAVMRTSQRLYLFGKQVGQTNVFVFDNGGN 160

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
           Q+  L+ILIERDI+ LE TL R I +S+I+ EM++D +VL G V T  DS +A  L++ F
Sbjct: 161 QIAALEILIERDISGLEETLSRLIPNSDIQAEMINDNIVLTGRVSTPSDSTKAQSLAQIF 220

Query: 168 LSQSGRNQ--------YANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
           +    +          + ++ + +++NLL I GEDQV LKV+I E++R ++KQ+G   S+
Sbjct: 221 VRGGEQTTNPAQQSSIFGDAPTSEIVNLLKIDGEDQVMLKVSIVEIQRSVVKQLGITTSL 280

Query: 220 TGSSSGPSKSFAADFGG---KFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPT 276
           T ++ G    F+   GG        G   S   V  + + +  L  L+    IR LAEPT
Sbjct: 281 TNAAEG-GFGFSTIAGGSVRNIAGAGLRGSANIVSGQNTLDAQLRVLDHTGMIRMLAEPT 339

Query: 277 LTAISGQSASFTSGGQHLY-KTVSSSTGATSVTTHD--YGVVLHFTPTVLSPGRIGLRIQ 333
           LTAISG++A F +GG +   + +      TS+   +  YGV L F PTVL+ GRI L+++
Sbjct: 340 LTAISGEAAEFRAGGTYQAPQQIERDENGTSIEYEERQYGVSLQFIPTVLTEGRISLKLK 399

Query: 334 TEVSEPVIGVNAG-----DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
           TEV EP +  + G      +   R R A TTVELPSGG++ +AGL++DD++Q   G P L
Sbjct: 400 TEVKEPSLHGSTGRSSDAGLFGTRERVASTTVELPSGGSMAIAGLIQDDLRQNISGFPGL 459

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV 448
           SK+PI GALFR+  F+R ETE+ I  TP+LV+PVA   L+ PD+ +    +    F  RV
Sbjct: 460 SKLPIFGALFRSREFHRSETELVIIVTPYLVRPVARAKLANPDEGFQPASEPAGIFMGRV 519

Query: 449 NKIYGPKEASEVEGQNYKGAIGFIYK 474
           N++YG K+ +  +G+ Y G+IGFI K
Sbjct: 520 NRVYGTKQGNLPKGR-YTGSIGFILK 544


>gi|118589703|ref|ZP_01547108.1| pilus assembly protein [Stappia aggregata IAM 12614]
 gi|118437789|gb|EAV44425.1| pilus assembly protein [Stappia aggregata IAM 12614]
          Length = 483

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 184/455 (40%), Positives = 280/455 (61%), Gaps = 38/455 (8%)

Query: 37  INISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQ 96
           ++I+  E   G+ +++G+ + +++ +  D  DVLVS+P  AD V+ +PR +++ G   GQ
Sbjct: 50  VHIAAGERATGRILNVGVGRSVVINLAEDAADVLVSNPEIADAVLRTPRRIFVIGNTAGQ 109

Query: 97  ANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQD 156
           + ++L    G+++ + D+ +E+D + +   +R+ I  SNI  E ++ +VVL G  ++  +
Sbjct: 110 SRLVLFSRSGRELASFDVRVEKDTSDITRIIRKLIPGSNIFAESINGSVVLSGTAKSTLE 169

Query: 157 SQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG-- 214
           +Q+A +++  F       Q A S+S+ V+NL+++AG+DQV LKVT+AEV R I+KQ+G  
Sbjct: 170 AQQAADIAAKF-------QGAASASE-VVNLISVAGKDQVHLKVTVAEVERSIIKQLGVQ 221

Query: 215 FQHSITGSSSGPSKSFAADF-----------GGKFVSEGGDFSVKGVLDRFSFETVLHAL 263
           FQ +I   +  P  S   +F           GG  ++ G            S    + AL
Sbjct: 222 FQGTIGIGNFTPFMSSLPNFTVNPTIVNQAVGGTQLTAGAT----------SITAQVEAL 271

Query: 264 ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVL 323
           +R   IRTLAEPTLTAISG++ASF +GG+     +S   G  SV    +GV L FTP VL
Sbjct: 272 QREGVIRTLAEPTLTAISGENASFLAGGEFPIP-ISQRDGELSVEFKKFGVGLDFTPVVL 330

Query: 324 SPGRIGLRIQTEVSEPVI--GVNAGDM--PSYRVRKADTTVELPSGGTIVLAGLLKDDIQ 379
           S GRI LR++TEVSE      V+AG +   + +VR+A++T+ELPSGGT+V+AGLL++  Q
Sbjct: 331 SEGRISLRVKTEVSELSNDGAVSAGGITISALKVRRAESTMELPSGGTLVMAGLLQESYQ 390

Query: 380 QLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDD 439
           Q  EG+P L +IPILGALF++  F RE+TE+ +  TP++V+PVA+  L RPD +     D
Sbjct: 391 QAIEGVPGLMQIPILGALFKSRDFLREQTELAVFVTPYVVQPVAVSKLQRPDKNLMAPSD 450

Query: 440 AKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           A   F NR+NKIY P  A+  EG  Y G +GFIYK
Sbjct: 451 AGTIFLNRLNKIYNPTGAA-AEG-TYHGQVGFIYK 483


>gi|254501806|ref|ZP_05113957.1| Putative phospholipid-binding domain family [Labrenzia alexandrii
           DFL-11]
 gi|222437877|gb|EEE44556.1| Putative phospholipid-binding domain family [Labrenzia alexandrii
           DFL-11]
          Length = 483

 Score =  301 bits (770), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 173/465 (37%), Positives = 275/465 (59%), Gaps = 44/465 (9%)

Query: 30  KEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYL 89
           +EA  + I+++  E    + +++G+ + +++ +  D  DVLVS+P  AD V+ +PR +++
Sbjct: 43  QEAFPSQIHVAAGERATDRILNVGIGRSVVINLAEDAADVLVSNPQIADAVLRTPRRIFV 102

Query: 90  FGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHG 149
            G   GQA ++L G  G+++ + DI +E+D + +   +RR I  ++++ E ++  VVL G
Sbjct: 103 LGNTAGQARLVLFGRSGRELASFDIRVEKDTSDITRIIRRLIPGTSVQAESINGKVVLSG 162

Query: 150 MVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDI 209
             ++  ++Q+A +++  F          + +   ++NL+ ++G DQV LKVT+AEV R I
Sbjct: 163 TAKSTLEAQQAADIAAKF--------QGDETGSAIVNLIAVSGSDQVHLKVTVAEVERSI 214

Query: 210 LKQIGFQHSITGSSSGPSKSFAADFG-GKFVSEGGDF------------SVKGVL---DR 253
           +KQ+G              SF A+ G G F   G +F            +  GV      
Sbjct: 215 IKQLGV-------------SFQANLGAGNFFPFGSNFPNFNVNPSIVNQATGGVTFSSGT 261

Query: 254 FSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYG 313
            S    + AL+R   IRTLAEPTLTA SG++ASF +GG+     ++      SV    +G
Sbjct: 262 SSLTAQVEALQRDGVIRTLAEPTLTATSGENASFLAGGEFPIP-IAQEDNQISVEFKKFG 320

Query: 314 VVLHFTPTVLSPGRIGLRIQTEVSEPVI--GVNAGDM--PSYRVRKADTTVELPSGGTIV 369
           V L FTP VL+ GRI LR++TEVSE      V+AG +   + +VR+A++T+ELPSGGT+V
Sbjct: 321 VGLDFTPIVLTGGRISLRVKTEVSELSNEGAVSAGGITISALKVRRAESTMELPSGGTLV 380

Query: 370 LAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSR 429
           +AGLL++  QQ  EG+P L +IP+LGALF++  F +++TE+ +  TP++VKPVA + + R
Sbjct: 381 MAGLLEESYQQAVEGVPGLMQIPVLGALFKSRDFLKQQTELAVFVTPYVVKPVAAQKMVR 440

Query: 430 PDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           PD +     DA+A F NR+NKI+ P  A E     Y G +GFIYK
Sbjct: 441 PDKNLFAPSDAEAIFLNRLNKIFNP--AGEQAQGTYHGQVGFIYK 483


>gi|92116013|ref|YP_575742.1| type II and III secretion system protein [Nitrobacter hamburgensis
           X14]
 gi|91798907|gb|ABE61282.1| type II and III secretion system protein [Nitrobacter hamburgensis
           X14]
          Length = 486

 Score =  296 bits (757), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 178/493 (36%), Positives = 278/493 (56%), Gaps = 55/493 (11%)

Query: 9   FTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQD 68
            +  +I  F+ NP+   L P+  ++  V   +       + +S+G+ K +++ +P DV+D
Sbjct: 18  LSFAAIAAFTLNPA---LTPVFASDYRVPAATAGAKMHAQSLSLGIGKSVVVDLPRDVKD 74

Query: 69  VLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLR 128
           VLV+DP  A+ VV S +  Y+ G  VGQ N+I     G+Q+   DI + RD+  L   L+
Sbjct: 75  VLVADPKIANAVVRSAQRAYIIGAAVGQTNIIFFDGSGQQISAYDIAVTRDLNGLRAALK 134

Query: 129 RFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLL 188
           + + +++I+++ + D VVL G  ++  +SQ+A +L+                + KV+N +
Sbjct: 135 QILPNADIKIDGLGDGVVLSGWAQSPVESQQAADLAARLAG----------GADKVVNSI 184

Query: 189 NIAGEDQVTLKVTIAEVRRDILKQIG---------------FQHS----ITGSSSGPSKS 229
            + G DQV LKV +AEV+RDI+KQ+G               F +S     TGS+  P  S
Sbjct: 185 AVRGRDQVMLKVVVAEVQRDIIKQLGVDLSANLSYGTAVVNFNNSNPFLATGSALVPGNS 244

Query: 230 FAADFGGKFVSEGGDFSVKGVLDRFSFETV---LHALERATAIRTLAEPTLTAISGQSAS 286
               FG            K +++  +  TV   L A+E +  IRTLAEP+LTAISG+SA+
Sbjct: 245 VVGGFG------------KSIINGVTMPTVQATLRAMENSGVIRTLAEPSLTAISGESAN 292

Query: 287 FTSGGQHLYKTVSSSTGAT---SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----P 339
           F +GG+    +  S T  T   +VT   +G+ L+FTP VLS GRI LR+ TE SE     
Sbjct: 293 FLAGGEFPIPSGVSCTNGTCTPTVTFKKFGISLNFTPVVLSEGRISLRVATEASEVNNEN 352

Query: 340 VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFR 399
            I ++   +PS + R+ADTT+E+PSGG++V+AGL+K   +Q   G+P +S+IP+LG LFR
Sbjct: 353 AIQISGTAVPSIKTRRADTTLEIPSGGSMVMAGLIKQQTKQSISGMPGVSQIPVLGTLFR 412

Query: 400 NSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASE 459
           +  +    TE+ I  TP++V+ VA +DLSRPDD ++   D +A     +N+IYG    +E
Sbjct: 413 SRDYVNNNTELMILVTPYVVRAVAQKDLSRPDDGFADASDPQADLLGSINRIYGVPGRAE 472

Query: 460 VEGQNYKGAIGFI 472
              + Y+G  GFI
Sbjct: 473 -PARQYRGTYGFI 484


>gi|86748907|ref|YP_485403.1| type II and III secretion system protein [Rhodopseudomonas
           palustris HaA2]
 gi|86571935|gb|ABD06492.1| type II and III secretion system protein [Rhodopseudomonas
           palustris HaA2]
          Length = 479

 Score =  290 bits (741), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 172/487 (35%), Positives = 278/487 (57%), Gaps = 33/487 (6%)

Query: 2   RYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKG---KKISIGLNKVI 58
           R+++    T M++   S+  ++  LPP     A+    +  + G G   + +++G+ K +
Sbjct: 8   RFIRTLTGTAMAV---SAVVALTMLPPWTPVKASDYRATTTQTGGGMNARPLALGIGKSV 64

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           ++ +P D++DVLV+DP  A+ VV S +  Y+ G  VGQ N++     G+Q+   DI + R
Sbjct: 65  VIDLPRDIKDVLVADPKIANAVVRSSQRAYIIGAAVGQTNIVFFDSTGQQIAAYDIAVTR 124

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           D+  +   L++ I +++IRVE + D V+L G V T  ++Q+A +L+      +       
Sbjct: 125 DLNGIRAALQQSIPNADIRVEGLGDGVILMGSVATPIEAQQAADLAARLAGDA------- 177

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFA-----AD 233
               KV+N + I G DQV LK+T+AEV+RDI+KQ+G   +   S      SF        
Sbjct: 178 ---SKVVNNIAIRGRDQVMLKITVAEVQRDIVKQLGVDLTANLSYGTSVVSFTNTNPFTQ 234

Query: 234 FGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQH 293
            G   VS  G+       +  S    L A+E A  +RTLAEP LTAISG+ ASF +GG+ 
Sbjct: 235 SGQALVS--GNALTTSFGNGPSITATLKAMESAGVVRTLAEPNLTAISGEPASFLAGGEF 292

Query: 294 LYKTVSSSTGAT---SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAG 346
              +  + T A    SV+   +GV+L+FTP VLS GRI L++ TEVSE      + ++  
Sbjct: 293 PVPSGVTCTNAVCTPSVSYKKFGVLLNFTPVVLSEGRISLKVATEVSEVSSDNSVTISGT 352

Query: 347 DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNRE 406
            +PS + R+ D+TVE+PSGG++ +AGL+++  +Q   G+P +++IPILG LFR+  +   
Sbjct: 353 TVPSIKTRRVDSTVEIPSGGSLAMAGLIQEQTKQAINGMPGMTQIPILGTLFRSRDYINR 412

Query: 407 ETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYG-PKEASEVEGQNY 465
           ++E+ +  TP++V+ VA +DLSRPDD ++   D ++     +N+IYG P      + Q Y
Sbjct: 413 QSELMVLVTPYVVRAVAPKDLSRPDDGFADASDPQSDLLGSINRIYGVPGRTG--QSQTY 470

Query: 466 KGAIGFI 472
           +G  GFI
Sbjct: 471 RGRFGFI 477


>gi|154250689|ref|YP_001411513.1| type II and III secretion system protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154154639|gb|ABS61856.1| type II and III secretion system protein [Parvibaculum
           lavamentivorans DS-1]
          Length = 491

 Score =  285 bits (730), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 170/470 (36%), Positives = 262/470 (55%), Gaps = 49/470 (10%)

Query: 32  ANAAVINISDVEIGKGKK-ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLF 90
            +A ++ I    IG+  + I +GLNK  I+++P+  +DVLVS+P   D VV + +  YL 
Sbjct: 40  GDARLVKIDQGGIGQSSRSIVLGLNKAAIVELPIAARDVLVSNPAIVDAVVRTNKRTYLI 99

Query: 91  GKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGM 150
           G  VGQ N       G+Q+LNL+I + RD+  L  +LR++   + I VE ++D VVL GM
Sbjct: 100 GLAVGQTNAFFFNEAGQQILNLEIRVARDLTGLRESLRQYFPKARIDVESINDHVVLSGM 159

Query: 151 VRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDIL 210
           V +  D+ +A + +          +Y     + V+N+L I G++QV LKVT+AE++R+++
Sbjct: 160 VASATDASKAQDFAA---------RYIGGDKEHVLNMLGIEGKEQVMLKVTVAEMQRNVI 210

Query: 211 KQIGF-------------------QHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVL 251
           KQ+G                      S+ G S G   + AAD       + GD +V    
Sbjct: 211 KQLGVDLSTAANFGDFALRLATSNSFSVQGGSLG-GLTTAADAADPTRYQSGDVTV---- 265

Query: 252 DRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHD 311
                ++ + ALER   +RTLAEP LTAISG+SA F +GG+    T     G   +    
Sbjct: 266 -----DSAIRALERDGILRTLAEPNLTAISGESAKFLAGGEFPVPTSRDRDGNVQLEFKP 320

Query: 312 YGVVLHFTPTVLSPGRIGLRIQTEVSEP------VIGVNAGD---MPSYRVRKADTTVEL 362
           +GV L+FTP VLS GRI L+I TEVSE       V    + D   +P  +VR+A+TT+EL
Sbjct: 321 FGVGLNFTPVVLSEGRISLKISTEVSELTSEGAFVFQSTSADGVTVPGLKVRRAETTLEL 380

Query: 363 PSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV 422
           PSGG++V+AGLL D ++Q  +G+P +  +P+LG LFR+  + + ETE+ +  TP+LV P 
Sbjct: 381 PSGGSLVMAGLLSDTMRQNIDGVPGVKDVPVLGQLFRSRDYQKNETELVVIVTPYLVDPT 440

Query: 423 AMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
           + ++L  P D ++   D       R+N  YG + A+  +  + +G +GFI
Sbjct: 441 SRKNLVLPTDGFAPASDMDTILMGRLNATYGARGAAPGD-HSLQGPVGFI 489


>gi|146338123|ref|YP_001203171.1| putative pilus assembly protein CpaC [Bradyrhizobium sp. ORS278]
 gi|146190929|emb|CAL74934.1| putative Pilus assembly protein cpaC; putative signal peptide
           [Bradyrhizobium sp. ORS278]
          Length = 500

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 163/450 (36%), Positives = 258/450 (57%), Gaps = 44/450 (9%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++G+ K +++ +P D++DVLV+DP  A+ VV S +  Y+ G  VGQ N++     G+Q+
Sbjct: 66  LALGVGKSVVIDLPRDIKDVLVADPKIANAVVRSSQRAYIIGAAVGQTNIVFFDAQGQQI 125

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
              DI ++RD+      L++ + +++I++E + D +VL G   +  ++Q+A EL+     
Sbjct: 126 AAYDIAVKRDLNGARAALKQLLPNADIQIEGLGDGIVLTGSASSQIEAQQAGELAARLAG 185

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS---------IT 220
                      ++KV+N + + G DQV LKVT+AEV+R ++KQ+G   S         + 
Sbjct: 186 ----------GAEKVVNSITVRGRDQVMLKVTVAEVQRSVVKQLGIDLSGQLNYGTAVVK 235

Query: 221 GSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAI 280
            ++S P   F A +G   VS     +  G     S +  L A+E A  IRTLAEP LTAI
Sbjct: 236 FANSNP---FTA-YGSNLVSNNAVSAAFGSTP--SVQATLRAMENAGVIRTLAEPNLTAI 289

Query: 281 SGQSASFTSGGQHLYKTVSSSTGATSVTT-----HDYGVVLHFTPTVLSPGRIGLRIQTE 335
           SG+SA+F +GG+       S    T V T       +G+ L+FTP VLS GRI +R+ TE
Sbjct: 290 SGESATFIAGGEFPVPAGYSCDPTTHVCTTQISFKKFGISLNFTPIVLSEGRISMRVMTE 349

Query: 336 VSE-------------PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLK 382
           VSE                 VN+  +PS + R+A+TT+E+PSGG + +AGL++   +Q  
Sbjct: 350 VSELSNENSITLSQAVSSTTVNSLTVPSIKTRRAETTLEIPSGGAMAMAGLIQQQTKQAI 409

Query: 383 EGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
            G+P L ++P+LGALFR+  +   +TE+ +  TPF+V+ V+ +DLSRPDD ++   D +A
Sbjct: 410 SGMPGLMQLPVLGALFRSRDYVNNQTELMVLVTPFVVRAVSQKDLSRPDDGFAAASDPQA 469

Query: 443 FFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
                +N+IYG    +E  G+NY+G  GFI
Sbjct: 470 DLLGSINRIYGVPGRTE-PGRNYRGTYGFI 498


>gi|39936740|ref|NP_949016.1| type II and III secretion system protein [Rhodopseudomonas
           palustris CGA009]
 gi|192292566|ref|YP_001993171.1| type II and III secretion system protein [Rhodopseudomonas
           palustris TIE-1]
 gi|39650596|emb|CAE29119.1| putative exporter protein, cpaC [Rhodopseudomonas palustris CGA009]
 gi|192286315|gb|ACF02696.1| type II and III secretion system protein [Rhodopseudomonas
           palustris TIE-1]
          Length = 480

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 160/440 (36%), Positives = 259/440 (58%), Gaps = 27/440 (6%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
             + IS+G+ K +++ +P D++DVLV+DP  A+ VV S +  Y+ G  VGQ N++     
Sbjct: 53  NAQSISLGIGKSMVIDLPRDIKDVLVADPKIANAVVRSAQRAYIIGAAVGQTNIVFFDSA 112

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
           G+Q+   DI + RD+  L   L++ + ++ I+VE + D V+L+G V +  D+Q+A +L+ 
Sbjct: 113 GRQIAAYDIAVTRDLNGLRTALKQTLPNAEIQVEGLGDGVMLNGWVTSPIDAQQAYDLAV 172

Query: 166 TFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSG 225
             + +           KKV+N + + G DQV LK+T+AEV+RDI+KQ+G   S   +   
Sbjct: 173 RLVGED----------KKVVNNIAVRGRDQVMLKITVAEVQRDIVKQLGVDLSANMAYGT 222

Query: 226 PSKSFAADFGGKFVSEGGDF-SVKGVLDRF----SFETVLHALERATAIRTLAEPTLTAI 280
              +F  +    F   GG   S   +  +F    S    L A+E A  +RTLAEP LTAI
Sbjct: 223 AVVNF--NNSNPFTQSGGPLVSSNALTTKFGSLPSVTATLRAMESAGVVRTLAEPNLTAI 280

Query: 281 SGQSASFTSGGQHLYK---TVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS 337
           SG+ A+F +GG+       T ++     SVT   +G++L+FTP V++ GRI L++ TEVS
Sbjct: 281 SGEPATFLAGGEFPVPSGVTCTNGVCTPSVTFKKFGILLNFTPVVMTAGRISLKVMTEVS 340

Query: 338 E-----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           E      VI  N   +PS + R+ ++TVE+PSGG++ +AGL+++  +Q   G+P  +++P
Sbjct: 341 EVSSDNSVIISNM-SVPSIKTRRVESTVEIPSGGSLAMAGLIQEQTKQAINGMPGAAQLP 399

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIY 452
           ILG LFR+  +   +TE+ +  TP++V+ VA +DLSRPDD ++   D ++     +NK+Y
Sbjct: 400 ILGTLFRSRDYINRQTELMVLVTPYVVRAVAQKDLSRPDDGFADASDPQSDLLGSINKLY 459

Query: 453 GPKEASEVEGQNYKGAIGFI 472
           G    +E   + Y+G  GFI
Sbjct: 460 GVPGRTE-PARTYRGRFGFI 478


>gi|91977985|ref|YP_570644.1| type II and III secretion system protein [Rhodopseudomonas
           palustris BisB5]
 gi|91684441|gb|ABE40743.1| type II and III secretion system protein [Rhodopseudomonas
           palustris BisB5]
          Length = 480

 Score =  283 bits (724), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 160/438 (36%), Positives = 254/438 (57%), Gaps = 27/438 (6%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           + +++G+ K +++ +P D++DVLV+DP  A+ VV S +  Y+ G  VGQ N++     G+
Sbjct: 55  RPLALGIGKSVVIDLPRDIKDVLVADPKIANAVVRSAQRAYIIGAAVGQTNIVFFDSTGQ 114

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
           Q+   DI + RD+  +   LR+ I +++I+VE + D V+L G V T  ++Q+A +L+   
Sbjct: 115 QIAAYDIAVTRDLNGIRTALRQSIPNADIQVEGLGDGVMLIGSVATPIEAQQAADLAARL 174

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
              +           KV+N + + G DQV LK+T+AEV+RDI+KQ+G    +T S +  +
Sbjct: 175 AGDA----------SKVVNNIAVRGRDQVMLKITVAEVQRDIVKQLGVD--LTASMNYGT 222

Query: 228 KSFAADFGGKFVSEGGDFSVKGVLDRF-----SFETVLHALERATAIRTLAEPTLTAISG 282
                     F   GG       L        S    L A+E A  +RTLAEP LTAISG
Sbjct: 223 SVVKFSNTNPFTQSGGPLVANNALTTSFGSGPSVSATLRAMESAGVVRTLAEPNLTAISG 282

Query: 283 QSASFTSGGQHLYK---TVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE- 338
           + ASF +GG+       T ++S    SVT   +GV+L+FTP VL+ GRI L++ TEVSE 
Sbjct: 283 EPASFLAGGEFPVPSGVTCTNSLCTPSVTFKKFGVLLNFTPVVLTEGRISLKVSTEVSEV 342

Query: 339 ---PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILG 395
                I +    +PS + R+ ++TVE+PSGG++ +AGL+++  +Q   G+P ++++PILG
Sbjct: 343 SSDNSIVIGGLSVPSIKTRRIESTVEIPSGGSLAMAGLIQEQTKQAINGLPGMTQLPILG 402

Query: 396 ALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYG-P 454
            LFR+  +   +TE+ +  TP++V+ VA +DLSRPDD ++   D ++     +N+IYG P
Sbjct: 403 TLFRSRDYINRQTELMVMVTPYVVRAVAQKDLSRPDDGFADASDPQSDLLGNINRIYGVP 462

Query: 455 KEASEVEGQNYKGAIGFI 472
                   Q Y+G  GFI
Sbjct: 463 GRTG--PAQTYRGRFGFI 478


>gi|148258235|ref|YP_001242820.1| putative pilus assembly protein CpaC [Bradyrhizobium sp. BTAi1]
 gi|146410408|gb|ABQ38914.1| putative Pilus assembly protein cpaC [Bradyrhizobium sp. BTAi1]
          Length = 497

 Score =  282 bits (721), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 169/480 (35%), Positives = 268/480 (55%), Gaps = 47/480 (9%)

Query: 20  NPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADV 79
           NP++A +       A     +D +I   + +++G+ K +++ +P D++DVLV+DP  A+ 
Sbjct: 36  NPALAPVIAADYHPAVTAAAADGQI-NARFLALGVGKSVVIDLPRDIKDVLVADPKIANA 94

Query: 80  VVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVE 139
           VV S +  Y+ G  VGQ N++     G+Q+   DI ++RD+      L++ + +S+I++E
Sbjct: 95  VVRSSQRAYIIGATVGQTNIVFFDAQGQQIAAYDIAVKRDLNGARAALKQLLPNSDIQIE 154

Query: 140 MVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLK 199
            + D++VL G   +  ++Q+A EL+                + KV+N + + G DQV LK
Sbjct: 155 GLGDSIVLSGSAASQIEAQQAGELAARLAG----------GADKVVNSITVRGRDQVMLK 204

Query: 200 VTIAEVRRDILKQIGFQHS---------ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGV 250
           VT+AEV+R ++KQ+G   S         +  ++S P   F A +G   VS     +  G 
Sbjct: 205 VTVAEVQRSVVKQLGIDLSGQLNYGTAVVKFANSNP---FTA-YGSNLVSNNAINASFG- 259

Query: 251 LDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT- 309
               S +  L A+E A  IRTLAEP LTAISG+SA+F +GG+       S    T V T 
Sbjct: 260 ---SSVQATLRAMENAGVIRTLAEPNLTAISGESATFIAGGEFPVPAGYSCDPTTHVCTT 316

Query: 310 ----HDYGVVLHFTPTVLSPGRIGLRIQTEVSE-------------PVIGVNAGDMPSYR 352
                 +G+ L+FTP VL+ GRI LR+ TEVSE                 VN+  +PS +
Sbjct: 317 QISFKKFGISLNFTPVVLAEGRISLRVMTEVSELSNENSITLSQAVTSSTVNSLTVPSIK 376

Query: 353 VRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFI 412
            R+A+TT+E+PSGG + +AGL++   +Q   G+P L ++P+LG LFR+  +   +TE+ +
Sbjct: 377 TRRAETTLEIPSGGAMAMAGLIQQQTKQAISGMPGLMQLPVLGTLFRSRDYVNNQTELMV 436

Query: 413 AATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
             TPF+V+ VA +DLSRPDD ++   D +A     +N+IYG     E  G++Y+G  GFI
Sbjct: 437 LVTPFVVRAVAQKDLSRPDDGFAAASDRQADLLGSINRIYGVPGRVE-PGRSYRGTYGFI 495


>gi|209886530|ref|YP_002290387.1| type II and III secretion system protein [Oligotropha
           carboxidovorans OM5]
 gi|209874726|gb|ACI94522.1| type II and III secretion system protein [Oligotropha
           carboxidovorans OM5]
          Length = 486

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 163/445 (36%), Positives = 258/445 (57%), Gaps = 29/445 (6%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           + + +G++K +++ +P DV+DVLV+DP  A+ VV S R  Y+ G +VGQ N+I    DG+
Sbjct: 49  RALRLGISKSLVVDLPRDVKDVLVADPKIANAVVRSSRRAYIIGASVGQTNIIFFDADGQ 108

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
           QM   D+ + RD+  +   + + +  S+I+VE + D VVL G      ++Q+A EL+   
Sbjct: 109 QMAAYDVAVTRDLNGIRTAIHQALPQSDIQVEGLGDGVVLSGTAANQAEAQQAYELAARL 168

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG------FQHSITG 221
           +    +      + + ++N + + G DQV L+VT+AEV+R I+KQ+G      F +    
Sbjct: 169 IGGPSK------AGELIVNNIAVRGRDQVMLRVTVAEVQRSIIKQLGVDLSGSFNYGTAV 222

Query: 222 SSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
                + +F A  G + V      +  G     S +  L A+E A  IRTLAEP LTAIS
Sbjct: 223 VDFNNTNTFTA-LGRRLVDNNAVSAAFGNGTVPSVKATLRAMESAGVIRTLAEPNLTAIS 281

Query: 282 GQSASFTSGGQHLYKT-------VSSSTGAT--SVTTHDYGVVLHFTPTVLSPGRIGLRI 332
           G+SA+F +GG+    T          STG    S+    +G+ L+FTP VL+ GRI LR+
Sbjct: 282 GESATFIAGGEFPIPTGITCQTAAGGSTGPCQPSIAFKKFGISLNFTPVVLTEGRISLRV 341

Query: 333 QTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
            TEVSE      I V+   +PS + R+A+TT+E+PSGG++ +AGL++D  +Q   G+P L
Sbjct: 342 MTEVSEVSSDNSISVSGLTIPSIKTRRAETTLEIPSGGSMAMAGLIQDQTKQAINGLPGL 401

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV 448
           +++P+LG LFR+  F   +TE+ +  TP++V+ VA +DLSRPDD ++   D ++     +
Sbjct: 402 AQVPVLGTLFRSRDFINNQTELMVLVTPYVVRAVAQKDLSRPDDGFASASDPQSVLLGNI 461

Query: 449 NKIYG-PKEASEVEGQNYKGAIGFI 472
            +IYG P+    V   +Y+G  GFI
Sbjct: 462 TRIYGVPRRGGPVA--SYRGKYGFI 484


>gi|27375777|ref|NP_767306.1| hypothetical protein bll0666 [Bradyrhizobium japonicum USDA 110]
 gi|27348915|dbj|BAC45931.1| bll0666 [Bradyrhizobium japonicum USDA 110]
          Length = 505

 Score =  280 bits (715), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 173/503 (34%), Positives = 286/503 (56%), Gaps = 53/503 (10%)

Query: 6   RTFFT--MMSIFLFSSNP--SVAKLP-----PIKEANAAVINISDVEIGKGKKISIGLNK 56
           RTF+   M+++ L ++    S A+ P     P++  +  V ++  +   K + +S+G+ K
Sbjct: 18  RTFWAGAMLTLGLLAAPGLVSAAEAPVGDQAPLQAPDLGVASVGTIAPAKTRFLSLGVGK 77

Query: 57  VIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILI 116
            +++ +P +V+DVLV+DP  A+ V+ S +  Y+ G  VGQ NV+    DG+Q+   DI +
Sbjct: 78  SVVIDLPREVKDVLVADPKIANAVIRSAQRAYIIGGQVGQTNVVFFTADGQQVAAYDIAV 137

Query: 117 ERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQY 176
           +RD+  +   LR+ +    +++E + D+V+L G V +  ++Q+A E++   +        
Sbjct: 138 KRDLNGMRAALRQSL--PGVQIEGIGDSVMLTGSVSSPVEAQQAGEVAAKLVG------- 188

Query: 177 ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS------GPSKSF 230
               S+KV+N + + G DQV LKV + EVRRDI+KQ+G   S + ++         S  F
Sbjct: 189 ---GSEKVVNNIVVRGRDQVMLKVVVGEVRRDIVKQLGVDLSASLNAGTAVVNFNNSNPF 245

Query: 231 AADFGGKFVSEGGDFSVKGVLDRFS-FETVLHALERATAIRTLAEPTLTAISGQSASFTS 289
           +   GG  VS  G   V G+    +     + A+E A  +RTLAEP+LTAISG+SA+F +
Sbjct: 246 SVS-GGPLVSSNG-LGVTGLAKGVATVNATMRAMETAGVMRTLAEPSLTAISGESATFIA 303

Query: 290 GGQ------HLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----P 339
           GG+      +    V+     T +T   +G+ L+FTP VLS GRI LR+ TEVSE     
Sbjct: 304 GGEFPIPGGYACDPVTHVC-TTQITYKKFGISLNFTPVVLSEGRISLRVMTEVSELSNQN 362

Query: 340 VIGVNAG---------DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSK 390
            I V             +PS + R+A+TT+E+PSGG++ +AGL++   +Q   G+P + +
Sbjct: 363 AISVTQAVSASQTSSVTIPSIQTRRAETTLEIPSGGSMAMAGLIQQQTKQAINGLPGVDQ 422

Query: 391 IPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNK 450
           +PI+GALFR+  F   ETE+ +  TP++V+ VA ++LSRPDD ++   DA+     R+N+
Sbjct: 423 VPIIGALFRSQDFVNNETELMVIVTPYVVRAVAQKELSRPDDGFAPASDAQTALLGRMNR 482

Query: 451 IYG-PKEASEVEGQNYKGAIGFI 472
           +YG  +    ++G   +G  GFI
Sbjct: 483 LYGIARRVDPIDG--ARGDFGFI 503


>gi|328545279|ref|YP_004305388.1| Pilus assembly protein [polymorphum gilvum SL003B-26A1]
 gi|326415021|gb|ADZ72084.1| Pilus assembly protein [Polymorphum gilvum SL003B-26A1]
          Length = 470

 Score =  278 bits (712), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 177/450 (39%), Positives = 273/450 (60%), Gaps = 27/450 (6%)

Query: 37  INISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQ 96
           ++++  E    + + +GL + +++ V  DV DVLVS+P  AD VV S   +++ G   GQ
Sbjct: 36  VHVAAGERATARLLRVGLGRSVVVNVAEDVADVLVSNPEIADAVVRSKNRVFVLGNKAGQ 95

Query: 97  ANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQD 156
           AN++L G +G+++ + ++ +E D + L   L+R + +S+I  E ++  VVL G   +  D
Sbjct: 96  ANLVLFGRNGRELASFNLRVEPDTSDLSALLKRVLPNSDIHAESINGNVVLSGTAVSAAD 155

Query: 157 SQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ 216
           +Q A +L+  F   SG      + +  V+N++++AG+DQ+ LKVT+AEV R ++KQ+G  
Sbjct: 156 AQSAADLATRF-GGSG------AGALPVLNMISVAGKDQIQLKVTVAEVDRSVVKQLGVN 208

Query: 217 HSIT---GSSSGPSKSFAADF----GGKFVSEGG-DFSVKGVLDRFSFETVLHALERATA 268
            S +   G+  G   S A+DF    G    + GG  F   G     +    + AL+R   
Sbjct: 209 LSGSIGIGNYRGTFNS-ASDFPVNPGITSQATGGIGFLAGGT----NVNAEIQALQRDGV 263

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRI 328
           IRTLAEPTLTAISG++ASF +GG+     VS       V    +GV L FTP VLS GRI
Sbjct: 264 IRTLAEPTLTAISGENASFLAGGEFPVP-VSQDNDTIGVEFKKFGVGLDFTPVVLSGGRI 322

Query: 329 GLRIQTEVSEPVI--GVNAGDM--PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
            +R++TEVSE      V  G +   + +VR+A++TVELPSGGT+V+AGLLK+  +Q   G
Sbjct: 323 SMRVKTEVSELTNDGAVTTGGIVISALKVRRAESTVELPSGGTLVMAGLLKETYKQAVNG 382

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF 444
           IP L ++P+LGALF++  F R++TE+ +  TP++V PVA   L+RPD ++    DA+  F
Sbjct: 383 IPGLMQLPVLGALFKSRDFLRQQTELVVFVTPYVVTPVAANALTRPDQNFLPPSDAETVF 442

Query: 445 FNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
            NR+NK++G   A +V G  Y G +G+IY+
Sbjct: 443 LNRINKLFGVSGA-KVPG-TYHGQVGYIYE 470


>gi|85713505|ref|ZP_01044495.1| type II and III secretion system protein [Nitrobacter sp. Nb-311A]
 gi|85699409|gb|EAQ37276.1| type II and III secretion system protein [Nitrobacter sp. Nb-311A]
          Length = 477

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 167/461 (36%), Positives = 259/461 (56%), Gaps = 53/461 (11%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           + +S+G+ K +++ +P DV+DVLV+DP  A+ VV S +  Y+ G  VGQ N+I     G+
Sbjct: 32  QSLSLGIGKSVVVDLPRDVKDVLVADPKIANAVVRSAQRAYIIGAAVGQTNIIFFDSSGQ 91

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
           Q+   DI + RD+  L   L++ + ++ I+V+ + D V+L G V +  ++Q+A +L+   
Sbjct: 92  QISAYDIAVTRDLNGLRAALKQLLPNAAIKVDGLGDGVMLSGWVSSPIEAQQAGDLAARL 151

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS--------- 218
                         +KV+N + + G DQV LKVT+AEV R I+KQ+G   S         
Sbjct: 152 AD----------GVQKVVNNIAVRGRDQVMLKVTVAEVARTIIKQMGIDLSANMNYGTAV 201

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRF------------SFETVLHALERA 266
           +  S+S P  +      G+ +  G + S    L               S +  L A+E A
Sbjct: 202 VNFSNSNPFTAL-----GRPLVSGNNLSGSAGLTNLLPGQAGYPGVVPSVQATLRAMESA 256

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT-----HDYGVVLHFTPT 321
             IRTLAEP LTAISG+SA+F SGG+       S   AT V         +G+ L+FTP 
Sbjct: 257 GVIRTLAEPNLTAISGESATFISGGEFPIPAGYSCDPATRVCLTQIRFKKFGISLNFTPV 316

Query: 322 VLSPGRIGLRIQTEVSE----------PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLA 371
           VL+ GRI LR+ TEVSE            IG N+  +PS R R+A+TT+E+PSGG++ +A
Sbjct: 317 VLTEGRISLRVMTEVSELSTENAMTITQTIG-NSLTVPSIRTRRAETTLEIPSGGSMAMA 375

Query: 372 GLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           GL+++  +Q   G+P L+++P+LGALFR+  +   +TE+ +  TP++V+ VA +DLSRPD
Sbjct: 376 GLIQEQTKQAINGLPGLTQLPVLGALFRSRDYVNGQTELVVLVTPYVVRAVAQKDLSRPD 435

Query: 432 DHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
           D ++   D ++     +N+IYG     E   ++Y+G  GFI
Sbjct: 436 DGFADASDPQSDLLGSINRIYGAPGRVE-PARHYRGTYGFI 475


>gi|27376550|ref|NP_768079.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
 gi|27349691|dbj|BAC46704.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
          Length = 496

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 162/451 (35%), Positives = 255/451 (56%), Gaps = 46/451 (10%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +S+G+ K I++ +P D++DVLV+DP  A+ VV S +  Y+ G  VGQ N++     G+Q+
Sbjct: 62  LSLGVGKSIVIDLPRDIKDVLVADPKIANAVVRSSQRAYIIGAAVGQTNIVFFDSAGQQI 121

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
              DI ++RD+  +   L++ + +S+I+++ + + +VL G      ++Q+A +L+     
Sbjct: 122 AAYDIAVKRDLNGVRAALKQILPNSDIQIDGLGEGIVLTGTAANPMEAQQANDLAARLAG 181

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS---------IT 220
                      + KV+N + + G DQV LKVT+AEV R I+KQ+G   +         +T
Sbjct: 182 ----------GADKVVNSIVVRGRDQVMLKVTVAEVARSIVKQLGIDLTANLNYGTSVVT 231

Query: 221 GSSSGPSKSFAADFGGKFVSEGGDFSVK-GVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            S+S P  +      GK + +G   + K G     S +  L A+E A  IRTLAEP LTA
Sbjct: 232 FSNSNPFTAL-----GKNLVDGNSLTTKFGATP--SVQATLRAMETAGVIRTLAEPNLTA 284

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTT-----HDYGVVLHFTPTVLSPGRIGLRIQT 334
           ISG+SA+F +GG+       +    T V T       +G+ L+FTP VL+ G+I LR+ T
Sbjct: 285 ISGESATFIAGGEFPVPAGYACDPTTHVCTTQISFKKFGISLNFTPVVLTEGKISLRVMT 344

Query: 335 EVSE-------------PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
           EVSE                 VN+  +PS + R+A+T++E+PSGG + +AGL++   +Q 
Sbjct: 345 EVSELSNENAITLSQAVTSTSVNSLTVPSIKTRRAETSLEIPSGGAMAMAGLIQQQTKQA 404

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
             G+P L ++PILG LFR+  F    TE+ +  TP++V+ VA +DLSRPDD +S   D +
Sbjct: 405 VSGLPGLMQLPILGTLFRSRDFVNNATELVVIVTPYIVRAVAQKDLSRPDDGFSAPADPQ 464

Query: 442 AFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
                 +N+IYG    +E  G+NY+G  GFI
Sbjct: 465 VELLGNINRIYGVPGRTE-PGRNYRGTYGFI 494


>gi|75674499|ref|YP_316920.1| type II and III secretion system protein [Nitrobacter winogradskyi
           Nb-255]
 gi|74419369|gb|ABA03568.1| type II and III secretion system protein [Nitrobacter winogradskyi
           Nb-255]
          Length = 493

 Score =  276 bits (706), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 166/458 (36%), Positives = 258/458 (56%), Gaps = 54/458 (11%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           + +S+G+ K +++ +P DV+DVLV+DP  A+ VV S +  Y+ G  VGQ N+I     G+
Sbjct: 55  QSLSLGIGKSVVVDLPRDVKDVLVADPKIANAVVRSAQRAYIIGAAVGQTNIIFFDSSGQ 114

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
           Q+   DI + RD+  L   L++ + ++ I+V+ + D V+L G V    ++Q+A +L+   
Sbjct: 115 QISAYDIAVTRDLNGLRTALKQLLPNAAIKVDGLGDGVMLSGWVSNPIEAQQAGDLAARL 174

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS--------- 218
                        ++KV+N + + G DQV LKVT+AEV R ++KQ+G   S         
Sbjct: 175 ----------TDGAQKVVNNIAVRGRDQVMLKVTVAEVARTVIKQMGIDLSASMNYGTAV 224

Query: 219 ITGSSSGP---------SKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAI 269
           +  +++ P         + S AA FG   V   G   V  V         L A+E A  I
Sbjct: 225 VNFTNANPFTALGRPLTNNSAAASFGSTMV---GGAPVPAV------TATLRAMESAGVI 275

Query: 270 RTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT-----HDYGVVLHFTPTVLS 324
           RTLAEP LTAISG+SA+F SGG+       S   AT V         +G+ L+FTP VL+
Sbjct: 276 RTLAEPNLTAISGESATFISGGEFPIPAGFSCDPATRVCLTQIRFKKFGISLNFTPVVLT 335

Query: 325 PGRIGLRIQTEVSE----------PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLL 374
            GRI LR+ TEVSE            +G N+  +PS R R+A+TT+E+PSGG++ +AGL+
Sbjct: 336 EGRISLRVMTEVSELSNENSMTLNQSVG-NSLTVPSIRTRRAETTLEIPSGGSMAMAGLI 394

Query: 375 KDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHY 434
               +Q+  G+P ++++P+LGALFR+  +   +TE+ +  TP++V+ VA +DLSRPDD +
Sbjct: 395 HQQTKQVINGLPGIAQVPVLGALFRSRDYVNGQTELMVLVTPYVVRAVAQKDLSRPDDGF 454

Query: 435 SVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
           +   D ++     +N+IYG     E   ++Y+G  GFI
Sbjct: 455 ADASDPQSDLLGSLNRIYGAPGRVE-PARHYRGTYGFI 491


>gi|90425197|ref|YP_533567.1| type II and III secretion system protein [Rhodopseudomonas
           palustris BisB18]
 gi|90107211|gb|ABD89248.1| type II and III secretion system protein [Rhodopseudomonas
           palustris BisB18]
          Length = 492

 Score =  276 bits (705), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 159/448 (35%), Positives = 254/448 (56%), Gaps = 37/448 (8%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++G++K +++ +P D++DVLV+DP  A+ VV S +  Y+ G  +GQ N++     G Q+
Sbjct: 55  LALGVSKSVVIDLPRDIKDVLVADPKIANAVVRSAQRAYIIGAAIGQTNIVFFDAAGLQI 114

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVS-DTVVLHGMVRTIQDSQRAVELSETFL 168
              DI + RD+  +   +++ +  ++IRVE V   +V+L G V +  ++Q+A +L+   +
Sbjct: 115 AAYDIAVTRDLNGIRAAMKQTLPGADIRVEGVGVKSVMLTGSVSSPIEAQQAGDLAARLV 174

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG------FQHSITGS 222
                          V+N + + G DQV LKVT+AEV+RDI+KQ+G        +     
Sbjct: 175 D----------GPDNVVNSIAVRGRDQVMLKVTVAEVQRDIVKQLGVDLTARMNYGTAVV 224

Query: 223 SSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISG 282
           +   S  F A +G   VS     +  G     S    L A+E A  +RTLAEP LTAISG
Sbjct: 225 NFNNSNPFTA-YGSNLVSGNATTASFGGGTTPSVTATLRAMESAGVVRTLAEPNLTAISG 283

Query: 283 QSASFTSGGQHLYKTVSSSTGATSVTT-----HDYGVVLHFTPTVLSPGRIGLRIQTEVS 337
           +SA+F +GG+       S    T V T       +G+ L+FTP V+S GRI LR+ TEVS
Sbjct: 284 ESATFVAGGEFPVPAGYSCDPVTHVCTTQISFKKFGISLNFTPVVMSEGRISLRVMTEVS 343

Query: 338 E-------------PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
           E                  N+  +PS + R+A+TT+E+PSGG++ +AGL+++  +Q   G
Sbjct: 344 EISTDNSITLSQAVSTTTTNSITVPSIKTRRAETTLEIPSGGSMAMAGLIQEQTKQAMNG 403

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF 444
           +P L+++P+LGALFR+  +    TE+ +  TP++V+ VA +DLSRPDD ++   D +A  
Sbjct: 404 LPGLAQLPVLGALFRSRDYVNRNTELLVLVTPYVVRAVAQKDLSRPDDGFAAASDPQADL 463

Query: 445 FNRVNKIYGPKEASEVEGQNYKGAIGFI 472
              +N+IYG +  +E   +NY+G  GFI
Sbjct: 464 IGNINRIYGVRGRTE-PAKNYRGTYGFI 490


>gi|299132286|ref|ZP_07025481.1| type II and III secretion system protein [Afipia sp. 1NLS2]
 gi|298592423|gb|EFI52623.1| type II and III secretion system protein [Afipia sp. 1NLS2]
          Length = 490

 Score =  276 bits (705), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 159/458 (34%), Positives = 252/458 (55%), Gaps = 53/458 (11%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
             + + +G++K +++ +P DV+DVLV+DP  A+ VV S R  Y+ G  VGQ N+I    D
Sbjct: 53  NARSLRLGISKSLVVDLPRDVKDVLVADPKIANAVVRSSRRAYIIGAAVGQTNIIFFDAD 112

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
           G+QM   D+ + RD+  +   + + +  S+I+VE + D VVL G      ++Q+A EL+ 
Sbjct: 113 GQQMAAYDVAVTRDLNGIRTAIHQALPQSDIQVEGLGDGVVLTGSAANQAEAQQAYELAA 172

Query: 166 TFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF---------- 215
             +    +      ++  V+N + + G DQV LKVT+AEV+R+I+KQ+G           
Sbjct: 173 RLIGGPSK------ANDLVVNNITVRGRDQVMLKVTVAEVQRNIVKQLGVDLSGKFSYGT 226

Query: 216 ---------QHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERA 266
                    Q S  G +  P  + +  FG                   S +  L A+E A
Sbjct: 227 AVVDFNNANQFSALGHALAPDNAISTSFGSAP----------------SVKATLRAMESA 270

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTV--------SSSTGATSVTTHDYGVVLHF 318
             +RTLAEP LTAISG+SA+F +GG+    T         +SS    S+    +G+ L+F
Sbjct: 271 GVVRTLAEPNLTAISGESATFIAGGEFPIPTGITCQTAAGTSSNCQPSIAFKKFGISLNF 330

Query: 319 TPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLL 374
           TP VL+ GRI LR+ TEVSE      + V+   +PS + R+A+TT+E+PSGG++ +AGL+
Sbjct: 331 TPVVLTEGRISLRVMTEVSEISNDNSLTVSGMTIPSIKTRRAETTLEIPSGGSMAMAGLI 390

Query: 375 KDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHY 434
           ++  +Q   G+P L+++P+LG LFR+  F   +TE+ +  TP++V+ VA +DLSRPDD +
Sbjct: 391 QEQTKQAINGLPGLAQLPVLGTLFRSRDFINNQTELMVLVTPYVVRAVAQKDLSRPDDGF 450

Query: 435 SVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
           +   D +      + +IYG          +Y+G  GFI
Sbjct: 451 ASASDPQTVLLGNITRIYGVPRREGQASSSYRGKYGFI 488


>gi|323137425|ref|ZP_08072503.1| type II and III secretion system protein [Methylocystis sp. ATCC
           49242]
 gi|322397412|gb|EFX99935.1| type II and III secretion system protein [Methylocystis sp. ATCC
           49242]
          Length = 504

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 165/467 (35%), Positives = 251/467 (53%), Gaps = 50/467 (10%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           ++IS+G+ K II+ +P D  +V+V +P  AD +V S R +Y+ G + GQ  +  +   G+
Sbjct: 46  RRISMGVGKSIIVDLPRDATEVVVGNPKVADAIVRSARKLYIMGMDAGQTTIFAVDSSGR 105

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
           Q+ NL+I I RD+  L   L+  +  SNI    V+D ++L G V +  ++ RAV++++ F
Sbjct: 106 QVANLEISIGRDVGELAPLLKAALPKSNITARTVNDIIILTGTVSSAGEALRAVDIAKGF 165

Query: 168 LS---------------QSGRNQYAN---SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDI 209
            S               Q+  +Q      S+   V+N L I GE+QV LKVT+AEV R +
Sbjct: 166 ASRAMGGGAGGGGGVAGQASNSQVGGVGGSADGNVINALTIRGEEQVMLKVTVAEVERKV 225

Query: 210 LKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSF--------ETVLH 261
           +KQ+GF     G      ++      GK V E   F++   +   +            L 
Sbjct: 226 IKQLGFSAQAGG------ETILNGSWGKLVQEN-PFAINPTMSNSALIINGPNNTNATLK 278

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST----------GATSVTTHD 311
           A ER    R LAEPT+TA+SG++A    GG+       S T           +  +T   
Sbjct: 279 AFERYGVSRILAEPTVTAVSGEAAKMLVGGEIAVPGSGSCTFFTNGGGQPICSPGITFKS 338

Query: 312 YGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG-----VNAGDMPSYRVRKADTTVELPSGG 366
           YGV L+F P VLS GRI L +  EV+E  +       N   +P ++ RK +T+VELPSGG
Sbjct: 339 YGVSLNFVPIVLSEGRIHLHLAAEVTEVDLQNTFTYANVA-VPGFKTRKNETSVELPSGG 397

Query: 367 TIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRD 426
           +I  AGLL     Q   G+P L  +PILGALFR+  + R ETE+ +  TP++V+P++ +D
Sbjct: 398 SIATAGLLTQKSSQAISGLPGLLNLPILGALFRSRDYLRNETELLVIVTPYIVRPLSAQD 457

Query: 427 LSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIY 473
           +SRPDD ++   D + +   RVN+IY  +   ++  QN+KG IGFI+
Sbjct: 458 VSRPDDGFADASDPQGWLLGRVNRIYSTRNNPQLM-QNFKGRIGFIH 503


>gi|316933039|ref|YP_004108021.1| type II and III secretion system protein [Rhodopseudomonas
           palustris DX-1]
 gi|315600753|gb|ADU43288.1| type II and III secretion system protein [Rhodopseudomonas
           palustris DX-1]
          Length = 478

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 150/437 (34%), Positives = 256/437 (58%), Gaps = 25/437 (5%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           + +++G+ K +++ +P D++DVLV+DP  A+ V+ S +  Y+ G  VGQ N++     G+
Sbjct: 53  QSVALGIGKSMVIDLPRDIKDVLVADPKIANAVIRSAQRAYIIGAAVGQTNIVFFDSTGR 112

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
           Q+   DI + RD+  +   L++ +  ++I+VE + + V+L+G V +  ++Q+A +L+   
Sbjct: 113 QIAAYDIAVTRDLNGIRTALKQTLPTADIQVEGLGEGVMLNGSVASPIEAQQAFDLAARL 172

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
           +             KKV+N + + G DQV LK+T+AEV+RDI+KQ+G   S   +     
Sbjct: 173 VGDD----------KKVVNNIAVRGRDQVMLKITVAEVQRDIVKQLGVDLSANMAYGTAV 222

Query: 228 KSFAADFGGKFVSEGGDFSVKGVLD-RF----SFETVLHALERATAIRTLAEPTLTAISG 282
            +F  +    F   G        L  +F    S    L A+E A  +RTLAEP LTAISG
Sbjct: 223 VNF--NNTNPFTQSGSALVPNNALTTKFGSLPSVTATLRAMESAGVVRTLAEPNLTAISG 280

Query: 283 QSASFTSGGQHLYK---TVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE- 338
           + A+F +GG+       T ++     SV    +G++L+FTP V++ GRI L++ TEVSE 
Sbjct: 281 EPATFLAGGEFPVPSGVTCTNGVCTPSVVFKKFGILLNFTPVVMTAGRISLKVMTEVSEV 340

Query: 339 ---PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILG 395
                + +N+  +PS + R+ ++T+E+PSGG++ +AGL+++  +Q   G+P  +++PILG
Sbjct: 341 SSDNAVVINSLSVPSIKTRRVESTLEIPSGGSLAMAGLIQEQTKQAINGMPGAAQLPILG 400

Query: 396 ALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPK 455
            LFR+  +   +TE+ +  TP++V+ VA +DLSRPDD ++   D ++     +NK+YG  
Sbjct: 401 TLFRSRDYINRQTELMVLVTPYVVRAVAQKDLSRPDDGFADASDPQSDLLGSLNKLYGAP 460

Query: 456 EASEVEGQNYKGAIGFI 472
             SE   + Y+G  GFI
Sbjct: 461 GRSE-PARTYRGRFGFI 476


>gi|300021854|ref|YP_003754465.1| type II and III secretion system protein [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299523675|gb|ADJ22144.1| type II and III secretion system protein [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 550

 Score =  274 bits (700), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 181/507 (35%), Positives = 267/507 (52%), Gaps = 63/507 (12%)

Query: 27  PPIKEANAAVINISDVE-IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPR 85
           P   +   +++ IS+ E +   K I IGL K ++++ P  V+DV+ S+P   D VV S  
Sbjct: 48  PEFSKNTQSIVRISESEGLPVRKSIKIGLGKSVLIEFPNGVRDVMASNPAVVDAVVLSSN 107

Query: 86  TMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTV 145
            ++L GK  GQ+N     + G+Q+  +++ ++++   LEM LRR I  S I+VE ++ T 
Sbjct: 108 RVFLLGKAPGQSNAFFFSNKGEQLALIELNVDQEGDGLEMLLRRVIPGSEIKVETLNQTA 167

Query: 146 VLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS--------------------SKKVM 185
           +L G V++  DS RA  ++  F+SQ   N  +N S                     K V+
Sbjct: 168 ILTGRVKSPSDSARASRIAAQFMSQMIANWASNVSLTSSGSGQQNKAGEVKDADDVKSVI 227

Query: 186 NLLNIAGEDQVTLKVTIAEVRRDILKQIG-----------FQHSITGSSSGP-------- 226
           NLL +  E+QV LKVT+AEV+R +LKQ+G           F  ++   ++ P        
Sbjct: 228 NLLTVEAEEQVMLKVTVAEVKRTLLKQLGINLGGVLSSGSFSTTLLTENAFPISTAQGLG 287

Query: 227 --------SKSFAADFGGKFVS-----EGGDFSVKGVLD-----RFSFETVLHALERATA 268
                   + + AA   G+  +       G F   G++      R + ++ + ALER   
Sbjct: 288 SLPTFGVGTAASAACAVGQICAFNPGPATGAFGNSGLVSGWGNSRNNIQSAVRALERDGL 347

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKT-VSSSTGATSVTTHDYGVVLHFTPTVLSPGR 327
           I+TLAEP LTAISG+ A F +GG+  Y T V + TG ++V    +GV L FTP VL+ GR
Sbjct: 348 IKTLAEPNLTAISGEPAEFLAGGEVPYVTGVDTQTGVSAVAFKKFGVQLAFTPVVLTEGR 407

Query: 328 IGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           I L+I T VS+  I       P +  R+A T VELPSGG++ LAGL+    QQ  +G+P 
Sbjct: 408 ISLKIDTSVSD--ISQYVAGNPVFDTRQAKTVVELPSGGSLALAGLISTKTQQNIDGLPG 465

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR 447
              IPILG LFR+  F  +E+E+ +  TP+LV+PVA + LS P D      D KA F   
Sbjct: 466 AKDIPILGTLFRSRDFQNDESELVVIVTPYLVQPVARQQLSAPTDGLYPATDLKADFLGH 525

Query: 448 VNKIYGPKEASEVEGQNYKGAIGFIYK 474
           +N+IYG  E     G   KG  GFI +
Sbjct: 526 LNRIYGKSEVQPSGG--LKGDYGFIVE 550


>gi|296444395|ref|ZP_06886360.1| type II and III secretion system protein [Methylosinus
           trichosporium OB3b]
 gi|296258042|gb|EFH05104.1| type II and III secretion system protein [Methylosinus
           trichosporium OB3b]
          Length = 485

 Score =  273 bits (699), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 174/493 (35%), Positives = 267/493 (54%), Gaps = 37/493 (7%)

Query: 2   RYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQ 61
           R+L  T  T +++    S P+VA       A  +    SD +    +++++G+ K II+ 
Sbjct: 6   RHLIPTLATALALVGAGSLPAVA-------APQSWGVESDSDAIMSRRVAMGVGKSIIVD 58

Query: 62  VPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIA 121
           +P D  +++V +P  A+ VV S R +Y+ G   GQ  +  +   G+Q+ NL+I I RD+ 
Sbjct: 59  LPADAAEIVVGNPKVANAVVRSTRKLYIMGVETGQTTIFALDRSGRQIANLEISIGRDVG 118

Query: 122 HLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSS 181
            L   L   + +SNI    V+D ++L G V +  ++QRAV++++ F ++S      ++  
Sbjct: 119 ELGPLLHAALPNSNISARTVNDAIILTGTVDSASEAQRAVDIAKGFAARSASASAQSAGG 178

Query: 182 KK----VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGK 237
                 V+N L I  +DQV LKVT+AEV R +LKQ+G    I+  S G  ++      G+
Sbjct: 179 SPADGLVVNALVIRTQDQVMLKVTVAEVERRVLKQLG----ISAQSGG--ETLLKGGWGQ 232

Query: 238 FVSEGGDFSVKGVLDRFSFE--------TVLHALERATAIRTLAEPTLTAISGQSASFTS 289
            V +   F+V   L   S            L A ER    R LAEPT+TAISG+SA FT 
Sbjct: 233 LVQQN-PFAVNSALTASSLTINGNNGSTATLQAYERYGVSRVLAEPTVTAISGESAKFTV 291

Query: 290 GGQHLYKTVSSSTGATSVTT------HDYGVVLHFTPTVLSPGRIGLRIQTEVSE----P 339
           GG+      SS    +++ +        YGV L+FTP VL+ GRI L + TEV+E     
Sbjct: 292 GGEIAVPGNSSCIAGSTLCSSVGIVFKPYGVSLNFTPVVLAQGRILLHLATEVTEIDYQA 351

Query: 340 VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFR 399
               N   +P ++ RK +T+VELPSGG+I  AGLL     Q   G+P L  +P+LGALFR
Sbjct: 352 AQAYNGVTVPGFKTRKNETSVELPSGGSIATAGLLTQKSDQAINGLPGLINLPVLGALFR 411

Query: 400 NSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASE 459
           +  + R ETE+ I  TP++ + ++ RD++RPDD ++   D +A+   RVN++Y   +  +
Sbjct: 412 SRDYQRNETELLIVVTPYIARALSARDVTRPDDGFADASDPQAWLLGRVNRLYANPQHPQ 471

Query: 460 VEGQNYKGAIGFI 472
              Q  KG IGFI
Sbjct: 472 AAPQ-LKGRIGFI 483


>gi|146342078|ref|YP_001207126.1| putative pilus assembly protein CpaC [Bradyrhizobium sp. ORS278]
 gi|146194884|emb|CAL78909.1| putative Pilus assembly protein cpaC [Bradyrhizobium sp. ORS278]
          Length = 492

 Score =  272 bits (695), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 162/481 (33%), Positives = 273/481 (56%), Gaps = 50/481 (10%)

Query: 20  NPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADV 79
           NP++A +   ++ +A  +++   ++     +S+G+ K +++  P DV+DVLV+DP  A+ 
Sbjct: 32  NPALAPVKAAEDRDAPTVSVGSSKV---HYLSLGIGKSVVVDFPQDVKDVLVADPKIANA 88

Query: 80  VVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVE 139
           VV S +  Y+ G  +GQ NV+    +G+Q+   DI I+RD+  +   L + I    ++++
Sbjct: 89  VVRSAKRAYIIGAAIGQTNVVFFDGEGQQVAAYDIAIKRDLNGVRQALSQSI--PGVKID 146

Query: 140 MVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLK 199
            V D V+L G V +  ++Q+A E++   +            + KV+N + + G DQV LK
Sbjct: 147 GVGDGVILTGSVSSPVEAQQAGEIAARLVG----------GADKVVNSIVVRGRDQVMLK 196

Query: 200 VTIAEVRRDILKQIGFQHS---------ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGV 250
           V ++EVRR+I+KQ+G   S         +  + + P  ++     GK ++ G   S  G 
Sbjct: 197 VNVSEVRREIVKQLGIDLSASMTYGTAVVNFNQTNPFTAY-----GKSLAAGNGLSAIGG 251

Query: 251 LDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYK---TVSSSTG--AT 305
            +  S    + A+E A  ++TLAEP LTAISG+SA+F +GG+       +    TG  +T
Sbjct: 252 GNLSSVSATMRAMETAGVVKTLAEPNLTAISGESATFIAGGEFPVPGGYSCDPKTGLCST 311

Query: 306 SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP----------VIGVNAGD---MPSYR 352
           SV    +G+ L+FTP VLS GRI LR+ TEVSE               N+     +P+ R
Sbjct: 312 SVMFKKFGISLNFTPVVLSEGRISLRVMTEVSELSNDNAITLSYATSANSASSVTIPAIR 371

Query: 353 VRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFI 412
            R+A+TT+E+PSGG++ +AGL+++  +Q   G+P L+++P+LG LFR+  +   ETE+ +
Sbjct: 372 TRRAETTLEIPSGGSMAMAGLIQNQTKQAINGLPGLNQLPVLGQLFRSQDYVNNETELMV 431

Query: 413 AATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYG-PKEASEVEGQNYKGAIGF 471
             TP++V+ VA ++LSRPDD ++   D+++    R+N++YG   +   V GQ      GF
Sbjct: 432 LVTPYVVRAVAQKELSRPDDGFAPATDSESALLGRMNRLYGVAAKVDAVTGQ--PAGFGF 489

Query: 472 I 472
           I
Sbjct: 490 I 490


>gi|148256957|ref|YP_001241542.1| putative pilus assembly protein CpaC [Bradyrhizobium sp. BTAi1]
 gi|146409130|gb|ABQ37636.1| putative Pilus assembly protein cpaC [Bradyrhizobium sp. BTAi1]
          Length = 489

 Score =  270 bits (690), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 164/480 (34%), Positives = 274/480 (57%), Gaps = 53/480 (11%)

Query: 3   YLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQV 62
           +L R F T  +I L + NP++A +   ++ +  V+++   ++     +S+G+ K +++  
Sbjct: 14  WLVRAFSTAAAIGL-AINPALAPVHAAEDRDTPVVSVGSSKV---HYLSLGIGKSVVVDF 69

Query: 63  PVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAH 122
           P DV+DVLV+DP  A+ VV S R  Y+ G  VGQ NV+    +G+Q+   DI I+RD+  
Sbjct: 70  PQDVKDVLVADPKIANAVVRSARRAYIIGAAVGQTNVVFFDGEGQQVAAYDIAIKRDLNG 129

Query: 123 LEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK 182
           +   L + I    ++++ V D V+L G V +  ++Q+A E++   +            S 
Sbjct: 130 VRQALSQSI--PGVKIDGVGDGVILTGSVSSPVEAQQAGEIASRLVG----------GSD 177

Query: 183 KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS---------ITGSSSGPSKSFAAD 233
           KV+N + + G DQV LKV ++EVRR+I+KQ+G   S         +  +++ P  ++   
Sbjct: 178 KVVNSIVVRGRDQVMLKVNVSEVRREIVKQLGIDLSASMTYGTAVVNFNNTNPFTAY--- 234

Query: 234 FGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQ- 292
             GK +  G   +V G     S    + A+E A   +TLAEP LTAISG+SA+F +GG+ 
Sbjct: 235 --GKSLVNGNALNVSG-GGLSSVSATMRAMETAGVTKTLAEPNLTAISGESATFIAGGEF 291

Query: 293 ------HLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIG 342
                 +   T    T  TS+T   +G+ L+FTP VLS GRI LR+ TEVSE      I 
Sbjct: 292 PVPGGYNCDPTTRVCT--TSITYKKFGISLNFTPVVLSEGRISLRVMTEVSELSNDNAIT 349

Query: 343 VNAG---------DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPI 393
           V+            +P+ R R+A+TT+E+PSGG++ +AGL+++  +Q   G+P + ++P+
Sbjct: 350 VSYALTSTSSSSVTIPAIRTRRAETTLEIPSGGSMAMAGLIQNQTKQAINGLPGVDQLPV 409

Query: 394 LGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYG 453
           LG LFR+  +   ETE+ +  TP++V+ VA ++L+RPDD ++   D+++    R+N++YG
Sbjct: 410 LGQLFRSKDYVNNETELMVLVTPYVVRAVAQKELARPDDGFAPATDSESALLGRMNRLYG 469


>gi|115525749|ref|YP_782660.1| type II and III secretion system protein [Rhodopseudomonas
           palustris BisA53]
 gi|115519696|gb|ABJ07680.1| type II and III secretion system protein [Rhodopseudomonas
           palustris BisA53]
          Length = 486

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 158/445 (35%), Positives = 263/445 (59%), Gaps = 37/445 (8%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++G++K +++ +P D++DVLV+DP  A  V+ S +  Y+ G +VGQ N++     G+Q+
Sbjct: 55  LALGISKSVVIDLPRDIKDVLVADPKIATAVIRSAQRAYIIGASVGQTNIVFFDAAGQQI 114

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDT-VVLHGMVRTIQDSQRAVELSETFL 168
              DI + RD+  +   L++ + +++IRVE V    V+L G V +  ++Q+A E++   L
Sbjct: 115 AAYDIAVTRDLNGIRAALKQTLPNTDIRVEGVGPKGVLLSGSVSSPVEAQQAGEVAAR-L 173

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK 228
           ++   N         V+N + + G DQV LKVT+AEV+RDI+KQ+G   S + +      
Sbjct: 174 AEGAEN---------VVNSIAVRGRDQVMLKVTVAEVQRDIIKQMGIDLSASMTYGTAVV 224

Query: 229 SFA-----ADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQ 283
           +F        FG + V+  G+          +    L A+E A  +RTLAEP LTAISG+
Sbjct: 225 NFNNTNPFTAFGRQLVT--GNSLATSFGGGPTVTATLRAMESAGVVRTLAEPNLTAISGE 282

Query: 284 SASFTSGGQ------HLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS 337
           SA+F +GG+      + Y  V+   G T +    +G+ L+FTP V++ GRI LR+ TEVS
Sbjct: 283 SATFIAGGEFPVPSGYNYDPVTH-VGTTQIAFKKFGISLNFTPVVMTEGRISLRVMTEVS 341

Query: 338 EP------VIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
           E        +  + GD   +PS + R+A+TT+E+PSGG++ +AGL+++  +Q   G+P +
Sbjct: 342 ELSNDNSITLTQSNGDGLTVPSIKTRRAETTLEIPSGGSMAMAGLIQEQTKQAINGLPGM 401

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV 448
           ++IP+LG+LFR+  +   +TE+ +  TP++V+ VA +DLSRPDD ++   D +      +
Sbjct: 402 AQIPVLGSLFRSRDYVNRQTELMVLVTPYVVRAVAQKDLSRPDDGFAAVSDPQGDLLGSI 461

Query: 449 NKIYG-PKEASEVEGQNYKGAIGFI 472
           N+IYG P +      +NY+G  GFI
Sbjct: 462 NRIYGVPGKPG--PDRNYRGTYGFI 484


>gi|254473733|ref|ZP_05087128.1| type II and III secretion system protein [Pseudovibrio sp. JE062]
 gi|211957119|gb|EEA92324.1| type II and III secretion system protein [Pseudovibrio sp. JE062]
          Length = 456

 Score =  268 bits (685), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 171/484 (35%), Positives = 280/484 (57%), Gaps = 49/484 (10%)

Query: 12  MSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLV 71
           M++ L  + P +A      EA   V +   V++   +++++G  + I+L    +V+DVLV
Sbjct: 1   MALTLTVTAPQLATAQTNFEATVEVTSQHSVKV---RQLNVGEGRSIVLNTNEEVRDVLV 57

Query: 72  SDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFI 131
           S+P  AD VV +   +++FG   GQA+++L G+ GKQ+ + ++ ++ D + L   ++R +
Sbjct: 58  SNPKIADAVVRTRNRVFVFGNETGQASLVLFGNGGKQLASFNLNVQPDPSGLIELIQRLL 117

Query: 132 ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIA 191
            +S I  ++V+++VVL G   +  ++Q+A +++  F+          +  KK++N + +A
Sbjct: 118 PNSAINADIVNESVVLSGTAISALEAQQAYDIALKFVG---------NDDKKIVNTIAVA 168

Query: 192 GEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS----------------GPSKSFAADFG 235
            +DQV LKVT+AEV R  +KQ+G   S+ G+ S                 PS   A  F 
Sbjct: 169 EKDQVQLKVTVAEVERTTIKQLGV--SLQGALSIGALDVKFNTSPAYNINPSVVNAGLFQ 226

Query: 236 GKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLY 295
           G+    GG           S    + ALER   ++TLAEPTL A+SG++ASF +GG+   
Sbjct: 227 GQLPIGGG-----------SIVPTIKALERDGVMKTLAEPTLVAVSGENASFLAGGEFPI 275

Query: 296 KTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE-----PVIGVNAGDMPS 350
             V+      S+    +GV L FTP VLS GRI LRI+TEVSE      V    A  + +
Sbjct: 276 P-VAYEDNKISLEFKPFGVGLDFTPVVLSEGRIKLRIKTEVSELSSEGAVNLAGAISVSA 334

Query: 351 YRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEI 410
            +VR+A++T+ELPSGGT+V+AGLLK +  Q  +GIP L  +PILG +F++  +  ++TE+
Sbjct: 335 LKVRRAESTLELPSGGTLVMAGLLKHNYGQEIDGIPGLKDVPILGTMFKSRDYINKQTEL 394

Query: 411 FIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIG 470
            I  TP++V+PVA   ++RPDD+++   D    F N++++IY   +A  V+G +Y G IG
Sbjct: 395 VIFVTPYVVRPVARSQIARPDDNFAAPSDQSTIFLNQLSRIYRSTDAP-VKG-SYHGKIG 452

Query: 471 FIYK 474
           +IY+
Sbjct: 453 YIYE 456


>gi|307943145|ref|ZP_07658490.1| type II and III secretion system protein [Roseibium sp. TrichSKD4]
 gi|307773941|gb|EFO33157.1| type II and III secretion system protein [Roseibium sp. TrichSKD4]
          Length = 482

 Score =  267 bits (683), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 166/476 (34%), Positives = 271/476 (56%), Gaps = 45/476 (9%)

Query: 22  SVAKLPPIKEANAAV---INISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKAD 78
           S+A +P    A  A    ++++  E    + +S+G+ + +I+     V DVLVS+P  AD
Sbjct: 29  SLAGVPEPAAAQGAFEKRVHVASGERVSSRLLSVGVGRSVIIDTAEAVADVLVSNPGVAD 88

Query: 79  VVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRV 138
            VV +P  +++ G   GQAN++L    G+++ + ++ +E D + L   +++++  SNI  
Sbjct: 89  AVVRTPNRIFVLGNKAGQANLVLFSRTGRELASFNLRVEPDTSDLVRFIQKYVPGSNIEA 148

Query: 139 EMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTL 198
           + ++  ++L G      D+QRA +L+  +     +       +  ++N++ + GEDQV L
Sbjct: 149 QSLNGNIILSGTAANAADAQRAADLAARYAGDGKK-------ATDILNMITVDGEDQVHL 201

Query: 199 KVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSE---GGDFSVKGVLDRFS 255
           KVT+AEV R+++KQ+G Q +      G  K    +FG  F ++       SV     R +
Sbjct: 202 KVTVAEVDREVIKQLGVQLN------GEIK--IGNFGFGFANDTSFNAGTSVAQQTTRLA 253

Query: 256 FETV---------LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATS 306
            E V         + AL+R   ++TLAEPTLTAISG++ASF +GG+     +S      +
Sbjct: 254 GELVSGGTTIGAEVKALQREGIVKTLAEPTLTAISGENASFLAGGEFPIP-ISQDGNEVT 312

Query: 307 VTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVEL 362
           V    +GV L FTP VLS GRI L+I TEVSE      + +    +P+ +VR+A++T+EL
Sbjct: 313 VEFKKFGVGLDFTPIVLSGGRISLKITTEVSELSSDGAVNIGTLTIPALKVRRAESTLEL 372

Query: 363 PSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV 422
           PSGGT+V+AGLL++  +Q   G+P L  +P+LG+LF++  F R +TE+ +  TP++V P+
Sbjct: 373 PSGGTLVMAGLLQESYRQSVNGVPGLMNLPVLGSLFKSRDFLRSQTELVVFVTPYIVNPI 432

Query: 423 AMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQN----YKGAIGFIYK 474
           A   + RPD + +  +D++  F NR+NKIY         GQN    Y G +GFIYK
Sbjct: 433 AASKVQRPDKNLAPANDSETLFLNRLNKIY------RANGQNAQAPYHGQVGFIYK 482


>gi|170740621|ref|YP_001769276.1| type II and III secretion system protein [Methylobacterium sp.
           4-46]
 gi|168194895|gb|ACA16842.1| type II and III secretion system protein [Methylobacterium sp.
           4-46]
          Length = 501

 Score =  263 bits (671), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 158/463 (34%), Positives = 262/463 (56%), Gaps = 25/463 (5%)

Query: 25  KLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSP 84
           K P I    A V++I   E    ++I +   + +++ +P D ++V V++P  A+ VV S 
Sbjct: 47  KAPAIA---APVLSIGPQEAEIARRIDLTQGRSLVIDLPRDAKEVFVANPKVANAVVRST 103

Query: 85  RTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDT 144
           R +++ G   G  ++ ++  +G+Q+ +LD+ + RD+  L  TL   +  +   V    D+
Sbjct: 104 RKVFIIGVENGATSIFVMDAEGRQIASLDVTVGRDLNILRQTLATSLPSARFEVRPAGDS 163

Query: 145 VVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAE 204
           ++L G V +  ++Q+A++++  F+  +G       +   V+N + I G+DQV L+VT+ E
Sbjct: 164 ILLSGTVNSATEAQQALDIANAFVGIAG----GTVTRGAVINNITIRGKDQVMLRVTVVE 219

Query: 205 VRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDR---FSFETVLH 261
           V R +LKQ G   S++GS SG + + A  F        G+  ++G ++     S +  L 
Sbjct: 220 VSRTVLKQFGV--SLSGSWSGLNLTNATQFALNGDRGLGNL-IEGTINGGAGASLKATLK 276

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATS----VTTHDYGVVLH 317
           A E+A   R LAEPTLTAISG+SA FT+GG+    +  S T A +    +T   YGVVL+
Sbjct: 277 AFEQAGVSRILAEPTLTAISGESAKFTAGGEIAVPSGLSCTTANNCIPGITFKQYGVVLN 336

Query: 318 FTPTVLSPGRIGLRIQTEVSEP--------VIGVNAGDMPSYRVRKADTTVELPSGGTIV 369
           FTP VLS  RI +R+ T+V+E          IG  +  +P + +RK++TT+EL SG TI+
Sbjct: 337 FTPVVLSENRISIRVGTDVTEIDQQNAYSYNIGTTSTSVPGFTIRKSETTIELASGATIM 396

Query: 370 LAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSR 429
            AGL++   +    G+P L  +P+LGALFR+  + R+ETE+ I  TP++ K +   ++ R
Sbjct: 397 TAGLIQQKNKAAVMGLPALMNLPVLGALFRSRDYQRDETELMIMVTPYIAKAMDPGEVKR 456

Query: 430 PDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
           PDD +    D +A    R N++YG   A+ +  + Y+G  GFI
Sbjct: 457 PDDGFVDATDGQAILLGRFNRLYGVVGAAPLAPKAYRGKFGFI 499


>gi|114568970|ref|YP_755650.1| type II and III secretion system protein [Maricaulis maris MCS10]
 gi|114339432|gb|ABI64712.1| type II and III secretion system protein [Maricaulis maris MCS10]
          Length = 491

 Score =  260 bits (664), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 156/467 (33%), Positives = 260/467 (55%), Gaps = 51/467 (10%)

Query: 43  EIGKG---KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANV 99
           E G G   + + + L+K  ++ +PVDV DVLV++P   + +V +PR  Y+ G  +GQ N 
Sbjct: 41  EPGNGPVSETLDLPLSKAAVVHLPVDVADVLVTNPAVVEAIVRTPRRAYIMGMGIGQTNA 100

Query: 100 ILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQR 159
                +G+ +L+LD+ +ERD++ L+ ++ RF+ ++ I VE ++D +VL G   +  D+  
Sbjct: 101 FFFDANGQLILDLDLRVERDLSPLQESIDRFLPNARIEVEAMNDHIVLSGRAPSASDADA 160

Query: 160 AVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
           A+ +++ ++           +   +++++++   +QV L+V I E++R I++Q+G   S 
Sbjct: 161 ALRIAQRWVD----------NPDNILSMISVEAREQVMLRVRIVEMQRTIVRQLGVNLST 210

Query: 220 TGSSS--GPSKSFAADFG--GKFVSEGGDFSVKGVLDRFSFET--------VLHALERAT 267
            G++   G   S + DF   G+F+  GG      +LD  S  T        +L A+ER  
Sbjct: 211 AGTTGEFGFGVSTSPDFSRVGRFL--GG---TSAMLDWVSGNTGGVESVSAMLQAMERVG 265

Query: 268 AIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGR 327
            +RTLAEP LTAI+G+SA+F +GG+          G   +    +GV L FTP VLS GR
Sbjct: 266 LVRTLAEPNLTAITGESANFLAGGEFPVPVGRDRDGNIIIEYKPFGVGLGFTPVVLSEGR 325

Query: 328 IGLRIQTEVSE-------------------PVIGVNAG-DMPSYRVRKADTTVELPSGGT 367
           I LRI TEVSE                    VIG   G  +P+  V +A+TTVELPSGG+
Sbjct: 326 ISLRISTEVSELTSQGSLTFQSNNVLDDDGNVIGTVPGLTIPALNVNRAETTVELPSGGS 385

Query: 368 IVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDL 427
           +VLAGL++++ +Q  +G+P +  +P+LG+LFR+  +  +ETE+ +  TP+LV P     L
Sbjct: 386 LVLAGLIQEETRQNLDGVPGVQNLPVLGSLFRSRDYENQETELVVLVTPYLVDPTNPNQL 445

Query: 428 SRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
             P D +    +A    F R+N+ Y     S+   + + G +GF+++
Sbjct: 446 QTPADGFRNASEASGLLFGRINRAYS-VPGSDTGDRGWSGPVGFLFE 491


>gi|163851903|ref|YP_001639946.1| type II and III secretion system protein [Methylobacterium
           extorquens PA1]
 gi|163663508|gb|ABY30875.1| type II and III secretion system protein [Methylobacterium
           extorquens PA1]
          Length = 502

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 158/470 (33%), Positives = 250/470 (53%), Gaps = 43/470 (9%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVG 95
           V+ I   E    +++ +   + +I+ +P D ++V V++P  A+ VV S R ++L G + G
Sbjct: 41  VLTIGANEAAVSRRVELSKGRSLIVDLPRDAKEVFVANPAVANAVVRSSRKLFLIGIDNG 100

Query: 96  QANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
             ++ ++  +G+Q+  LD+ I RDI  L  +L++ +      V+ V D++VL G V +  
Sbjct: 101 ATSIFVMDGEGRQIAALDVTIARDINVLRQSLQQSLPGGRFDVKAVGDSLVLSGSVNSTS 160

Query: 156 DSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
           ++Q+A++++  F+  +     A   +  V+N L I  +DQV ++VT+ EV R +LKQ G 
Sbjct: 161 EAQQALDIANAFVGIAAGGGVATRGA--VINNLTIRNKDQVMIRVTVVEVARTVLKQFGI 218

Query: 216 QHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGV-------------LDRFSFETVLHA 262
             S   S+  P        GG F++    F + G                 FSF+  L A
Sbjct: 219 STSGNWSALNP-------LGGNFLTNNTGFPLTGSRSPDANALTASVQTGGFSFKATLRA 271

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQ-------HLYKTVSSSTGAT-----SVTTH 310
            E+A   R LAEPTLTAISG+SA FT+GG+           TVS  T  +     ++T  
Sbjct: 272 FEQAGVSRILAEPTLTAISGESAKFTAGGEIPVPLSCSAASTVSIGTSVSQGCVVALTYK 331

Query: 311 DYGVVLHFTPTVLSPGRIGLRIQTEVSE--P------VIGVNAGDMPSYRVRKADTTVEL 362
            YGV L FTP V++  RI +RI T+V +  P       +      +P    R ++TTVEL
Sbjct: 332 PYGVSLSFTPVVMAENRISVRIATDVVDLDPQNSFTYYLNDRPTPVPGTTKRSSETTVEL 391

Query: 363 PSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV 422
            SG T++ AGL++   +    G+P L  +PILGALFR+  + R+ETE+ I  TP++ +P+
Sbjct: 392 ASGATMMTAGLIQQKNRAAISGLPGLMNLPILGALFRSRDYQRDETELMIMVTPYIAQPM 451

Query: 423 AMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
             R + RPDD +    D +A    R+NKIYG      + G  Y+G +GFI
Sbjct: 452 EARQVQRPDDGFVDAPDGQAVLLGRLNKIYGTVGGGTL-GPAYRGRVGFI 500


>gi|254561621|ref|YP_003068716.1| pilus assembly protein [Methylobacterium extorquens DM4]
 gi|254268899|emb|CAX24860.1| putative pilus assembly protein; putative precursor
           [Methylobacterium extorquens DM4]
          Length = 502

 Score =  253 bits (647), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 158/470 (33%), Positives = 250/470 (53%), Gaps = 43/470 (9%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVG 95
           V+ I   E    +++ +   + +I+ +P D ++V V++P  A+ VV S R ++L G + G
Sbjct: 41  VLTIGANEAAVSRRVELSKGRSLIVDLPRDAKEVFVANPAVANAVVRSSRKLFLIGIDNG 100

Query: 96  QANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
             ++ ++  +G+Q+  LD+ I RDI  L  +L++ +      V+ V D++VL G V +  
Sbjct: 101 ATSIFVMDGEGRQIAALDVTIARDINVLRQSLQQSLPGGRFDVKAVGDSLVLSGSVNSTS 160

Query: 156 DSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
           ++Q+A++++  F+  +     A   +  V+N L I  +DQV ++VT+ EV R +LKQ G 
Sbjct: 161 EAQQALDIANAFVGIAAGGGVATRGA--VINNLTIRNKDQVMIRVTVVEVARTVLKQFGI 218

Query: 216 QHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGV-------------LDRFSFETVLHA 262
             S   S+  P        GG F++    F + G                 FSF+  L A
Sbjct: 219 STSGNWSALNP-------LGGNFLTNNTGFPLTGSRSPDANALTASVQTGGFSFKATLRA 271

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQ-------HLYKTVSSSTGAT-----SVTTH 310
            E+A   R LAEPTLTAISG+SA FT+GG+           TVS  T  +     ++T  
Sbjct: 272 FEQAGVSRILAEPTLTAISGESAKFTAGGEIPVPLSCSAASTVSIGTSVSQGCVVALTYK 331

Query: 311 DYGVVLHFTPTVLSPGRIGLRIQTEVSE--P------VIGVNAGDMPSYRVRKADTTVEL 362
            YGV L FTP V++  RI +RI T+V +  P       +      +P    R ++TTVEL
Sbjct: 332 PYGVSLSFTPVVMAENRISVRIATDVVDLDPQNSFTYYLNDRPTPVPGTTKRSSETTVEL 391

Query: 363 PSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV 422
            SG T++ AGL++   +    G+P L  +PILGALFR+  + R+ETE+ I  TP++ +P+
Sbjct: 392 ASGATMMTAGLIQQKNRAAISGLPGLMNLPILGALFRSRDYQRDETELMIMVTPYIAQPM 451

Query: 423 AMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
             R + RPDD +    D +A    R+NKIYG      + G  Y+G +GFI
Sbjct: 452 EARQVQRPDDGFVDAPDGQAVLLGRLNKIYGTVGGGTL-GPAYRGRVGFI 500


>gi|240139026|ref|YP_002963501.1| putative pilus assembly protein; putative precursor
           [Methylobacterium extorquens AM1]
 gi|240008998|gb|ACS40224.1| putative pilus assembly protein; putative precursor
           [Methylobacterium extorquens AM1]
          Length = 502

 Score =  253 bits (646), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 158/470 (33%), Positives = 250/470 (53%), Gaps = 43/470 (9%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVG 95
           V+ I   E    +++ +   + +I+ +P D ++V V++P  A+ VV S R ++L G + G
Sbjct: 41  VLTIGANEAAVSRRVELSKGRSLIVDLPRDAKEVFVANPAVANAVVRSSRKLFLIGIDNG 100

Query: 96  QANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
             ++ ++  +G+Q+  LD+ I RDI  L  +L++ +      V+ V D++VL G V +  
Sbjct: 101 ATSIFVMDGEGRQIAALDVTIARDINVLRQSLQQSLPGGRFDVKAVGDSLVLSGSVNSTS 160

Query: 156 DSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
           ++Q+A++++  F+  +     A   +  V+N L I  +DQV ++VT+ EV R +LKQ G 
Sbjct: 161 EAQQALDIANAFVGIAAGGGVATRGA--VINNLTIRNKDQVMIRVTVVEVARTVLKQFGI 218

Query: 216 QHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGV-------------LDRFSFETVLHA 262
             S   S+  P        GG F++    F + G                 FSF+  L A
Sbjct: 219 STSGNWSALNP-------LGGNFLTNNTGFPLTGSRSPDANALTASVQTGGFSFKATLRA 271

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQ-------HLYKTVSSSTGAT-----SVTTH 310
            E+A   R LAEPTLTAISG+SA FT+GG+           TVS  T  +     ++T  
Sbjct: 272 FEQAGVSRILAEPTLTAISGESAKFTAGGEIPVPLSCSAASTVSIGTSVSQGCVVALTYK 331

Query: 311 DYGVVLHFTPTVLSPGRIGLRIQTEVSE--P------VIGVNAGDMPSYRVRKADTTVEL 362
            YGV L FTP V++  RI +RI T+V +  P       +      +P    R ++TTVEL
Sbjct: 332 PYGVSLSFTPVVMAENRISVRIATDVVDLDPQNSFTYYLNDRPTPVPGTTKRSSETTVEL 391

Query: 363 PSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV 422
            SG T++ AGL++   +    G+P L  +PILGALFR+  + R+ETE+ I  TP++ +P+
Sbjct: 392 ASGATMMTAGLIQQKNRAAISGLPGLMNLPILGALFRSRDYQRDETELMIMVTPYIAQPM 451

Query: 423 AMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
             R + RPDD +    D +A    R+NKIYG      + G  Y+G +GFI
Sbjct: 452 EARQVQRPDDGFVDAPDGQAVLLGRLNKIYGTVGGGTL-GPAYRGRVGFI 500


>gi|188581660|ref|YP_001925105.1| type II and III secretion system protein [Methylobacterium populi
           BJ001]
 gi|179345158|gb|ACB80570.1| type II and III secretion system protein [Methylobacterium populi
           BJ001]
          Length = 502

 Score =  249 bits (636), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 161/487 (33%), Positives = 254/487 (52%), Gaps = 45/487 (9%)

Query: 19  SNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKAD 78
           S P+ A+  P     + V+ I   E    +K+ +   + +I+ +P D ++V V++P  A+
Sbjct: 26  SGPASAQ--PGLPGASPVLTIGPNETAVSRKVELSKGRSLIIDLPRDAKEVFVANPAVAN 83

Query: 79  VVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRV 138
            VV S R ++L G + G  ++ ++  +G+Q+  LD+ I RDI  L  +L++ +      V
Sbjct: 84  AVVRSSRKLFLIGIDNGATSIFVMDAEGRQIAALDVTIARDINVLRQSLQQSLPSGRFDV 143

Query: 139 EMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTL 198
           + V D++VL G V +  ++Q+A++++  F+  +     A   +  V+N L I  +DQV +
Sbjct: 144 KAVGDSLVLSGSVNSASEAQQALDIANAFVGIAAGGGVATRGT--VINNLTIRNKDQVMI 201

Query: 199 KVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGV-------- 250
           +VT+ EV R +LKQ G   S   ++  P        GG   +    F + G         
Sbjct: 202 RVTVVEVARTVLKQFGISTSGNWAALNP-------LGGNVFTNNTGFPLTGSRSPDANAI 254

Query: 251 -----LDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQ-------HLYKTV 298
                   FSF   L A E+A   R LAEPTLTAISG+SA FT+GG+           TV
Sbjct: 255 TASVQTGGFSFRATLRAFEQAGVSRILAEPTLTAISGESAKFTAGGEIPVPLSCAAASTV 314

Query: 299 SSSTGAT-----SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--P------VIGVNA 345
           S  T  +     ++T   YGV L FTP V++  RI +RI T+V +  P       +    
Sbjct: 315 SIGTSISQGCVVALTYKPYGVSLSFTPVVMAENRISVRIATDVVDLDPQNSFTYYLNDRP 374

Query: 346 GDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNR 405
             +P    R ++TTVEL SG T++ AGL++   +    G+P L  +PILGALFR+  + R
Sbjct: 375 TPVPGTTRRSSETTVELASGATMMTAGLIQQKNRGAISGLPGLMNLPILGALFRSRDYQR 434

Query: 406 EETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNY 465
           +ETE+ I  TP++ +P+  R + +PDD Y    D +A    R+NKIYG      + G  Y
Sbjct: 435 DETELMIMVTPYIAQPMEARQVQKPDDGYVDAPDGQAVLLGRLNKIYGTVGGGTL-GPAY 493

Query: 466 KGAIGFI 472
           +G +GFI
Sbjct: 494 RGRVGFI 500


>gi|218530654|ref|YP_002421470.1| type II and III secretion system protein [Methylobacterium
           chloromethanicum CM4]
 gi|218522957|gb|ACK83542.1| type II and III secretion system protein [Methylobacterium
           chloromethanicum CM4]
          Length = 499

 Score =  246 bits (627), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 151/462 (32%), Positives = 250/462 (54%), Gaps = 30/462 (6%)

Query: 36  VINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVG 95
           V+ I   E    +++ +   + +I+ +P D ++V V++P  A+ VV S R ++L G + G
Sbjct: 41  VLTIGANEAAVSRRVELSKGRSLIVDLPRDAKEVFVANPAVANAVVRSSRKLFLIGIDNG 100

Query: 96  QANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
             ++ ++  +G+Q+  LD+ I RDI  L  +L+  +      V+ V D++VL G V +  
Sbjct: 101 ATSIFVMDGEGRQIAALDVTIARDINVLRQSLQLSLPGGRFDVKAVGDSLVLSGSVNSTS 160

Query: 156 DSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
           ++Q+A++++  F+  +     A   +  V+N L I  +DQV ++VT+ EV R +LKQ G 
Sbjct: 161 EAQQALDIANAFVGIAAGGGVATRGA--VINNLTIRNKDQVMIRVTVVEVARTVLKQFGI 218

Query: 216 QHSITGSSSG-----PSKSFAAD-----FGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
             ++TG+ +      P+ +   +       G +  +G   S        S +  L A E+
Sbjct: 219 --NVTGNWAALNPLSPTGNVLTNTTPFPLTGAYSPDGNALSASIRSGGVSLQATLRAFEQ 276

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQ-----HLYKTVSSSTGATSVTTHDYGVVLHFTP 320
           A   R LAEPTLTAISG+SA FT+GG+     +    V+ +    ++    YGV L FTP
Sbjct: 277 AGVSRILAEPTLTAISGESAKFTAGGEIPVPSNCSAGVAGAACTVALEFKPYGVSLAFTP 336

Query: 321 TVLSPGRIGLRIQTEVSE---------PVIGVN-AGDMPSYRVRKADTTVELPSGGTIVL 370
            V++  RI +R+ T+V+E            G N    +P+   R ++TTVEL SG T++ 
Sbjct: 337 IVMAENRISIRVATDVTELDRQNSYSFSFPGSNRVTPVPATTRRSSETTVELASGATMMT 396

Query: 371 AGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           AGL++   +    G+P L  +PILGALFR+  + R+ETE+ I  TP++ +P+  R + RP
Sbjct: 397 AGLIQQKSRASISGLPGLMNLPILGALFRSRDYQRDETELMIMVTPYIAQPMEARQVQRP 456

Query: 431 DDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
           DD +    D +A    R+NKIYG      + G  Y+G +GFI
Sbjct: 457 DDGFVDAPDGQAVLLGRLNKIYGTVGGGTL-GPAYRGRVGFI 497


>gi|315497465|ref|YP_004086269.1| type II and iii secretion system protein [Asticcacaulis excentricus
           CB 48]
 gi|315415477|gb|ADU12118.1| type II and III secretion system protein [Asticcacaulis excentricus
           CB 48]
          Length = 476

 Score =  245 bits (625), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 151/431 (35%), Positives = 238/431 (55%), Gaps = 35/431 (8%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           ++ +PVD  DV VS+P  AD V+ +PR +++ G   GQ++ I     G+Q+LNL I +  
Sbjct: 62  VVDLPVDAADVFVSNPAVADAVLRTPRRIFVLGVAAGQSDAIFFDATGRQILNLQIRVGV 121

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
               L  T+++    S+++V+ V+  V+L G+V    +S+    LS  F  +        
Sbjct: 122 STDQLSDTVQKLYPQSDVQVQSVNGYVILSGVVANASESEAIQRLSVAFAEKP------- 174

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK---SFAADFG 235
              + ++N+L++AG+DQV+LKV I EV++  +KQ+GF  +     +G  +     A  +G
Sbjct: 175 ---ENIINMLSVAGKDQVSLKVRIVEVQKSSIKQMGFNFNGLSGQTGEVQYALQNAPTYG 231

Query: 236 GKFVSEGGDFSVK-GVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHL 294
               + GG   +K G  D+      L A ER   +RTLAEP L A+SG+SA F +GG+  
Sbjct: 232 TNGKALGG---MKIGYADKL-LSASLQAFERVGLVRTLAEPNLAAVSGESAKFLAGGEFP 287

Query: 295 YKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGD------- 347
                 + G  +V    YGV L FTP VLS G I L++ TEVSE V   N G        
Sbjct: 288 VPVAKDTQGRVTVEFKTYGVGLGFTPVVLSNGTISLKLSTEVSEIV---NTGSFSLDDTF 344

Query: 348 -MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNRE 406
            +P   VR+A+TTVELPSGG++++AGLL+   +Q  + +P ++ IP+LGALFR+  F  E
Sbjct: 345 TIPGLSVRRAETTVELPSGGSLMIAGLLQSKYKQSIDALPGMTTIPVLGALFRSRDFLDE 404

Query: 407 ETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPK-----EASEVE 461
           +TE+ +  TP+++   +      P D++ V  D ++ F  R+NK    K     EA  + 
Sbjct: 405 QTEMVVIVTPYIISAKSPDAFQTPADNFQVASDLESVFLGRLNKSVRAKRGEVAEAPPLA 464

Query: 462 GQNYKGAIGFI 472
           G +Y+  IG++
Sbjct: 465 G-SYQAPIGYV 474


>gi|170750189|ref|YP_001756449.1| type II and III secretion system protein [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656711|gb|ACB25766.1| type II and III secretion system protein [Methylobacterium
           radiotolerans JCM 2831]
          Length = 546

 Score =  244 bits (624), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 159/505 (31%), Positives = 257/505 (50%), Gaps = 73/505 (14%)

Query: 34  AAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKN 93
           A V+ +   E    +++ +   + +I+ +P D ++V V++P  A+ VV S R +++ G  
Sbjct: 51  APVLTVGAAEANTTRRVELTAGRSVIVDLPRDAKEVFVANPAVANAVVRSTRKVFVIGMA 110

Query: 94  VGQANVILIGHDGKQMLNLDILIERDI--AHLEMTLRRFIADSNIRVEMVSDTVVLHGMV 151
            G  ++ ++  +G+Q+  LD+ + RD+    L   L + I      V     +V+L G V
Sbjct: 111 DGATSIFIMDAEGRQIAALDVTVARDLNLGTLRELLSQSIPGGRFDVRSSGASVLLSGAV 170

Query: 152 RTIQDSQRAVELSETFLSQSGRNQYANS----------SSKKVMNLLNIAGEDQVTLKVT 201
            +  D+Q+A++++  F+   G      +          S   V+N L I  +DQV L+VT
Sbjct: 171 NSSSDAQQAIDIANAFVGLGGGGAAGPAGAASGGVAAGSRGAVINNLTIRNKDQVMLRVT 230

Query: 202 IAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGG------------------ 243
           + EV R++LKQ G   +   S+  P  +      G+ V  GG                  
Sbjct: 231 VVEVSRNVLKQFGINMAGNWSALNPVGNL-----GQTVVNGGTAAATQVPAYLPNVITNN 285

Query: 244 ---------------DFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
                            SV+G    FS +  L A E+A   R LAEPTLTAISG++A F 
Sbjct: 286 LPFPINTNTPSGNLIQASVQG--GGFSLQATLKAFEQAGVSRILAEPTLTAISGEAAKFL 343

Query: 289 SGGQHLYKTVSSSTGATS------VTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP--- 339
           +GG+  +   +S+T A        +T   YGV L FTPTVL+  RI +R+ T+V+E    
Sbjct: 344 AGGE--FAVPASATCAVGGVCSPGITYKPYGVALSFTPTVLADNRISIRVATDVTEIDTQ 401

Query: 340 -----VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPIL 394
                VIG  +  +P  RVR+++TTVELPSGG ++ AGL++   +Q   G+P L  +PIL
Sbjct: 402 QSFSYVIGNTSVAVPGTRVRRSETTVELPSGGVMMTAGLIQQFNKQAIAGLPGLINLPIL 461

Query: 395 GALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGP 454
           GALFR+  + R+ETE+ I  TP++ +P+  + +SRPDD++    D +     ++N+IYG 
Sbjct: 462 GALFRSRDYQRQETELMIMCTPYIARPMEPKQVSRPDDNFVDASDGQTVLLGQINRIYGK 521

Query: 455 KEASEVE-----GQNYKGAIGFIYK 474
                       G+ Y+G +GFI +
Sbjct: 522 VAPPGATAAAPLGRAYRGRVGFIVE 546


>gi|329890996|ref|ZP_08269339.1| bacterial type II and III secretion system family protein
           [Brevundimonas diminuta ATCC 11568]
 gi|328846297|gb|EGF95861.1| bacterial type II and III secretion system family protein
           [Brevundimonas diminuta ATCC 11568]
          Length = 522

 Score =  244 bits (622), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 141/475 (29%), Positives = 251/475 (52%), Gaps = 70/475 (14%)

Query: 60  LQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERD 119
           + +P D +DV++S+P  A+ ++HSPR + + G   G+ + + +   G+ +L L + ++  
Sbjct: 58  VDLPADARDVIISNPAVAEAMLHSPRRITMIGLAGGETDAVFLDASGRTILALRVRVDAG 117

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANS 179
           ++ L+ TL R    SN+R E V+D+++L G+  +  +++RA +++  F+S          
Sbjct: 118 VSALQDTLARVAPGSNVRAEAVNDSIILTGVAASPLEAERAAQVARAFVS---------- 167

Query: 180 SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQ-----------IGFQHSITGSSS--GP 226
           + +KVMN++ +AG DQVTLKV + EV+R+ +KQ           +G    + G+S+  G 
Sbjct: 168 APEKVMNMIAVAGSDQVTLKVRVVEVQRNAIKQLGFDTQAVIGRVGDTQWLLGNSATWGV 227

Query: 227 SKSFAADFGGKFVSEG-----------GDFSVKGVL----------DRFSFET------- 258
           + SF     G    +            G    +G +          D  +++T       
Sbjct: 228 NGSFLGGLAGGIARDTTKNFQMQVPCVGPGWPEGAMCPVTVDGSPGDPSNWDTAKPGTGP 287

Query: 259 ----------VLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVT 308
                     +L A ER   +RTLAEP LT+++G++ASF +GG+          G  +V 
Sbjct: 288 GSDGLNKGEAMLKAFERVGLVRTLAEPNLTSVNGEAASFLAGGEFPVPAGRDREGQITVE 347

Query: 309 THDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PVIGVNAG-------DMPSYRVRKADTT 359
              YGV L F P VLS GRI L+++ EVSE  P  G+  G        +P   VR+++ T
Sbjct: 348 YKPYGVGLSFRPVVLSEGRISLQVKVEVSELTPNGGLTIGAGTPSSITLPGLTVRRSENT 407

Query: 360 VELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLV 419
           +ELPSGG++++AGLL++  +Q  + +P ++ +P+LG LFR+  +   ETE+ +   P++V
Sbjct: 408 IELPSGGSMMIAGLLQESTRQAIDALPGMTNLPVLGQLFRSRDYVMGETELVVIVEPYIV 467

Query: 420 KPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
            P +   +  P D   +  DA+  FF ++N++YG    +   G  ++G +G++ +
Sbjct: 468 NPTSPDRMQTPADGLRIAQDAQTIFFGQLNQVYGSPAPAAQPGAGWRGPVGYVIE 522


>gi|114799376|ref|YP_761691.1| pilus assembly protein CpaC [Hyphomonas neptunium ATCC 15444]
 gi|114739550|gb|ABI77675.1| pilus assembly protein CpaC [Hyphomonas neptunium ATCC 15444]
          Length = 535

 Score =  243 bits (621), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 153/502 (30%), Positives = 256/502 (50%), Gaps = 89/502 (17%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           +++++G++K +I+ +     DV++S+P  AD VV + + +   G   GQ N ++    G 
Sbjct: 44  RRVTLGVDKSMIVDLEAPAADVVISNPEIADAVVQTAQRIIFRGIKFGQTNALIFDRAGN 103

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
            +L+L+I++E D+A LE T+ R I D+ +++E  + +V+L GMV  +  S +  +L + F
Sbjct: 104 TLLDLNIMVETDLAALEETISRHIPDARVKIESFNGSVILTGMVDNLSQSDQVSQLVKAF 163

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF------------ 215
             +S     A     +++N+LN+   DQV L+V I E++R ++KQ+G             
Sbjct: 164 FPES-----AGGGELQIVNMLNVNAADQVMLEVRIVEMQRSVIKQLGINLSGATSFGELA 218

Query: 216 ---------------------QHSITGSSS--------GPSKSFAADFGGKFVSEGGDFS 246
                                +++ TG  +        GPS +  +       S    F+
Sbjct: 219 NQTLQQVFQGGLPLFFDPDSGEYNTTGQGTAVEMLQPAGPSSNTISG------SASSGFN 272

Query: 247 VKG-VLDRFSFET----------------VLHALERATAIRTLAEPTLTAISGQSASFTS 289
           V+G  L   S ET                 + A+ER   +RTLAEP + A+SG+SA F +
Sbjct: 273 VQGQALGGISLETGYTNYNNGRLQSSIGAAIDAMERVGIVRTLAEPNIVAMSGESAKFLA 332

Query: 290 GGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE---------PV 340
           GG+       +  G  +V    YGV L FTP VLS GRI L++ TEVSE           
Sbjct: 333 GGEFPVPVGQNQNGQITVEFKPYGVGLAFTPVVLSEGRISLKVSTEVSELTSQGAFQGAA 392

Query: 341 IGVNAGD----------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSK 390
             +  GD          +P+  VR+A++ VELPSGG++++AGL+    +Q  + +P L K
Sbjct: 393 QTITDGDGNTTIIQGATLPALSVRRAESVVELPSGGSMMMAGLISVKDRQTIDQLPGLKK 452

Query: 391 IPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNK 450
           +PILG+LF++  F  EETE+ +  TP+LV       +  P D Y+   DAK  FF ++N+
Sbjct: 453 LPILGSLFQSRDFLSEETELVVMVTPYLVGATNKASMVTPADGYANASDAKTIFFGKLNE 512

Query: 451 IYGPKEASEVEGQNYKGAIGFI 472
            YG ++ + ++  +Y+  +GF+
Sbjct: 513 TYG-RDGAPIKPDDYRAPVGFM 533


>gi|302381756|ref|YP_003817579.1| type II and III secretion system protein [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302192384|gb|ADK99955.1| type II and III secretion system protein [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 520

 Score =  243 bits (620), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 152/492 (30%), Positives = 254/492 (51%), Gaps = 69/492 (14%)

Query: 42  VEIGKGKK-ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
           V  G G + I++       + +P D +DV+VS+P  A+  VHSPR + + G   G+ + +
Sbjct: 39  VAAGSGPRLINLPRGTSFAVDLPADARDVIVSNPAVAEANVHSPRRITVIGIAPGETDAV 98

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
            +   G+ +L L + ++  +  L+ TL R    + +  E V+D++VL G+V +   S++ 
Sbjct: 99  FLDAAGRSILTLRVRVDAGVTALQDTLSRVAPGAQVHAEAVNDSIVLTGLVTSAAQSEQV 158

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS-- 218
            +++  F+S          + +KV+N+L IAG DQVTLKV I EV+R+ +KQ+GF  +  
Sbjct: 159 AQVARAFVS----------APEKVLNMLTIAGSDQVTLKVRIIEVQRNAIKQLGFDTAAA 208

Query: 219 -----------------------ITGSSSGPSKSFAADF------GGKFVSEG-GDFSVK 248
                                  + G S+G S++   +F      G  F ++    F+V 
Sbjct: 209 LGRVGDTQFLLSQAASFGVNGSLLGGISAGVSRNTTQNFQLQGPCGPGFPADSLCPFTVD 268

Query: 249 GVLDRFSFET-----------------VLHALERATAIRTLAEPTLTAISGQSASFTSGG 291
           G  D  +++T                 ++ A ER   IRTLAEP LT+++G+SASF +GG
Sbjct: 269 GPEDASNWDTAQPGTGPGSDDLNKGNAMIKAFERVGLIRTLAEPNLTSVNGESASFLAGG 328

Query: 292 QHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVNAG- 346
           +    T     G  ++    YGV L F P VLS GRI L+I  EVSE      I + AG 
Sbjct: 329 EFPVPTGRDRDGNVTIEFKPYGVSLGFRPIVLSEGRISLQISAEVSELTQTGGITLGAGT 388

Query: 347 ----DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
               ++    VR+   TVE+PSGG++++AGLL++  +Q  + +P L  +P+LG LFR+  
Sbjct: 389 STALNIAGLNVRRVQNTVEIPSGGSMMIAGLLQESTRQAIDSLPGLGGLPVLGQLFRSRD 448

Query: 403 FNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEG 462
           +   ETE+ +   P++V P +   L  P D   +  DA+  FF ++N+ YG    ++   
Sbjct: 449 YLSGETELVVIVEPYIVTPTSPNRLQTPADGLRIATDAQTIFFGQLNQAYGSPAPTDTAS 508

Query: 463 QNYKGAIGFIYK 474
             ++G +G++ +
Sbjct: 509 AGWQGPVGYVIE 520


>gi|83859357|ref|ZP_00952878.1| pilus assembly protein CpaC [Oceanicaulis alexandrii HTCC2633]
 gi|83852804|gb|EAP90657.1| pilus assembly protein CpaC [Oceanicaulis alexandrii HTCC2633]
          Length = 529

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 155/501 (30%), Positives = 262/501 (52%), Gaps = 83/501 (16%)

Query: 43  EIGKG---KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANV 99
           E G G   + + + L +  ++ +P D  DV++++   A  VV + R  ++ G+ VG+ N+
Sbjct: 43  EPGAGPASESLQLPLGQAAVIHLPEDAADVVIANDEVASAVVRTTRRAFVMGQAVGRTNI 102

Query: 100 ILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQR 159
                DG  +L+L++ +ERDIA L+  L RF+ +  I+ E ++  +VL G V +   +  
Sbjct: 103 FFFNADGGLILDLNVRVERDIAALQDALDRFVPEGRIQAESMNANIVLSGQVPSAAAADT 162

Query: 160 AVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
           A+++++ ++           + ++V++ L + G DQVTL+V I E+ R +++Q+G   ++
Sbjct: 163 ALQVAQRWVD----------TPEQVVSFLTVEGRDQVTLQVRIVEMERTLVRQLGV--NL 210

Query: 220 TGSSS----GPSKSFAA--DFG-----------------GKFVSEGGDFS---------- 246
           +G  +     P+   AA  D G                 G+F +  G  +          
Sbjct: 211 SGEQAFGEFTPTVRTAATNDRGDPLFDQNGAPIYEVYQQGRFQNSAGWGTSNAFGVAGAA 270

Query: 247 -------------VKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQH 293
                        V GVL + S    L+ALER   +RTLAEP +TAISG+ A F +GG+ 
Sbjct: 271 LGGLTGTLGTQNLVDGVL-QSSISATLNALERVGLVRTLAEPNITAISGEPAQFLAGGEF 329

Query: 294 LYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE-----------PVIG 342
                    G  ++    +GV L FTP VLS GRI LR+ TEVSE            VI 
Sbjct: 330 PVPVGRDRDGNVTIEFKPFGVGLGFTPVVLSEGRISLRVSTEVSELSNEGAISLNSQVIT 389

Query: 343 VNAGD---------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPI 393
            + G+         +P+  V +A+TTVELPSGG++V+AGL++++ +Q  + +P + ++P+
Sbjct: 390 DDQGNVTGTVQGVTIPALSVNRAETTVELPSGGSMVIAGLIREETRQAMDSVPGIERMPV 449

Query: 394 LGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYG 453
           LG+LFR+  F   ETE+ +  TP+LV P+   D+  P + ++V   A   F  R+N++Y 
Sbjct: 450 LGSLFRSRDFANNETELVVVVTPYLVDPLNPNDVESPAEGFAVSSLAAGAFLGRLNRVYA 509

Query: 454 PKEASEVEGQNYKGAIGFIYK 474
              A +VE + + G IGF+ +
Sbjct: 510 APGA-QVENRGWSGPIGFVLE 529


>gi|220922779|ref|YP_002498081.1| type II and III secretion system protein [Methylobacterium nodulans
           ORS 2060]
 gi|219947386|gb|ACL57778.1| type II and III secretion system protein [Methylobacterium nodulans
           ORS 2060]
          Length = 494

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 154/462 (33%), Positives = 246/462 (53%), Gaps = 32/462 (6%)

Query: 34  AAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKN 93
           A V+++   E    ++I +   + +++ +P D ++V V++P  A+ VV S R +++ G  
Sbjct: 40  APVLSVGPQEADISRRIDLTQGRSLVVDLPRDAKEVFVANPKVANAVVRSTRKVFIIGVE 99

Query: 94  VGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRT 153
            G  ++ ++  +G+Q+  LD+ + RD+  L  TL   I      V    D+++L G V +
Sbjct: 100 NGATSIFVMDAEGRQIAALDVTVGRDLNVLRQTLASSIPKGRFEVRPAGDSILLSGSVNS 159

Query: 154 IQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
             ++Q+A++++  F+               V+N + I G+DQV L+VT+ EV R +LKQ 
Sbjct: 160 AAEAQQAIDVANAFVGIG---GGGVPGRGAVINNITIRGKDQVMLRVTVVEVSRSVLKQF 216

Query: 214 GFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDR-------FSFETVLHALERA 266
           G   +++G+ S  + +  A         GG F +   +          S    L A E+A
Sbjct: 217 GV--NLSGNWSNLNFANVA----PLALNGGSFPIGNAISGSINFGGGASLTATLKAFEQA 270

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQ-----HLYKTVSSS---TGATSVTTHDYGVVLHF 318
              R LAEPTLTAISG+SA FT+GGQ     +L  +  S+       SVT   YGV L F
Sbjct: 271 GVSRVLAEPTLTAISGESAKFTAGGQLPVPGNLACSAPSNGVQLCTPSVTFKPYGVSLTF 330

Query: 319 TPTVLSPGRIGLRIQTEVSE--PVIGVNAG------DMPSYRVRKADTTVELPSGGTIVL 370
           TP VLS  RI +R+ T+V+E  P   +N         +P + VR ++TTVEL SG T++ 
Sbjct: 331 TPVVLSENRISIRVGTDVTEIDPQNSMNINFSGTTTAIPGFTVRTSETTVELASGATMMT 390

Query: 371 AGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           AGL++   +    G+P L  +PILGALFR+  + R+ETE+ I  TP++ K +   ++ RP
Sbjct: 391 AGLIQQRNRAAITGLPALMNLPILGALFRSRDYQRDETELMIMVTPYIAKAMEPAEIKRP 450

Query: 431 DDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
           DD +    D +A    R N++YG   AS +  + Y G  GFI
Sbjct: 451 DDGFVDATDGQAVLLGRFNRLYGVVGASPLAPKAYHGRFGFI 492


>gi|329847253|ref|ZP_08262281.1| bacterial type II and III secretion system family protein
           [Asticcacaulis biprosthecum C19]
 gi|328842316|gb|EGF91885.1| bacterial type II and III secretion system family protein
           [Asticcacaulis biprosthecum C19]
          Length = 535

 Score =  235 bits (600), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 147/447 (32%), Positives = 230/447 (51%), Gaps = 64/447 (14%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           ++ +P D  DV VS+P  AD V+ +PR +++ G   GQ++ I     G+Q+LNL I +E 
Sbjct: 71  VVDLPTDAADVFVSNPAVADAVLRTPRRIFVLGVEGGQSDAIFFDAQGRQILNLSIRVEA 130

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
               L  T+ R    S + V+ ++  VVL G+ +    + +   L+ +++++        
Sbjct: 131 ATDELTDTVHRLFPTSKVEVQSLNGRVVLSGLAQNNAQADQIARLAASYVTKP------- 183

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFA------- 231
              + V+NL++IAG+DQVTLKV + EV+R  +KQ+G    I  ++   S S+        
Sbjct: 184 ---EDVINLMSIAGKDQVTLKVRVIEVQRSAIKQLGLSSDIVYNNGSQSYSYGRGNTYGT 240

Query: 232 --ADFGGKFVSEGGDFSVKG--------------------VLDRF--------------- 254
               +GG+ +  G +  V                      V++R                
Sbjct: 241 NGTSYGGRGLCYGQNNVVTNNFTDSNSVTDQTAVTLEDTPVVNRTLTATIGSAVNTTWRT 300

Query: 255 ----SFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTH 310
               S  T L A ER   IRTLAEP LTA+SG++A F +GG+          G  +V   
Sbjct: 301 LTGSSNATCLQAFERVGLIRTLAEPNLTAVSGEAAKFLAGGEFPVPVAEDDAGRITVEFK 360

Query: 311 DYGVVLHFTPTVLSPGRIGLRIQTEVSEPV-IGV---NAGDM--PSYRVRKADTTVELPS 364
            +GV L FTP VLS GRI ++I TEVSE   +G    N  ++  P   VR+A+TTVE+ S
Sbjct: 361 PFGVGLGFTPVVLSEGRISMKISTEVSEITNVGAFTSNGSNLTIPGLSVRRAETTVEMQS 420

Query: 365 GGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAM 424
           GG++++AGLL+   +Q  + +P ++ +PILG+LFR+  F  E+TE+ +  TP++V PV  
Sbjct: 421 GGSLMIAGLLQSKYKQSIDSLPGMTSLPILGSLFRSRDFLNEDTELVVMVTPYIVDPVHP 480

Query: 425 RDLSRPDDHYSVEDDAKAFFFNRVNKI 451
             L  P D+    DD    F  R+NK+
Sbjct: 481 DQLQTPADNLEFADDMSTVFMGRLNKV 507


>gi|167648152|ref|YP_001685815.1| type II and III secretion system protein [Caulobacter sp. K31]
 gi|167350582|gb|ABZ73317.1| type II and III secretion system protein [Caulobacter sp. K31]
          Length = 545

 Score =  235 bits (599), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 159/518 (30%), Positives = 255/518 (49%), Gaps = 78/518 (15%)

Query: 21  PSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVV 80
           P +   P +      V+ I D+     + +++   K  I+++PVDV+D+LV++P  AD V
Sbjct: 42  PRIIDTPTLAPPADQVLRI-DLTASGAQSLTLARGKSAIVELPVDVRDMLVTNPAVADAV 100

Query: 81  VHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEM 140
           +  PR +Y+ G   G  + +     G+++L+L I +++D + L+ TLRR +  +NI V+ 
Sbjct: 101 LRGPRRIYVLGMGQGVTDAVFFDAAGRKILSLAIRVDQDSSALQDTLRRVLPAANIEVQS 160

Query: 141 VSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKV 200
           + D+V+L GMV  + +S  A +++  F+ +             V+N+L IAG+DQV LKV
Sbjct: 161 IRDSVILTGMVANVGESTMASQIAARFVDKP----------DNVLNMLTIAGKDQVMLKV 210

Query: 201 TIAEVRRDI-----------LKQIGFQHSITGSSSG------------------------ 225
            I EV+R+I           L Q+G      G S                          
Sbjct: 211 RIVEVQRNIIKQLGVDSSAVLGQLGETQYAFGLSPSYGINGKLLGGLTGGYKADTTKQPT 270

Query: 226 ---PSKSFAADFGGKFVSEGGDFSV------------KGVLDRFSFETVLHALERATAIR 270
              P  +   D G K +    D SV             G     S + ++ A ER   +R
Sbjct: 271 LQVPCNAALPD-GAKCLQIVRDNSVYSNGDTATITDTAGSAGLNSAKGMIQAFERVGLVR 329

Query: 271 TLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGL 330
           TLAEP LT +SG++  F  GG+        +TG  ++    YGV L +TP VLS GRI L
Sbjct: 330 TLAEPNLTVVSGEAGKFLVGGEFPVPVGQDATGKVTIEFKPYGVGLGYTPIVLSGGRISL 389

Query: 331 RIQTEVSE-------------PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           ++ TEVSE                  +   +P   VR+A+TTVELPSGG++++AGLL+  
Sbjct: 390 KLSTEVSELSSLGAFTLTTSTGTSTSSNLTVPGLTVRRAETTVELPSGGSLMIAGLLQQQ 449

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
            +Q  + +P ++ +PILGALFR+  +   ETE+ +  TP++V P   ++L  P D     
Sbjct: 450 TRQNIDALPGMTSLPILGALFRSRDYLNGETELVVIITPYIVDPTKPQNLQTPADGLQTA 509

Query: 438 DDAKAFFFNRVNKIY-GPKEASEVEGQNYKGAIGFIYK 474
            D       R+NK+   P  A+   G+ Y+G +G++ +
Sbjct: 510 SDMSTALLGRLNKVVKAPVGAN--SGRAYQGPVGYVIE 545


>gi|254418362|ref|ZP_05032086.1| Putative phospholipid-binding domain family [Brevundimonas sp.
           BAL3]
 gi|196184539|gb|EDX79515.1| Putative phospholipid-binding domain family [Brevundimonas sp.
           BAL3]
          Length = 517

 Score =  231 bits (589), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 140/474 (29%), Positives = 250/474 (52%), Gaps = 69/474 (14%)

Query: 60  LQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERD 119
           + +P D +DV+V++P  A+ ++HSPR + + G   G+ + + +   G+ +L+L + ++  
Sbjct: 54  VDLPADARDVIVANPQVAEAMLHSPRRITVIGIAPGETDAVFLDAAGRTILSLRVRVDAG 113

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANS 179
            + L+ TL R +  S IR E V+D+V+L G+  +   + +A +++  F+S          
Sbjct: 114 TSALQDTLSRLVPGSQIRAEAVNDSVILSGVADSPAQAVQAAQVARAFVS---------- 163

Query: 180 SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS--------------------- 218
           + +KV+N+++IAG DQVTLKV + EV+R  +KQ+GF  S                     
Sbjct: 164 APEKVLNMISIAGSDQVTLKVRVVEVQRSAIKQLGFDTSAVVGQLGSTQWLLGNSATWGV 223

Query: 219 ----ITGSSSGPSKSFAADFGGKFVSEGGDFS--------VKGVLDRFSFETV------- 259
               I G S+G S+    ++  +    G  ++        V+G  D  +++T        
Sbjct: 224 NGGLIGGISAGLSRDTTKNYQMQRPCVGPGWTPGALCPVTVRGPDDASNWDTAQPGTGPG 283

Query: 260 ----------LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT 309
                     + A ER   +RTLAEP LT+++G++ASF +GG+    +     G  +V  
Sbjct: 284 SNDLNKGSATVKAFERVGLLRTLAEPNLTSVNGEAASFLAGGEFPIPSGRDRDGNITVVY 343

Query: 310 HDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVNAG-----DMPSYRVRKADTTV 360
             YGV L F P VL  GRI L+++ EVSE      + + AG      +P   VR+++ TV
Sbjct: 344 KPYGVALSFRPVVLDAGRISLQVKVEVSELTSQGGLTIGAGTTSSVSLPGLSVRRSENTV 403

Query: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           EL SGG++++AGLL+++ +Q  + +P ++ +P+LG LFR+  +   ETE+ +   P++V 
Sbjct: 404 ELSSGGSMMIAGLLQENTRQAIDALPGMTNLPVLGQLFRSRDYLNGETELVVIVEPYIVS 463

Query: 421 PVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           P +   +  P D   +  D++   F ++N+IYG    +   G  ++GA G++ +
Sbjct: 464 PTSPDRMQTPADGLRIASDSQTILFGQLNQIYGSPSPTAQSGAVWQGAAGYVIE 517


>gi|46201037|ref|ZP_00207939.1| COG4964: Flp pilus assembly protein, secretin CpaC
           [Magnetospirillum magnetotacticum MS-1]
          Length = 480

 Score =  231 bits (588), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 146/420 (34%), Positives = 234/420 (55%), Gaps = 28/420 (6%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           + + + + K + L +P  V++V++ +   ADV+V SP  +++ G+ VGQ NV L+   G+
Sbjct: 51  ESMQVPVGKSVDLTLPGAVREVVIGNSDIADVMVRSPNLVHITGRAVGQTNVFLVDRAGR 110

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSN-IRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
            M  +D+ +  D   +   LR  + D   I VE V+D++ L G V+    ++ A  L+  
Sbjct: 111 VMRRIDLNVSIDSQAVRDALRAVLPDERAINVEAVADSLYLSGSVKNDAAARDAKMLARR 170

Query: 167 FLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS------IT 220
           F+++            K++NLL +  E QV L V +AE++R +LK++GF  +      + 
Sbjct: 171 FVAEDA----------KLVNLLRVVNEQQVLLHVKVAEIQRTVLKELGFGLTANKGIPLI 220

Query: 221 GSSS-GPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
           GSS  G     ++  G    S    F    +    +    L+ LE    IRTL EP LTA
Sbjct: 221 GSSVLGSGSKTSSTVGLIDSSSTAIFGTATITGIGALAANLNILENQGLIRTLVEPNLTA 280

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP 339
           +SG++A+  +GG+ L   +S + GA SV    YGV+L FTPTVL PGR+ L++ TEVS  
Sbjct: 281 VSGETATMLAGGE-LPIPISQTNGAVSVEFKPYGVLLSFTPTVLDPGRLSLKMSTEVS-- 337

Query: 340 VIGVN-------AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
            I  N       +  +P+++VR+A +TVELPSGG+I++AGLL++DI     G+P L  +P
Sbjct: 338 AIDNNNKTAISSSISVPAFKVRRAGSTVELPSGGSIMIAGLLQNDITSNITGLPGLMDLP 397

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIY 452
           +LG LFR++ F R ETE+ +  + ++V+PV    L  P+D ++   D K F   R+   Y
Sbjct: 398 VLGLLFRSNAFQRNETELVVILSAYVVRPVEQPVLGTPNDGFAPSSDLKRFLLGRLQDTY 457


>gi|83312840|ref|YP_423104.1| Flp pilus assembly protein, secretin CpaC [Magnetospirillum
           magneticum AMB-1]
 gi|82947681|dbj|BAE52545.1| Flp pilus assembly protein, secretin CpaC [Magnetospirillum
           magneticum AMB-1]
          Length = 495

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 140/421 (33%), Positives = 235/421 (55%), Gaps = 31/421 (7%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           + + + + K I L +P  V++V++ +   ADV+V +P  +++ G+ VGQ NV L+   G+
Sbjct: 67  ESMQVPVGKSIDLPLPGAVKEVVIGNSDIADVIVRTPHMVHITGRAVGQTNVFLMDRSGR 126

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSN-IRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
            M  +D+ +  D   ++  LR  + +   I VE V+D++ L G V+    ++ A  ++  
Sbjct: 127 VMRRIDLAVAIDSQAVKDALRAVLPEERAITVEAVADSLYLSGSVKNDGAARDAKMVARR 186

Query: 167 FLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGP 226
           F++  G          K++N++ +  E QV L V +AE++R +LK++GF  +   S S P
Sbjct: 187 FVADDG----------KLVNMIRVVNEQQVLLHVKVAEIQRTVLKELGFGLTANKSISLP 236

Query: 227 SKSFAAD------FGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAI 280
             +  +        G    S    F    V    +     + LE    IRTL EP LTA+
Sbjct: 237 GTASLSSFTTSSTVGLIDSSSTAIFGTATVTGLGALAANFNILENQGLIRTLVEPNLTAV 296

Query: 281 SGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV 340
           SG++A+  +GG+ L   VS++ G+ SV    YGV+L FTP VL PGR+ L++ TEVS   
Sbjct: 297 SGETATMLAGGE-LPIPVSTTNGSISVEFKPYGVLLSFTPVVLDPGRLSLKMSTEVS--- 352

Query: 341 IGVNAGD---------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKI 391
             ++  +         +P+++VR+A +TVELPSGG+I++AGLL++DI     G+P L  +
Sbjct: 353 -AIDTANKTAITTTISVPAFKVRRAGSTVELPSGGSIMIAGLLQNDITANIAGLPGLMDL 411

Query: 392 PILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKI 451
           P+LGALFR++ F R ETE+ +  + ++++PV   +LS P+D ++   D K F   R+   
Sbjct: 412 PVLGALFRSNAFQRNETELVVILSAYVIRPVDQPNLSTPNDGFAPSSDLKRFLLGRLQDT 471

Query: 452 Y 452
           Y
Sbjct: 472 Y 472


>gi|304320647|ref|YP_003854290.1| putative exporter protein, cpaC [Parvularcula bermudensis HTCC2503]
 gi|303299549|gb|ADM09148.1| putative exporter protein, cpaC [Parvularcula bermudensis HTCC2503]
          Length = 494

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 145/455 (31%), Positives = 238/455 (52%), Gaps = 44/455 (9%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           +++ + L K  I+++P    D++VSDP   + V+ +P+ ++L G+  GQAN         
Sbjct: 52  REVLLPLGKAAIIELPRPATDIIVSDPDIVEAVIRTPQRVFLMGREAGQANAFFFDRANN 111

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
           Q+LNL+I +E+D   +   + + + ++ I VE ++  V++HG V    D+QRA E++  F
Sbjct: 112 QILNLEIRVEQDADTIRELMTKLVPNARISVESLNGNVIIHGTVDNASDAQRAGEIASRF 171

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
              +G + +        +N+L +    QV LK+ I E++R +++Q+G   +        +
Sbjct: 172 ---AGEDNF--------VNMLKVREPSQVLLKIKIVEMQRRLVRQLGIDLNGVAQVDRSA 220

Query: 228 KSFAAD--FGGKFVSEGG---DFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISG 282
             FA    F     S GG   + S  G  D  + +      E+   ++TLAEP++ A+SG
Sbjct: 221 IEFAVQNSFAISGQSLGGINANLSTPGFGDITNLDFAFDIFEQNGLVKTLAEPSIVALSG 280

Query: 283 QSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG 342
           ++ASF +GG+      +S+ G  SVT   +GV L F P V S  RI L + TEVS+ V  
Sbjct: 281 RNASFLAGGEFPVPE-ASANGTPSVTFKPFGVQLEFQPVVYSKNRIQLTLATEVSD-VSN 338

Query: 343 VNA---------------GDM----------PSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           VN                G++          P    R A TTVELPSGG++ LAGLL++D
Sbjct: 339 VNGLSIAGATQAEEDPDTGEIIEQTFEGFIVPGTVSRSAATTVELPSGGSLALAGLLQED 398

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
           I ++ +G+P L + P+LGALFR+  F  ++TE+ I ATP+LV+P  +  L+ P   Y+  
Sbjct: 399 INEVIDGVPGLKETPVLGALFRSQEFQSQQTELVIIATPYLVEPTDLAALTDPAQGYAPP 458

Query: 438 DDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
              ++    ++   YG +     + Q   G IGFI
Sbjct: 459 SPVQSVILGQLESAYGVRGRKARDAQ-LSGPIGFI 492


>gi|16127175|ref|NP_421739.1| pilus assembly protein CpaC [Caulobacter crescentus CB15]
 gi|221235976|ref|YP_002518413.1| outer membrane pilus secretion channel cpaC [Caulobacter crescentus
           NA1000]
 gi|7208425|gb|AAF40192.1|AF229646_4 CpaC [Caulobacter crescentus CB15]
 gi|13424571|gb|AAK24907.1| pilus assembly protein CpaC [Caulobacter crescentus CB15]
 gi|220965149|gb|ACL96505.1| outer membrane pilus secretion channel cpaC [Caulobacter crescentus
           NA1000]
          Length = 560

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 146/496 (29%), Positives = 247/496 (49%), Gaps = 82/496 (16%)

Query: 40  SDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANV 99
           + +E+ KGK          I+++P +V+D+LV++P  AD V+   R +Y+ G   G  + 
Sbjct: 86  ATLELAKGKSA--------IVELPSEVRDLLVTNPQIADAVLRDKRRIYIVGLAEGTTDA 137

Query: 100 ILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQR 159
                 G+++L+L I + + +  L   L + + D+ I V  + D+VVL G VRT  +++ 
Sbjct: 138 AFFDTAGRRILSLSIRVSQPVDQLAAMLGKILPDAKITVSPIRDSVVLSGTVRTASEAES 197

Query: 160 AVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ--- 216
           A  ++  F+           S +KV+N++++AG+DQV L+V I EV+R+++KQ+G     
Sbjct: 198 AARIAAQFVG----------SPEKVLNMISVAGKDQVMLQVRIVEVQRNVIKQLGVDLNA 247

Query: 217 -----------------HSITGS----------------------SSGPSKSFAADFGGK 237
                            + + GS                       +GP   + A     
Sbjct: 248 VIGQLGETQYTFGMAPGYGVNGSLLGGVTGGYKMDTTKQPVMQTPCTGPG--WTAGSLCP 305

Query: 238 FVSEGGDFSVKGVLDRF-------SFETVLHALERATAIRTLAEPTLTAISGQSASFTSG 290
            V+ GG  S    +          S + ++ A ER   +RTLAEP L A+SG+S  F  G
Sbjct: 306 VVARGGGNSDTATIQSTAGDPGLNSAKGMIQAFERVGLVRTLAEPNLAAVSGESGKFLVG 365

Query: 291 GQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE-PVIGVNAG--- 346
           G+    T S ++G  ++    YGV L +TP VLS GRI L++ TEVSE   +G  +    
Sbjct: 366 GEFPVPTGSDTSGKVTIEFKPYGVGLGYTPVVLSGGRISLKLSTEVSELSSLGAFSMSTG 425

Query: 347 --------DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALF 398
                    +P   VR+ ++TVELPSGG+++LAGLL+   ++  + +P ++ +PILG+LF
Sbjct: 426 TSSGSTNLTVPGLSVRRVESTVELPSGGSLMLAGLLQQTTKETIDSLPGMTSMPILGSLF 485

Query: 399 RNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEAS 458
           R+  F   +TE+ +  TP+++ P   ++L  P D      D       R+NK+     A 
Sbjct: 486 RSRDFLNNQTELVVIITPYIIDPTRPQNLQTPADGLQFASDMGTVLLGRLNKVV-KAPAG 544

Query: 459 EVEGQNYKGAIGFIYK 474
              G+ Y+G +G++ +
Sbjct: 545 ANAGRAYQGPVGYVIE 560


>gi|254293214|ref|YP_003059237.1| type II and III secretion system protein [Hirschia baltica ATCC
           49814]
 gi|254041745|gb|ACT58540.1| type II and III secretion system protein [Hirschia baltica ATCC
           49814]
          Length = 535

 Score =  223 bits (568), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 156/497 (31%), Positives = 245/497 (49%), Gaps = 89/497 (17%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           + +++  NK  +L+   DV D+LV++P  ADV+  S R + +  K  G++++I     GK
Sbjct: 56  RTLNLSQNKTAVLEFEEDVDDILVANPEIADVLARSKRRIAVLAKGKGESSIIFTNAQGK 115

Query: 108 QMLNLDILIE-RDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           ++L+LD+++  + ++ L+  + +++  S I+ E V+  +VL G   ++ D+  A++L++ 
Sbjct: 116 EILSLDVIVAGQGVSELQALIEQYVPRSAIKAEFVNGAIVLAGKSPSLSDADMAIQLAQQ 175

Query: 167 F----------LSQSGRNQ------------------------------YANSSSKKVMN 186
           F          +S  G++Q                               AN S +   +
Sbjct: 176 FVVDDSPVINMISIEGKDQVLLKVRIVEMQRSVIKQLGVNLSGSMNIGELANKSVQTAYD 235

Query: 187 ------LLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS--ITGSSSGP---SKSFAADFG 235
                 LL+ AGE    L+V       D     G  +S  I+G S G    S S+    G
Sbjct: 236 AVTGEVLLDAAGE---ALQVLAPAAPWDQSVSFGTSNSLGISGESLGGMSLSPSYNNYVG 292

Query: 236 GKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLY 295
            K  S  G FSV               LER   +RTLAEP LTA+SG+SA F +GG+   
Sbjct: 293 DKLQSSAG-FSV-------------DMLERIGLVRTLAEPNLTALSGESAKFLAGGEFPV 338

Query: 296 KTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----------------- 338
            +   S G   +    +GV L FTP VLS  RI +RI TEVSE                 
Sbjct: 339 PSEVDSDGEVVLEFKPFGVGLGFTPVVLSESRISMRISTEVSELTSTGGYQIGGTTYVDG 398

Query: 339 --PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
               +   A  +P+ +VR+ADTTVE+PSGG++V+AGL+++   Q  + +P +  +P++G+
Sbjct: 399 AGNTVSTPAVVIPALKVRRADTTVEMPSGGSLVIAGLIQEQTSQAMDKVPGVGNLPVIGS 458

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKE 456
           LFR+  F   ETE+ +  TP+LV P   + L  PDD Y    DAKA FF ++N++Y  + 
Sbjct: 459 LFRSREFQNNETELVVIVTPYLVDPTDPKKLRSPDDGYVAAKDAKAIFFGKMNEVYAVEG 518

Query: 457 ASEVEGQNYKGAIGFIY 473
           A   E     GA GFI+
Sbjct: 519 ADVEETAGINGA-GFIF 534


>gi|255262444|ref|ZP_05341786.1| outer membrane general secretion pathway protein, Secretin
           [Thalassiobium sp. R2A62]
 gi|255104779|gb|EET47453.1| outer membrane general secretion pathway protein, Secretin
           [Thalassiobium sp. R2A62]
          Length = 480

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 137/434 (31%), Positives = 230/434 (52%), Gaps = 24/434 (5%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++ +N+ ++++  V   ++ +++P  AD+   S RT+Y+ GK  G+  + L+G DG+ +
Sbjct: 58  LNVPMNRAVVVESDVPFAELSIANPGIADISTLSDRTIYVLGKLPGRTTLTLLGPDGRLI 117

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            N+D+ +  DIA  +  L + +   NI V   +D +VL G+V +     RA++L+E +  
Sbjct: 118 TNVDVHVTPDIAEFKERLSQILPGENIEVRTANDGIVLSGVVSSSARLTRALDLAERY-- 175

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG---SSSGP 226
                     +  +V NL+++ G  QV L+V  AE++R + K +    +I G   S++  
Sbjct: 176 ----------APDRVSNLMSVGGTQQVMLRVRFAEMQRSVRKSLSSSVNIFGTGFSTAAG 225

Query: 227 SKSFAADFGGKFVSEGGDFSVKGV-LDRFSFETVLHALERATAIRTLAEPTLTAISGQSA 285
           + +     GG   ++    +  G+      F  +L ALE    +RTLAEP LTA+SGQ A
Sbjct: 226 NINGVQAAGGGITTDATGAAFFGIDAGDIQFNVLLEALESKGVVRTLAEPNLTALSGQEA 285

Query: 286 SFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGV 343
            F +GG++    V+   G T+V   D+GV L F P V+    I L ++  VS  +   GV
Sbjct: 286 HFLAGGEYPVP-VAQEGGTTTVEYKDFGVELTFLPVVVDQDLINLTLKASVSSIDTTNGV 344

Query: 344 NAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
             G    + ++R R+  TTVE+  G +  +AGLL+DD   L   +P L  +P+LGALFR+
Sbjct: 345 QVGSDFTIAAFRTRETSTTVEMRDGESFAIAGLLQDDFTDLNGQVPWLGDVPVLGALFRS 404

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKE--AS 458
           + +NR ++E+ I  TP LV P     L+ P D      +   F F RV     P+   A 
Sbjct: 405 AEYNRSQSELVIIVTPHLVTPTRGEALALPTDRVRPPTERDLFLFGRVAASDAPQSGAAG 464

Query: 459 EVEGQNYKGAIGFI 472
           EV  Q++ G+ G++
Sbjct: 465 EVAKQDFSGSYGYV 478


>gi|77462453|ref|YP_351957.1| Outer membrane general secretion pathway protein, secretin
           [Rhodobacter sphaeroides 2.4.1]
 gi|77386871|gb|ABA78056.1| Outer membrane general secretion pathway protein, Secretin
           [Rhodobacter sphaeroides 2.4.1]
          Length = 461

 Score =  216 bits (549), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 142/443 (32%), Positives = 236/443 (53%), Gaps = 40/443 (9%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++ +N+ ++++      ++ +++P  AD+   S  ++Y+ GK  G+  + L+G DG+ +
Sbjct: 41  LNVPMNRAVVVESDRPFAELSIANPGIADISTLSETSIYVLGKAPGRTTLTLLGADGRLI 100

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            N+D+ +  D+A  +  LR+ +   NI V   +D +VL G V +     RA++L+  +  
Sbjct: 101 SNVDVHVTPDVAEFKERLRQILPGENIEVRTANDGIVLSGTVTSTAKLDRALDLASRY-- 158

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG---FQHSITGSSSG- 225
                     +  +V NL+++ G  QV LKV  AE++R + K +G   +  + +GS  G 
Sbjct: 159 ----------APDRVSNLMSVGGTQQVMLKVRFAEMQRSVAKSLGSSIYARNGSGSVIGG 208

Query: 226 ----------PSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEP 275
                     PS +  A  G   +S G  FSV G L+   F+ +L ALE    +RTLAEP
Sbjct: 209 TGTLLQNGIPPSGASIATSGNGALSLG--FSV-GALE---FQVLLEALESKGVVRTLAEP 262

Query: 276 TLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            LTA+SGQ A F +GG++    V+S     S+    +GV L+FTP V+   +I L I   
Sbjct: 263 NLTALSGQEAKFLAGGEYPIP-VASGDEKISIEYKPFGVELNFTPVVVDGNQINLMINAA 321

Query: 336 VS---EPVIGVNAG-DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKI 391
           VS     V   ++G  + +++ R+  TTVE+  G +  +AGLL+DD + L   +P L  I
Sbjct: 322 VSSIDNTVTLESSGFTINAFKRRETSTTVEMRDGESFAIAGLLQDDFRNLNGQVPWLGDI 381

Query: 392 PILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKI 451
           PILGALFR++ + R ++E+ I  TP LV P     L+ P D   +  +   F F RV   
Sbjct: 382 PILGALFRSAEYQRSQSELVIIVTPHLVTPTRGEALALPTDRVKLPSEKDLFLFGRVT-- 439

Query: 452 YGPKEASEVEGQNYKGAIGFIYK 474
            G   A+EV  Q++ G+ G++ +
Sbjct: 440 -GRGAAAEVARQDFSGSYGYVME 461


>gi|114764946|ref|ZP_01444119.1| bacterial type II/III secretion system protein [Pelagibaca
           bermudensis HTCC2601]
 gi|114542658|gb|EAU45682.1| bacterial type II/III secretion system protein [Roseovarius sp.
           HTCC2601]
          Length = 471

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 137/450 (30%), Positives = 235/450 (52%), Gaps = 32/450 (7%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
           V  G    +S+ +N+ ++++      ++ +++P  AD+   S RT+Y+ GK  G   + +
Sbjct: 33  VRTGTESVLSVPMNRAVVVESDRPFAELSIANPAIADISSLSDRTIYVLGKTPGTTTLTI 92

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           +  +G+ + N+D+ +  D+   +  LR+ + +  I V   +D +VL G + + Q  QRA+
Sbjct: 93  LDANGRLITNVDVRVAADVTEFKERLRQILPNEPIEVRTANDGIVLSGTISSAQKLQRAL 152

Query: 162 ELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG 221
           +L+E +            + ++V NL+ + G  QV LKV  AE++R + K +    S+TG
Sbjct: 153 DLAERY------------APERVSNLMTVGGVQQVMLKVRFAEMQRSVAKNLRSSLSVTG 200

Query: 222 SSSGPSKSFAADFGGKFVSEGGDFSVKGVLDR-----FSFET-------VLHALERATAI 269
           +  G  ++  A   G  + + G+ S+    D        F +       +L ALE     
Sbjct: 201 TLFGNDETTLASETGTLIGQSGNTSINVNDDAEGAFLLGFNSGALQVGILLEALESKGIS 260

Query: 270 RTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIG 329
           RTLAEP LTA+SGQ A F +GG++    VS   G T V+   +GV L+F P V+    I 
Sbjct: 261 RTLAEPNLTALSGQEARFLAGGEYPVP-VSQDDGTTIVSYKPFGVELNFVPRVVDGDLIN 319

Query: 330 LRIQTEVS--EPVIGVNAGDMP--SYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGI 385
           L ++  VS  +   G+  G++   ++R R+  TTVE+  G +  +AGLL+DD + L   +
Sbjct: 320 LELEAAVSSIDSSNGITTGEITIDAFRRRETSTTVEMRDGESFAIAGLLQDDFRDLNGQV 379

Query: 386 PLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           P L  IP+LGALFR++ + RE++E+ I  TP LV P     L+ P D      +   F +
Sbjct: 380 PWLGDIPVLGALFRSAEYEREQSELVIIVTPHLVTPTRGEVLALPTDRVRPPTEKDLFLY 439

Query: 446 NR-VNKIYGPKE--ASEVEGQNYKGAIGFI 472
            R  +    P+   A+EV  Q++ G+ G++
Sbjct: 440 GRTASDTRRPQSGGAAEVAKQDFTGSYGYV 469


>gi|260574616|ref|ZP_05842619.1| type II and III secretion system protein [Rhodobacter sp. SW2]
 gi|259023033|gb|EEW26326.1| type II and III secretion system protein [Rhodobacter sp. SW2]
          Length = 470

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 140/450 (31%), Positives = 235/450 (52%), Gaps = 40/450 (8%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           + + + LN+ ++++  V   ++ +++P  AD+   S +++Y+ GK  G+  + L+G DG+
Sbjct: 38  RALEVPLNRAVVVESDVPFAELSIANPGIADISTLSDKSIYVLGKAPGRTTLTLLGPDGR 97

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
            + N+++ +  D+A  +  LR+ +    I V   +D +VL G V +     RA++L+E +
Sbjct: 98  LISNVEVQVSPDVAEFKERLRQILPGELIEVRTANDGIVLSGTVSSTAKLDRALDLAERY 157

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGP- 226
                       + ++V NL+++ G  QV LKV  AE++R + K +    +I GS+ G  
Sbjct: 158 ------------APERVSNLMSVGGTQQVMLKVRFAEMQRSVAKNLSASLAINGSTGGGN 205

Query: 227 ------SKSFAAD------FGGKFVSEGGDFSVKGVL------DRFSFETVLHALERATA 268
                 S  F A       F G   S+ G  + +GV           F  +L ALE    
Sbjct: 206 VGVNAGSGQFTAGGTRDGVFAG--TSQSGADNSEGVATIGFSAGSLQFAVLLEALESKGV 263

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRI 328
           +RTLAEP LTA+SGQ A F +GG++    V+  +G+ SV    +GV ++FTP V+    I
Sbjct: 264 VRTLAEPNLTALSGQEAKFLAGGEYPIP-VADGSGSISVEYKPFGVEMNFTPVVVDGDII 322

Query: 329 GLRIQTEVSE---PVIGVNAG-DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
            L I   VS     V   NAG  + +++ R+  TTVE+  G +  +AGLL+DD + L   
Sbjct: 323 NLTINAAVSSIDSTVTVQNAGFTLNAFKRRETSTTVEMRDGESFAIAGLLQDDFRDLNGQ 382

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF 444
           +P L  IPILGALFR++ + R ++E+ I  TP LV P     L+ P D   +  + + F 
Sbjct: 383 VPWLGDIPILGALFRSAEYQRAQSELVIIVTPHLVTPTRGEALALPTDRIRIPTERELFL 442

Query: 445 FNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           F + +   G     EV  Q++ G+ G++ +
Sbjct: 443 FGKTSGARG--ATGEVARQDFSGSYGYVME 470


>gi|221638316|ref|YP_002524578.1| Type II and III secretion system protein [Rhodobacter sphaeroides
           KD131]
 gi|221159097|gb|ACM00077.1| Type II and III secretion system protein precursor [Rhodobacter
           sphaeroides KD131]
          Length = 461

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 135/437 (30%), Positives = 232/437 (53%), Gaps = 28/437 (6%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++ +N+ ++++      ++ +++P  AD+   S  ++Y+ GK  G+  + L+G DG+ +
Sbjct: 41  LNVPMNRAVVVESDRPFAELSIANPGIADISTLSETSIYVLGKAPGRTTLTLLGADGRLI 100

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            N+D+ +  D+A  +  LR+ +   NI V   +D +VL G V +     RA++L+  +  
Sbjct: 101 SNVDVHVTPDVAEFKERLRQILPGENIEVRTANDGIVLSGTVTSTAKLDRALDLASRY-- 158

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG---FQHSITGSSSGP 226
                     +  +V NL+++ G  QV LKV  AE++R + K +G   +  + +GS  G 
Sbjct: 159 ----------APDRVSNLMSVGGTQQVMLKVRFAEMQRSVAKSLGSSIYARNGSGSVIGG 208

Query: 227 SKSFAAD----FGGKFVSEG-GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
           + +   +     G    + G G  S+   +    F+ +L ALE    +RTLAEP LTA+S
Sbjct: 209 TGTLLQNGIPPSGAPISTSGNGALSLGFSVGALEFQVLLEALESKGVVRTLAEPNLTALS 268

Query: 282 GQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS---E 338
           GQ A F +GG++    V+S     S+    +GV L+FTP V+   +I L I   VS    
Sbjct: 269 GQEAKFLAGGEYPIP-VASGDEKISIEYKPFGVELNFTPVVVDGNQINLMINAAVSSIDN 327

Query: 339 PVIGVNAG-DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGAL 397
            V   ++G  + +++ R+  TTVE+  G +  +AGLL+DD + L   +P L  IPILGAL
Sbjct: 328 TVTLESSGFTINAFKRRETSTTVEMRDGESFAIAGLLQDDFRNLNGQVPWLGDIPILGAL 387

Query: 398 FRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEA 457
           FR++ + R ++E+ I  TP LV P     L+ P D   +  +   F F RV    G   A
Sbjct: 388 FRSAEYQRSQSELVIIVTPHLVTPTRGEALALPTDRVKLPSEKDLFLFGRVT---GRGAA 444

Query: 458 SEVEGQNYKGAIGFIYK 474
           +EV  Q++ G+ G++ +
Sbjct: 445 AEVARQDFSGSYGYVME 461


>gi|126461331|ref|YP_001042445.1| type II and III secretion system protein [Rhodobacter sphaeroides
           ATCC 17029]
 gi|126102995|gb|ABN75673.1| type II and III secretion system protein [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 461

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 135/437 (30%), Positives = 232/437 (53%), Gaps = 28/437 (6%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++ +N+ ++++      ++ +++P  AD+   S  ++Y+ GK  G+  + L+G DG+ +
Sbjct: 41  LNVPMNRAVVVESDRPFAELSIANPGIADISTLSETSIYVLGKAPGRTTLTLLGADGRLI 100

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            N+D+ +  D+A  +  LR+ +   NI V   +D +VL G V +     RA++L+  +  
Sbjct: 101 SNVDVHVTPDVAEFKERLRQILPGENIEVRTANDGIVLSGTVTSTAKLDRALDLASRY-- 158

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG---FQHSITGSSSGP 226
                     +  +V NL+++ G  QV LKV  AE++R + K +G   +  + +GS  G 
Sbjct: 159 ----------APDRVSNLMSVGGTQQVMLKVRFAEMQRSVAKSLGSSIYARNGSGSVIGG 208

Query: 227 SKSFAAD----FGGKFVSEG-GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
           + +   +     G    + G G  S+   +    F+ +L ALE    +RTLAEP LTA+S
Sbjct: 209 TGTLLQNGIPPSGAPISTSGNGALSLGFSVGALEFQVLLEALESKGVVRTLAEPNLTALS 268

Query: 282 GQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS---E 338
           GQ A F +GG++    V+S     S+    +GV L+FTP V+   +I L I   VS    
Sbjct: 269 GQEAKFLAGGEYPIP-VASGDEKISIEYKPFGVELNFTPVVVDGNQINLMINAAVSSIDN 327

Query: 339 PVIGVNAG-DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGAL 397
            V   ++G  + +++ R+  TTVE+  G +  +AGLL+DD + L   +P L  IPILGAL
Sbjct: 328 TVTLESSGFTINAFKRRETSTTVEMRDGESFAIAGLLQDDFRNLNGQVPWLGDIPILGAL 387

Query: 398 FRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEA 457
           FR++ + R ++E+ I  TP LV P     L+ P D   +  +   F F RV    G   A
Sbjct: 388 FRSAEYQRSQSELVIIVTPHLVTPTRGEALALPTDRVKLPSEKDLFLFGRVT---GRGAA 444

Query: 458 SEVEGQNYKGAIGFIYK 474
           +EV  Q++ G+ G++ +
Sbjct: 445 AEVARQDFSGSYGYVME 461


>gi|332560337|ref|ZP_08414659.1| Type II and III secretion system protein precursor [Rhodobacter
           sphaeroides WS8N]
 gi|332278049|gb|EGJ23364.1| Type II and III secretion system protein precursor [Rhodobacter
           sphaeroides WS8N]
          Length = 466

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 135/437 (30%), Positives = 232/437 (53%), Gaps = 28/437 (6%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++ +N+ ++++      ++ +++P  AD+   S  ++Y+ GK  G+  + L+G DG+ +
Sbjct: 46  LNVPMNRAVVVESDRPFAELSIANPGIADISTLSETSIYVLGKAPGRTTLTLLGADGRLI 105

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            N+D+ +  D+A  +  LR+ +   NI V   +D +VL G V +     RA++L+  +  
Sbjct: 106 SNVDVHVTPDVAEFKERLRQILPGENIEVRTANDGIVLSGTVTSTAKLDRALDLASRY-- 163

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG---FQHSITGSSSGP 226
                     +  +V NL+++ G  QV LKV  AE++R + K +G   +  + +GS  G 
Sbjct: 164 ----------APDRVSNLMSVGGTQQVMLKVRFAEMQRSVAKSLGSSIYARNGSGSVIGG 213

Query: 227 SKSFAAD----FGGKFVSEG-GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
           + +   +     G    + G G  S+   +    F+ +L ALE    +RTLAEP LTA+S
Sbjct: 214 TGTLLQNGIPPSGNPISTSGNGALSLGFSVGALEFQVLLEALESKGVVRTLAEPNLTALS 273

Query: 282 GQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS---E 338
           GQ A F +GG++    V+S     S+    +GV L+FTP V+   +I L I   VS    
Sbjct: 274 GQEAKFLAGGEYPIP-VASGDEKISIEYKPFGVELNFTPVVVDGNQINLMINAAVSSIDN 332

Query: 339 PVIGVNAG-DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGAL 397
            V   ++G  + +++ R+  TTVE+  G +  +AGLL+DD + L   +P L  IPILGAL
Sbjct: 333 TVTLESSGFTINAFKRRETSTTVEMRDGESFAIAGLLQDDFRNLNGQVPWLGDIPILGAL 392

Query: 398 FRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEA 457
           FR++ + R ++E+ I  TP LV P     L+ P D   +  +   F F RV    G   A
Sbjct: 393 FRSAEYQRSQSELVIIVTPHLVTPTRGEALALPTDRVKLPSEKDLFLFGRVT---GRGAA 449

Query: 458 SEVEGQNYKGAIGFIYK 474
           +EV  Q++ G+ G++ +
Sbjct: 450 AEVARQDFSGSYGYVME 466


>gi|146276361|ref|YP_001166520.1| type II and III secretion system protein [Rhodobacter sphaeroides
           ATCC 17025]
 gi|145554602|gb|ABP69215.1| type II and III secretion system protein [Rhodobacter sphaeroides
           ATCC 17025]
          Length = 461

 Score =  212 bits (540), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 141/441 (31%), Positives = 236/441 (53%), Gaps = 36/441 (8%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++ +N+ ++++      ++ +++P  AD+   S  ++Y+ GK  G+  + L+G DG+ +
Sbjct: 41  LNVPMNRAVVVESDRPFAELSIANPGIADISTLSETSIYVLGKAPGRTTLTLLGADGRLI 100

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            N+D+ +  D+A  +  LR+ +   NI V   +D +VL G V + +   RA++L+     
Sbjct: 101 SNVDVHVTPDVAEFKERLRQILPGENIEVRTANDGIVLSGTVTSAERLDRALDLA----- 155

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG---FQHSITGSSSGP 226
               N+YA     +V NL+++ G  QV LKV  AE++R + K +G   +  + +GS  G 
Sbjct: 156 ----NRYA---PDRVSNLMSVGGTQQVMLKVRFAEMQRSVAKSLGSSIYARNGSGSVIGG 208

Query: 227 SKSFAAD----FGGKFVSE-----GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTL 277
           + +   +     G    +      G  FSV G L+   F  +L ALE    +RTLAEP L
Sbjct: 209 TGTLLQNGIPPSGAPITTAATGALGLGFSV-GALE---FSVLLEALESKGVVRTLAEPNL 264

Query: 278 TAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS 337
           TA+SGQ A F +GG++    V+S     ++    +GV L+FTP V+   +I L I   VS
Sbjct: 265 TALSGQEAKFLAGGEYPIP-VASGDEKIAIEYKPFGVELNFTPVVVDGSQINLMINAAVS 323

Query: 338 ---EPVIGVNAG-DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPI 393
                V   +AG  + +++ R+  TTVE+  G +  +AGLL+DD + L   +P L  IPI
Sbjct: 324 SIDNTVSLESAGFTINAFKRRETSTTVEMRDGESFAIAGLLQDDFRNLNGQVPWLGDIPI 383

Query: 394 LGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYG 453
           LGALFR++ + R ++E+ I  TP LV P     L+ P D   +  + + F F RV    G
Sbjct: 384 LGALFRSAEYQRSQSELVIIVTPHLVTPTRGEALALPTDRIKLPSEKELFLFGRVT---G 440

Query: 454 PKEASEVEGQNYKGAIGFIYK 474
              A EV  Q++ G+ G++ +
Sbjct: 441 RGAAGEVARQDFSGSYGYVME 461


>gi|84687277|ref|ZP_01015157.1| Outer membrane general secretion pathway protein, Secretin
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84664710|gb|EAQ11194.1| Outer membrane general secretion pathway protein, Secretin
           [Rhodobacterales bacterium HTCC2654]
          Length = 474

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 139/451 (30%), Positives = 229/451 (50%), Gaps = 34/451 (7%)

Query: 45  GKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGH 104
           G  + +++ +N+ ++++      ++ +++P  AD+   S RT+Y+ GK+ G+  + L+  
Sbjct: 36  GVAETLNVPMNRAVVVESDQPFAEISIANPGIADISTLSDRTIYVLGKSQGRTTLTLLAP 95

Query: 105 DGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELS 164
           DG  + N+++ +  D++  +  LR+ +    I V   +D +VL G V +I    RA++L+
Sbjct: 96  DGTLISNVEVQVTPDLSEFKERLRQILPGEPIEVRTANDGIVLSGTVTSIAALDRALDLA 155

Query: 165 ETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI----GFQHSIT 220
           E +            +  KV NLL++ G  QV LKV  AE++R + K +    GF  +I 
Sbjct: 156 ERY------------APDKVSNLLSVGGTQQVMLKVRFAEMQRSVTKSLSSSLGFGTNIN 203

Query: 221 G-------SSSGPSKSFAADFGGKFVSEGGD----FSVKGVLDRFSFETVLHALERATAI 269
           G        + G   +  A   G  +S G D    F+         F  +L ALE    +
Sbjct: 204 GLGGSIGTGALGNQANLDAASAGDLISTGNDRTGAFTFGFNAGALQFAVMLEALENKGMV 263

Query: 270 RTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIG 329
           RTLAEP LTA+SGQ ASF +GG++   +V  + GA  +    +GV L FTP V+    I 
Sbjct: 264 RTLAEPNLTALSGQEASFLAGGEYPIPSVQEN-GAVVIDYKPFGVELTFTPRVVDQDIIN 322

Query: 330 LRIQTEVSEPVIGVNAGD----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGI 385
           L++   VS     V  GD    + +++ R+  TTVE+  G +  +AGLL+DD + L   +
Sbjct: 323 LQMTASVSGLDNSVTYGDGAISVNAFKRRETSTTVEMRDGQSFAIAGLLQDDFRDLNGQV 382

Query: 386 PLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           P L  +PILGALFR++ + R ++E+ I  TP LV P     L+ P D      +A  F  
Sbjct: 383 PWLGDVPILGALFRSADYERSQSELVIIVTPHLVTPTRGEALALPTDRVRPPSEADLFLR 442

Query: 446 NRVNKIYGPK--EASEVEGQNYKGAIGFIYK 474
                   P    A EV  Q++ G+ G++ +
Sbjct: 443 GNTAAPNRPTTGAAGEVARQDFTGSYGYVME 473


>gi|126725970|ref|ZP_01741812.1| Outer membrane general secretion pathway protein, Secretin
           [Rhodobacterales bacterium HTCC2150]
 gi|126705174|gb|EBA04265.1| Outer membrane general secretion pathway protein, Secretin
           [Rhodobacterales bacterium HTCC2150]
          Length = 466

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 136/450 (30%), Positives = 237/450 (52%), Gaps = 42/450 (9%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++ +N+ I+++      +V V++P+ AD+   S +T+Y+ GK  G+  + L+   G+ +
Sbjct: 30  LNVPMNRAIVVETETSFGEVSVANPSIADISTLSDKTIYVLGKAPGRTTLTLLDGTGRLI 89

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            N+D+ +  D+A  +  L++ +    I V   +D +V+ G V +I    RA++L+     
Sbjct: 90  SNVDVHVTPDVAEFKERLQQILPGEPIEVRTANDGIVMSGTVSSIGKLDRALDLA----- 144

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI----GFQHSITGSS-- 223
               N+YA     +V NL+++ G  QV LK+  AE++R + K +     F  S+ G++  
Sbjct: 145 ----NRYA---PNRVSNLMSVGGTQQVMLKIRFAEMQRSVAKNLTGSLAFSGSLGGNAGA 197

Query: 224 SGPSKSFAADFGGKFVSEG-------------GDFSVKGVLDRFSFETVLHALERATAIR 270
           +G S++F+       + +G             G FS+        F+ +L ALE    +R
Sbjct: 198 TGASQTFSDGSNLANLYDGDSSTSATSSQDRDGLFSIGFSNGTIGFQVLLEALETKGVVR 257

Query: 271 TLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGL 330
           TLAEP LTA+SGQ A F +GG++    +  + G+  +    +G+ + FTPTV+    I L
Sbjct: 258 TLAEPNLTALSGQKADFLAGGEYPTPAIDDN-GSPIIEYKPFGIEMEFTPTVVDGDLINL 316

Query: 331 RIQTEVSEPVIGVNAGDMPSYRV-----RKADTTVELPSGGTIVLAGLLKDDIQQLKEGI 385
           +++T VS     ++A +   + V     RKA TTVE+  G +  +AGLL+DD       +
Sbjct: 317 QLKTSVSSLDTSISAQNSAGFTVFGFKTRKASTTVEMRDGQSFAIAGLLQDDFTDQSGQV 376

Query: 386 PLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           P L  +PI+GALFR+S + R+++E+ +  TP LV P     L+ P D   +  + + F F
Sbjct: 377 PWLGDVPIIGALFRSSEYERKQSELVVIVTPHLVTPTRGEALALPTDRVQIPTERELFLF 436

Query: 446 NRV---NKIYGPKEASEVEGQNYKGAIGFI 472
             V    KI G   A EV  Q++ G+ G++
Sbjct: 437 GNVAGKKKIKG--AAGEVARQDFSGSYGYV 464


>gi|260426909|ref|ZP_05780888.1| type II and III secretion system protein [Citreicella sp. SE45]
 gi|260421401|gb|EEX14652.1| type II and III secretion system protein [Citreicella sp. SE45]
          Length = 473

 Score =  209 bits (532), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 134/456 (29%), Positives = 232/456 (50%), Gaps = 34/456 (7%)

Query: 38  NISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQA 97
           N+  V  G    +++ +N+ ++++      ++ +++P  AD+   S RT+Y+ GK  G  
Sbjct: 29  NLRVVRTGTESVLNVPMNRAVVVESDQPFAELSIANPAIADISSLSERTIYVLGKTPGTT 88

Query: 98  NVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDS 157
            + ++  +G+ + N+D+ +  D+   +  LR+ +   +I V   +D +VL G V + Q  
Sbjct: 89  TLTILDGNGRLITNVDVRVAADVTEFKERLRQILPGESIEVRTANDGIVLSGTVSSAQKL 148

Query: 158 QRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH 217
           QRA++L++ +            + ++V NL+ + G  QV LKV  AE++R + K +    
Sbjct: 149 QRALDLAQRY------------APERVSNLMTVGGVQQVMLKVRFAEMQRSVSKNLRSSL 196

Query: 218 SITGSSSGPSKSFAADFGGKFVSEGGDFS-------------VKGVLDRFSFETVLHALE 264
           SI G   G  +       G +++ G  +              + G         +L ALE
Sbjct: 197 SIGGPIFGEDEITIGSETGTWLNSGNSYGDAVTVADGTESALLLGFNGAIEVGILLEALE 256

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLS 324
               +RTLAEP LTA+SGQ A F +GG++    VS   G  SVT   +GV L+F PTV+ 
Sbjct: 257 SKGMVRTLAEPNLTALSGQEAKFLAGGEYPVP-VSQEDGKLSVTYKPFGVELNFVPTVID 315

Query: 325 PGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQ 380
              I L+++  VS       I  +A  + ++R R+  TTVE+  G +  +AGLL+DD + 
Sbjct: 316 GDLINLQLEAAVSSIDSSNGITTDAISIDAFRRRETSTTVEMRDGESFAIAGLLQDDFRD 375

Query: 381 LKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDA 440
           +   +P +  IP+LGALFR++ + R+++E+ I  TP LV P     L+ P D      + 
Sbjct: 376 VNGQVPWIGDIPVLGALFRSAEYERQQSELVIIVTPHLVTPTRGEALALPTDRVMPPTEK 435

Query: 441 KAFFFNRV--NKIYGPKE--ASEVEGQNYKGAIGFI 472
             F F R   +    P+   A+EV  Q++ G+ G++
Sbjct: 436 DLFLFGRTSSDDARRPRTGGAAEVARQDFTGSYGYV 471


>gi|46204251|ref|ZP_00050268.2| COG4964: Flp pilus assembly protein, secretin CpaC
           [Magnetospirillum magnetotacticum MS-1]
          Length = 472

 Score =  207 bits (528), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 134/408 (32%), Positives = 217/408 (53%), Gaps = 51/408 (12%)

Query: 45  GKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGH 104
           G+ +++ +   + +I+ +P D ++V V++P  A+ VV S R ++L G   G  ++ ++  
Sbjct: 47  GQSRRVELSKGRSLIVDLPRDAKEVFVANPAVANAVVRSSRKLFLIGIENGATSIFVMDA 106

Query: 105 DGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELS 164
           +G+Q+  LD+ I RDI  L  +L++ +   +I V+ V D++VL G V +  ++Q+A++++
Sbjct: 107 EGRQIAALDVTIARDINVLRQSLQQSLPGRHIDVKAVGDSLVLSGGVSSASEAQQAIDIA 166

Query: 165 ETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS 224
             F+  +       ++   V+N L I  +DQV ++VT+ EV R ++KQ G   +   S+ 
Sbjct: 167 NAFVGIA--GGAGGAARGAVINNLTIRNKDQVMIRVTVVEVARSVIKQFGISTTGNWSAL 224

Query: 225 GPSKSFAADFGGKFVSEGGDFSVKGVLDR-------------FSFETVLHALERATAIRT 271
            P      D  G F++    F + G                 FS +  L A E+A   R 
Sbjct: 225 NP-----LDSTGNFLTNNTGFPLTGAFTPSGNALTASVRSGGFSLQATLRAFEQAGVSRI 279

Query: 272 LAEPTLTAISGQSASFTSGGQHLYKTVSSSTGAT------SVTTHDYGVVLHFTPTVLSP 325
           LAEPTLTAISG++A FT+GG+ +    + S GA       S+    YGV L FTP VL+ 
Sbjct: 280 LAEPTLTAISGEAAKFTAGGE-IPVPANCSVGAVGSACTISLVYKPYGVSLSFTPVVLAE 338

Query: 326 GRIGLRIQTEVSE----------------PVIGVNAGDMPSYRVRKADTTVELPSGGTIV 369
            RI +R+ T+V+E                PV        P+ R R ++TTVEL SG T++
Sbjct: 339 NRISIRVATDVTELDTQNSFSYNLNGRVVPV--------PATRRRNSETTVELASGATMM 390

Query: 370 LAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPF 417
            AGL++   +    G+P L  +PILGALFR+  F R+E E+ I  TP 
Sbjct: 391 TAGLIQQQNKGTINGLPGLMNLPILGALFRSRDFQRDENELMILVTPI 438


>gi|94497254|ref|ZP_01303826.1| type II and III secretion system protein [Sphingomonas sp. SKA58]
 gi|94423359|gb|EAT08388.1| type II and III secretion system protein [Sphingomonas sp. SKA58]
          Length = 486

 Score =  206 bits (523), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 144/438 (32%), Positives = 227/438 (51%), Gaps = 39/438 (8%)

Query: 28  PIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTM 87
           P    NAA  ++ D  I     +S+G ++VI L  P  + DV+++DP   DV V S   +
Sbjct: 21  PTSALNAATSSMQDNAI----LLSVGGSRVINL--PAKMSDVVIADPEVVDVHVRSQNQL 74

Query: 88  YLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVL 147
           YL  K  G+  V     +GK + +  + +  +I  ++  LR  +  +NI V  ++  V+L
Sbjct: 75  YLIAKKAGETTVFATAPNGKVLFSGTVRVGNNITSIDDMLRIAMPGANIAVNTMNGMVLL 134

Query: 148 HGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRR 207
            G ++  +D+     L++ F+ +             V++ L +A   QV L+V IAEV +
Sbjct: 135 TGTIQAPEDAAEVERLTQAFVGKD----------VTVVSRLRMATPLQVMLQVKIAEVAK 184

Query: 208 DILKQIGFQHS--------ITGSSSGPSKSFA--------ADFGGKFVSEGGDFSVKGVL 251
           D+  +IG   +        + G+  G  + FA         DF      +GG +S+ GV 
Sbjct: 185 DVGHKIGTNFASVDRSGGKVAGNVGGGLRDFAQYNADTNSWDFTNPI--DGG-YSLGGVA 241

Query: 252 DRFSFETV--LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT 309
                +    L   E +    TLA+P LTA+SG++ASF +GG++ Y TVS+     S+  
Sbjct: 242 RILGMDIAGALDLAESSGLASTLAQPNLTALSGETASFLAGGEYPY-TVSNGLQGNSIEF 300

Query: 310 HDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIV 369
             YGV L FTPTVL+ GRI LR++  VS     +NA ++P+ + R A+TTVEL SG   +
Sbjct: 301 KQYGVQLAFTPTVLADGRISLRVRPTVSSLDFSINA-NVPALKSRTAETTVELGSGQAFM 359

Query: 370 LAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSR 429
           +AGLL ++       +P L  +PILG+LF++ +F R ETE+ I  TP+LVKP+   D+  
Sbjct: 360 IAGLLNNEASNNVNKVPGLGNLPILGSLFKSRQFQRNETELVIVVTPYLVKPMNASDVRL 419

Query: 430 PDDHYSVEDDAKAFFFNR 447
           P D +   D  +  F  R
Sbjct: 420 PTDGFRNADLGEGLFLQR 437


>gi|89053488|ref|YP_508939.1| type II and III secretion system protein [Jannaschia sp. CCS1]
 gi|88863037|gb|ABD53914.1| type II and III secretion system protein [Jannaschia sp. CCS1]
          Length = 466

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 140/460 (30%), Positives = 229/460 (49%), Gaps = 31/460 (6%)

Query: 28  PIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTM 87
           PI  A A  + +  VE      + + +N+ ++++  +   ++ V++P  AD+   S R++
Sbjct: 21  PISGAQAQGLRV--VEGESTGTLRVPMNRAVVVEAEMLFAELSVANPAIADIATLSERSI 78

Query: 88  YLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVL 147
           Y+ G+  G+  + L+G DG  + N++I +  D+A L   LR  I    + V   +D +VL
Sbjct: 79  YVLGRAPGRTTMTLLGADGSLIANVEIQVVPDVAELRERLREIIPGEPVEVRTANDGIVL 138

Query: 148 HGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRR 207
            G V +     RA+EL+E +            +  ++ NL+ + G+ QV L+V  AE++R
Sbjct: 139 SGTVGSAFAVDRAMELAERY------------APGRISNLMMVGGQQQVMLQVRFAEMQR 186

Query: 208 DILKQIGFQHSI--TGSSSGPSKSFAADFGGKFVSEG----------GDFSVKGVLDRFS 255
            + +++     I  TG + G S       GG     G          G   V        
Sbjct: 187 TVRQELSASLGIGSTGGNFGTSVGAGNLQGGTGFGTGNLPGGLDGRNGGIGVSFAAGGLQ 246

Query: 256 FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVV 315
              +L ALE    +RTLAEP LTA+SG +ASF +GGQ    T S S G T++   D+GV 
Sbjct: 247 LSVLLEALESNGMVRTLAEPNLTALSGATASFLAGGQFPVPTESES-GGTTIEFVDFGVQ 305

Query: 316 LHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLK 375
           L FTPTV+    I L +  E+S     +     P+   R A T VE+  G +  +AGLL+
Sbjct: 306 LDFTPTVVGDHVINLALDAEISSIGEIIATTGAPAINTRNASTVVEMRDGDSFAIAGLLQ 365

Query: 376 DDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYS 435
           DD       +P L  +P+LGALFR++ ++R ++E+ I  T  LV PV    L+ P D   
Sbjct: 366 DDFTNSVAEVPWLGDLPVLGALFRSASYSRSQSELVIIITAHLVSPVNGEALALPTDRVR 425

Query: 436 VEDDAKAFFFNRVNKIYGPK---EASEVEGQNYKGAIGFI 472
           +  +++ FF  +V     P+    A +V  Q++ G+ G++
Sbjct: 426 IPTESELFFQGQVTG-SSPRPGTAAGDVAQQDFSGSYGYV 464


>gi|254440636|ref|ZP_05054129.1| Putative phospholipid-binding domain family [Octadecabacter
           antarcticus 307]
 gi|198250714|gb|EDY75029.1| Putative phospholipid-binding domain family [Octadecabacter
           antarcticus 307]
          Length = 474

 Score =  205 bits (521), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 140/457 (30%), Positives = 230/457 (50%), Gaps = 59/457 (12%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++ +N+ ++++  V   ++ +++P+ AD+   S RT+Y+ GK  G+  + L+G DG+ +
Sbjct: 41  LNVPMNRAVVVESDVPFTELSIANPSIADISSLSDRTIYVLGKEPGRTTLTLLGGDGRLI 100

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            N+++ +  DIA  +  L + +   NI V   +D +VL G V +I    RA+EL+     
Sbjct: 101 TNVEVHVTPDIAEFKERLEQILPGENIEVRTANDGIVLSGTVSSIARLDRALELA----- 155

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRD--------------------- 208
               N+YA     +V NL+++ G  QV L+V  AE++R                      
Sbjct: 156 ----NRYA---PDRVSNLMSVGGTQQVMLRVRFAEMQRSVSKSLSSSLALGGSTLGGDLG 208

Query: 209 -------ILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLH 261
                   +   G   +++G++  P+ +   D  G F+     F+  GV        +L 
Sbjct: 209 LALGTGATVGNTGRLSTLSGAT--PANN---DNAGAFLF---GFNAGGV----EVGILLE 256

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPT 321
           ALE    +RTLAEP LTA+SGQ ASF +GG++    +S    A +V    +G+ L FTP 
Sbjct: 257 ALENRGVVRTLAEPNLTALSGQEASFLAGGEYPVP-ISQDGSAITVEYKPFGISLSFTPR 315

Query: 322 VLSPGRIGLRIQTEVS--EPVIGV--NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           V+    I L +   VS  +P  G   N   + ++R R+  TTVE+  G +  +AGLL DD
Sbjct: 316 VIDGDIINLELHASVSSLDPTNGFSQNGFSIDAFRTRETSTTVEMRDGESFAIAGLLSDD 375

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
              L   +P    IP+LGALFR++ ++R++TE+ I  TP LV P     L+ P D     
Sbjct: 376 FVDLSGQVPWAGDIPVLGALFRSAEYSRQQTELVIIVTPHLVTPTRGDALALPTDRVRPP 435

Query: 438 DDAKAFFFNRVNKIYGPKE--ASEVEGQNYKGAIGFI 472
            +   F F RV     P+   A EV  Q++ G+ G++
Sbjct: 436 TERDLFLFGRVTAEDAPQSGGAGEVARQDFSGSYGYV 472


>gi|149915642|ref|ZP_01904168.1| bacterial type II/III secretion system protein [Roseobacter sp.
           AzwK-3b]
 gi|149810534|gb|EDM70377.1| bacterial type II/III secretion system protein [Roseobacter sp.
           AzwK-3b]
          Length = 467

 Score =  204 bits (518), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 136/454 (29%), Positives = 233/454 (51%), Gaps = 32/454 (7%)

Query: 38  NISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQA 97
           N+  V  G  + +++ +N+ ++++  V   ++ +++P+ AD    S RT+Y+ GK  G+ 
Sbjct: 29  NLQVVRNGAARDLNVTMNRAVVVESDVPFAELSIANPSIADFSTLSDRTIYVLGKAPGRT 88

Query: 98  NVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDS 157
            + L+   G+ + N++I +  D++  +  L++ + +  I V   +D +VL G V +    
Sbjct: 89  TLTLLDDSGRLITNVEIHVSTDVSEFKERLQQILPNERIEVRTANDGIVLSGSVSSTARM 148

Query: 158 QRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH 217
           +RA+ L++ +            +  +V NL+ +AG  QV LKV  AE++R + KQ+    
Sbjct: 149 ERALSLAQRY------------APDRVSNLMVVAGNQQVMLKVRFAEMQRSVSKQL--ST 194

Query: 218 SITGSSSGPSKSFAADFGGKFVSEGGD-----FSVKGVLDRFSFE-------TVLHALER 265
           S+   + G S + AA  G    S G +      +    +  F F+        +L ALE 
Sbjct: 195 SLAVDALGVSGNGAALAGSNLPSAGANRVGITANNNAGVAFFGFDIGSVEIGILLEALET 254

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
              +RTLAEP LTA+SGQ A F +GG++    V+     TS+    +GV L+F P V+  
Sbjct: 255 KGVVRTLAEPNLTALSGQEAKFLAGGEYPVP-VAQDNNTTSIEFKPFGVELNFIPRVVDG 313

Query: 326 GRIGLRIQTEVS--EPVIGVNAG--DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
             I L +   VS  +P  G+N G  ++ ++R R   TTV+L  G +  +AGLL+DD +  
Sbjct: 314 DIINLEMAAAVSSIDPTNGINTGAFNVDAFRRRDTSTTVQLRDGESFAIAGLLQDDFRDT 373

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
              +P L  +PILGALFR++ + R +TE+ I  +  LV P     L+ P D   +  +  
Sbjct: 374 NAQVPWLGDVPILGALFRSADYARAQTELVIIVSAHLVTPTRGEALALPTDRVRLPSEMD 433

Query: 442 AFFFNRV-NKIYGPKEASEVEGQNYKGAIGFIYK 474
            F   RV N       A EV  Q++ G+ G++ +
Sbjct: 434 LFLNGRVLNSNIPSGTAGEVARQDFTGSYGYVME 467


>gi|159043678|ref|YP_001532472.1| type II and III secretion system protein [Dinoroseobacter shibae
           DFL 12]
 gi|157911438|gb|ABV92871.1| type II and III secretion system protein [Dinoroseobacter shibae
           DFL 12]
          Length = 474

 Score =  204 bits (518), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 134/451 (29%), Positives = 226/451 (50%), Gaps = 43/451 (9%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + + +N+ ++++  +   ++ V++P  AD+   S R++Y+ GK+ G+  + L+G DG+ +
Sbjct: 41  LQVPMNRAVVVESDIPFAELSVANPGIADIATLSDRSIYVLGKSQGRTTMTLLGADGRLI 100

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            N+D+ +  DIA  +  L + +   NI V   +D VVL G   ++    RA++L++ +  
Sbjct: 101 TNVDVQVTPDIAEFKERLEQILPGENIEVRTANDGVVLSGTASSVTAMDRALDLAQRY-- 158

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKS 229
                     +  +V NL++I G  QV LKV  AE++R + KQ+     +T   SG   +
Sbjct: 159 ----------APDRVSNLMSIGGSQQVMLKVRFAEMQRSVSKQL--SGGLTAIYSGTDGA 206

Query: 230 FAADFGGKFVSEGGDFSVKGV--------------------LDRFSFETVLHALERATAI 269
           F+   G   +++GG  S+ G                     +   S   +L ALE    +
Sbjct: 207 FSVGLGSGGLTDGG--SIGGANSTEFTLNPEAAGTIGLGFNIGNVSLGILLEALESKGVV 264

Query: 270 RTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIG 329
           RTLAEP LT +SGQ ASF +GG++    V+   G  SV    +GV L F PTVL    I 
Sbjct: 265 RTLAEPNLTTLSGQEASFLAGGEYPIP-VADGDGGISVEYKPFGVELDFIPTVLDDDVIN 323

Query: 330 LRIQTEV----SEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGI 385
           L +   V    S   I  ++  +  +  R+  TTV+L  G +  +AGLL+DD +     +
Sbjct: 324 LELGAAVSALDSSASIITDSLTVQGFSRRETLTTVQLRDGDSFAIAGLLEDDFRDFAGQV 383

Query: 386 PLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           P L  IP+LGALFR++ + R ++E+ I  T  LV P     L  P D   +  + + F  
Sbjct: 384 PWLGDIPVLGALFRSADYARSQSELVIIVTAHLVSPTRGEALVLPTDRVRIPSEREFFLN 443

Query: 446 NRVNKIYGPKE--ASEVEGQNYKGAIGFIYK 474
             + +   P+   A EV  Q++ G+ G++ +
Sbjct: 444 GNLVREDTPRRGAAGEVAQQDFSGSYGYVLE 474


>gi|126733573|ref|ZP_01749320.1| bacterial type II/III secretion system protein [Roseobacter sp.
           CCS2]
 gi|126716439|gb|EBA13303.1| bacterial type II/III secretion system protein [Roseobacter sp.
           CCS2]
          Length = 476

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 139/453 (30%), Positives = 224/453 (49%), Gaps = 51/453 (11%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +S+ +++ ++++  V   ++ +++P  AD+   S RT+Y+ GK  G+  + L+G +G+ +
Sbjct: 42  LSVPMSRAVVVESDVPFTELSIANPGIADISSLSDRTIYVLGKEPGRTTLTLLGENGRLI 101

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            N++I +  D+A  +  L + +   NI V   +D +VL G V +I    RA++L+E +  
Sbjct: 102 TNVEIHVSPDMAEFKERLTQILPGENIEVRTANDGIVLSGTVSSIARLDRALDLAERY-- 159

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDI---------LKQIGF----- 215
                     + ++V NL+ + G  QV LKV  AE++R +         L  +GF     
Sbjct: 160 ----------APERVSNLMMVGGTQQVMLKVRFAEMQRSVSKALSTSVALSGLGFDDDVS 209

Query: 216 ----------QHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
                     Q +I G+ SG      A+ G      G      G+L        L ALE 
Sbjct: 210 ITGGTNRTIGQSAINGALSGSVPGSNANNGAVLFGFGAGGLEVGIL--------LEALET 261

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
              +R+LAEP LTA+SGQ A+F +GG++   T +   G  SV    +GV L F P V+  
Sbjct: 262 RGVVRSLAEPNLTALSGQEATFLAGGEYPVPTANDG-GTISVEFRPFGVELSFVPRVVDH 320

Query: 326 GRIGLRIQTEVS--EPVIG--VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
             I L +   VS  +P  G   N   + ++  R+  TTVE+  G +  +AGLL DD   L
Sbjct: 321 DIINLELSAAVSAIDPSNGFQANGFSVDAFTRRETSTTVEMRDGESFAIAGLLSDDFTDL 380

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
              +P +  IP+LGALFR++ + R +TE+ I  TP LV P     L+ P D      +  
Sbjct: 381 NGQLPWVGDIPVLGALFRSAEYARRQTELVIIVTPHLVSPTRGEALALPTDRVRPPTEQG 440

Query: 442 AFFFNRVNKIYGPKE--ASEVEGQNYKGAIGFI 472
            F F +V    GP    A EV  Q++ G+ G++
Sbjct: 441 LFLFGQVANEGGPSSGGAGEVARQDFSGSYGYV 473


>gi|84501676|ref|ZP_00999848.1| bacterial type II/III secretion system protein [Oceanicola
           batsensis HTCC2597]
 gi|84390297|gb|EAQ02856.1| bacterial type II/III secretion system protein [Oceanicola
           batsensis HTCC2597]
          Length = 474

 Score =  200 bits (509), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 144/509 (28%), Positives = 243/509 (47%), Gaps = 77/509 (15%)

Query: 7   TFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDV 66
           T+ + +   LF    +    P   +A    I    V      ++++ +N+ ++++  V  
Sbjct: 2   TYSSYLRAALFGMTLATGSFPVTAQAERLTI----VNRNSESRLNVAINRAVVVESDVSF 57

Query: 67  QDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMT 126
            ++ +++P  AD+   S  ++Y+ GK  G   + L+  +G+ + N+D+++  DI+  +  
Sbjct: 58  AELSIANPQIADISSLSDTSIYVLGKTPGITTLTLLDAEGRLISNVDVVVSADISEFKER 117

Query: 127 LRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMN 186
           LR+ + D  I V   +D +V+ G+V + Q  QRA++L+E +            + ++V N
Sbjct: 118 LRQILPDEKIEVRTANDGIVMSGVVSSSQKLQRALDLAERY------------APERVSN 165

Query: 187 LLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFS 246
           L+++ G  QV LKV  AE++R + K +             S S AAD G  F   GG+  
Sbjct: 166 LMSVGGVQQVMLKVRFAEMQRSVSKSL-------------SASLAAD-GSIF---GGNVG 208

Query: 247 VKGVLDRFSFE---------------------------------TVLHALERATAIRTLA 273
           V G   R+S                                    +L ALE    +RTLA
Sbjct: 209 VSGGTGRYSNAGNQGNGLGGNLPTPNTNSGATLLGFNAGAVQVGVLLEALEAKGVVRTLA 268

Query: 274 EPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQ 333
           EP LTA+SGQ A F +GG++    V+   G  +V    +GV ++F P V+    I L +Q
Sbjct: 269 EPNLTALSGQEAKFLAGGEYPVP-VAQDGGTVTVEFKPFGVEMNFIPRVVDDDIINLELQ 327

Query: 334 TEVS--EPVIG--VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLS 389
             VS  +P  G  +NA  + ++  R+  TTVEL  G +  +AGLL+DD +     +P L 
Sbjct: 328 AAVSAIDPNNGFELNAFRIDAFTRRETSTTVELRDGDSFAVAGLLQDDFRDTNSQVPWLG 387

Query: 390 KIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR-- 447
            IP++GALFR++ + R ++E+ I  T  LV P     L+ P D      +   F F R  
Sbjct: 388 DIPVIGALFRSADYQRNQSELVIIITAHLVSPTRGEALALPTDRVKPPSEKDLFLFGRTA 447

Query: 448 --VNKIYGPKEASEVEGQNYKGAIGFIYK 474
               K+ G   A EV  Q++ G+ G++ +
Sbjct: 448 KDTRKLRGA--AKEVAKQDFNGSYGYVME 474


>gi|302037439|ref|YP_003797761.1| putative pilus assembly protein CpaC [Candidatus Nitrospira
           defluvii]
 gi|300605503|emb|CBK41836.1| putative Pilus assembly protein CpaC [Candidatus Nitrospira
           defluvii]
          Length = 485

 Score =  200 bits (508), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 135/440 (30%), Positives = 216/440 (49%), Gaps = 35/440 (7%)

Query: 32  ANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFG 91
           A A  +   D++    + +S+   K ++L  P+      +++P  AD +V SP+ +Y+ G
Sbjct: 28  AQAHEVASPDIQTRVPRSLSLITGKSLVLDSPIPFSRASIANPDIADTLVLSPKQLYVIG 87

Query: 92  KNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSN-IRVEMVSDTVVLHGM 150
           K  G  N+ L   +G      D+ +  D+  L+  L +   D N ++V    D + L G 
Sbjct: 88  KAAGTTNLTLWDAEGSVYALYDLAVSPDLTRLKEHLHQLFPDENDLQVMAAHDRLTLTGT 147

Query: 151 VRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDIL 210
           V +      AV+++ET+  Q            KV+NLL + G  QV L+V +AE+ R +L
Sbjct: 148 VSSATHVSEAVDVAETYARQ------------KVINLLRVGGLHQVMLEVRVAEMERTLL 195

Query: 211 KQIGFQHSIT--GSSSG---------------PSKSFAADFGGKFVSEGGDFSVKGVLDR 253
           +++G   +    G S G               PS +  A   G  VS+  +  ++     
Sbjct: 196 RRLGVNLAAASGGQSFGVSSLKNLATVLPPTDPSAALVAGPVGLGVSQAVNALLRFQTGS 255

Query: 254 FSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYG 313
            S+   + AL+    ++ LAEPTL A+SGQ A F +GG+     V  + G T++    +G
Sbjct: 256 TSWTGFIDALKEENLVKVLAEPTLVALSGQEAHFLAGGEFPIP-VPQAFGVTTIQFKKFG 314

Query: 314 VVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIV 369
           + L+F P VLSP RI + +  EVS+      + +    +P+   R+A T VEL  G +  
Sbjct: 315 IQLNFNPVVLSPTRISVTVAPEVSDLDFANGLSLQGFVVPAITTRRASTVVELEDGQSFA 374

Query: 370 LAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSR 429
           +AGLL+D +++     P+L  IPILGALFR+S F + ETE+ I  TP LV PV   +L  
Sbjct: 375 VAGLLRDTVRETVSKFPVLGDIPILGALFRSSSFQKNETELVIIVTPHLVTPVTEAELPL 434

Query: 430 PDDHYSVEDDAKAFFFNRVN 449
           P   Y   DD   +   R+ 
Sbjct: 435 PTGQYLEPDDVDFYLMGRLQ 454


>gi|294012433|ref|YP_003545893.1| Flp pilus assembly protein secretin CpaC [Sphingobium japonicum
           UT26S]
 gi|292675763|dbj|BAI97281.1| Flp pilus assembly protein secretin CpaC [Sphingobium japonicum
           UT26S]
          Length = 499

 Score =  199 bits (507), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 142/435 (32%), Positives = 227/435 (52%), Gaps = 34/435 (7%)

Query: 28  PIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTM 87
           P    NAA  ++ D  I     +S+G +KVI L  P  + DV++ DP   DV V S   +
Sbjct: 31  PTSALNAAPASMQDNAI----LLSVGGSKVINL--PAKMSDVVIGDPDVVDVHVRSQNQL 84

Query: 88  YLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVL 147
           YL  K  G+  V     +GK + +  + +  ++  ++  L+  + +++I V  ++  V+L
Sbjct: 85  YLIAKKAGETTVFATATNGKVLFSGTVRVGNNLTSIDDMLKLAMPNADIAVNKMNGMVLL 144

Query: 148 HGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRR 207
            G +   +D+  A  L++ F+ +             V++ L  A   QV L+V IAEV R
Sbjct: 145 TGTIAAPEDAAEAERLTQAFVGKE----------VTVVSRLRTATPLQVNLQVKIAEVSR 194

Query: 208 DILKQIGFQH-----------SITGSSSGPSKSFAADFGG--KFVSEGGDFSVKGVLDRF 254
           D+  +IG                 G  +  + +F +  GG   F ++GG +S+ GV    
Sbjct: 195 DVGHKIGMNWKSQDLTGGKWAGGIGGGTRDAITFNSGGGGTFNFTADGG-YSLGGVARVL 253

Query: 255 SFE--TVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDY 312
             +   VL   E +    TLA+P LT++SG++ASF +GG++ Y TVS+ T   S+    Y
Sbjct: 254 GLDIGAVLDLAESSGLATTLAQPNLTSLSGETASFLAGGEYPY-TVSNGTQGNSIEFKQY 312

Query: 313 GVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAG 372
           GV L FTPTVL+ GRI LR++  VS     V++  +P+ R R A+TTVEL SG   ++AG
Sbjct: 313 GVQLAFTPTVLADGRISLRVRPTVSSLDFSVDS-SVPALRSRTAETTVELGSGQAFMIAG 371

Query: 373 LLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDD 432
           LL +D       +P +  +PILG+LF++  F R ETE+ I  TP+LVKP+   D+  P D
Sbjct: 372 LLNNDTANSISKVPGIGNLPILGSLFKSRNFQRHETELVIVVTPYLVKPMNASDVRLPTD 431

Query: 433 HYSVEDDAKAFFFNR 447
            +   ++ +  F  +
Sbjct: 432 GFRNANEGQGLFLQQ 446


>gi|83950066|ref|ZP_00958799.1| bacterial type II/III secretion system protein [Roseovarius
           nubinhibens ISM]
 gi|83837965|gb|EAP77261.1| bacterial type II/III secretion system protein [Roseovarius
           nubinhibens ISM]
          Length = 429

 Score =  199 bits (505), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 139/447 (31%), Positives = 225/447 (50%), Gaps = 48/447 (10%)

Query: 54  LNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLD 113
           +N+ I+++  V   ++ V++ + AD    S RT+YL GK  G+  + L+   G+ + N++
Sbjct: 1   MNRAIVVESDVPFAELSVANASIADFSTLSDRTIYLLGKAPGRTTLTLLDEAGRLITNVE 60

Query: 114 ILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGR 173
           I +  DI+  +  LR+ + +  I V   +D +VL G+V +    QRA++L++ +      
Sbjct: 61  IHVSADISEFKERLRQILPNEKIEVRTANDGIVLSGVVSSTPRMQRALDLAQRY------ 114

Query: 174 NQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAAD 233
                 + ++V NL++++G+ QV LKV  AE++R + K +G    I G S+       A 
Sbjct: 115 ------APERVSNLMSVSGKQQVMLKVRFAEMQRSVSKSLGTSLFIDGLSN-------AG 161

Query: 234 FGGKFVSEGGDFSVK------------GVLDRFSF----------ETVLHALERATAIRT 271
            GG   + G   S +            G  +  +F            ++ ALE    +RT
Sbjct: 162 IGGAISTNGIGSSAQTPVGVQPGTGTAGTNNGAAFIGLNAGSAQVGILIQALESKGLVRT 221

Query: 272 LAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           LAEP LTA+SGQ A+F +GG++    V+   GA +V    +GV L+F P VL    I L 
Sbjct: 222 LAEPNLTALSGQEANFLAGGEYPIP-VAQEEGAIAVEFKPFGVQLNFVPYVLDDEVINLE 280

Query: 332 IQTEVS--EPVIGVNAGDM--PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           I   VS  +P  G + G +    +R R   TTV L  G +  +AGLL+DD +     +P 
Sbjct: 281 IAAAVSSIDPSNGYSDGTITIAGFRTRSTSTTVSLRDGDSFAIAGLLQDDFEDTNGQVPW 340

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR 447
           L  +PILGALFR++ + R +TE+ I  T  LV P     L+ P D      +A  F   R
Sbjct: 341 LGDLPILGALFRSANYQRSQTELVIIVTAHLVTPTRGEALALPTDRVLPPSEADLFLNGR 400

Query: 448 VNKIYGPKEAS--EVEGQNYKGAIGFI 472
           V +     + S  EV  Q++ G+ G++
Sbjct: 401 VARQVRNSKGSVGEVAKQDFNGSYGYV 427


>gi|89068017|ref|ZP_01155434.1| Outer membrane general secretion pathway protein, Secretin
           [Oceanicola granulosus HTCC2516]
 gi|89046256|gb|EAR52313.1| Outer membrane general secretion pathway protein, Secretin
           [Oceanicola granulosus HTCC2516]
          Length = 482

 Score =  198 bits (504), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 137/459 (29%), Positives = 226/459 (49%), Gaps = 51/459 (11%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           + + + +N+ ++++      +V +++P  AD+   S RT+Y+ GK  G+  + L+G DG+
Sbjct: 39  RALQVPMNRAVVVESDTPFTEVSIANPGIADISTLSDRTLYVLGKEPGRTTLTLLGADGR 98

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
            + N+++ +  DI   +  L + +   +I V   ++ +VL G V +I    RA+EL++ +
Sbjct: 99  LITNVEVQVTPDIDEFKERLAQILPGEHIEVRTAANGIVLSGTVSSIARLDRALELAQRY 158

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
                       +  +V NL+ + G  QV LKV  AE++R + K +    +  G++ G +
Sbjct: 159 ------------APDRVSNLMTVGGVQQVMLKVRFAEMQRSVSKSLSSSLTARGTALGEN 206

Query: 228 KSFAADFG-------------GKFVSEGGD-------FSVKGVLDRFSFETVLHALERAT 267
               A  G             G   +   +       F+  GV        +L ALE   
Sbjct: 207 LGLTAGTGTLTGNGAIGSALNGNVPAANANNGALLLGFNAGGV----EIGMLLEALESRG 262

Query: 268 AIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGR 327
            +RTLAEP LTA+SGQ A F +GG++    VS   G+ S+    +GV L+F P V+    
Sbjct: 263 VVRTLAEPNLTALSGQEARFLAGGEYPVP-VSQDGGSISIEYKPFGVELNFIPRVVDGDL 321

Query: 328 IGLRIQTEVS--EPVIGVNAG--DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKE 383
           I L +Q  VS  +P  G   G   + ++R R+  TTVE+  G +  +AGLL DD   L  
Sbjct: 322 INLELQASVSSIDPTNGFVQGGFSIDAFRRRETSTTVEMRDGESFAIAGLLSDDFIDLNS 381

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
            +P +  IP+LGALFR++ + R +TE+ I  TP LV P     L+ P D      +   F
Sbjct: 382 QLPFVGDIPVLGALFRSAEYERNQTELVIIVTPHLVTPTRGEALALPTDRVRPPSERDLF 441

Query: 444 FFNRVNKIYG--------PKE--ASEVEGQNYKGAIGFI 472
            F RV    G        P+   A+EV  Q++ G+ G++
Sbjct: 442 LFGRVTAPDGSPIPSSSAPQSGAAAEVARQDFSGSYGYV 480


>gi|224824213|ref|ZP_03697321.1| type II and III secretion system protein [Lutiella nitroferrum
           2002]
 gi|224603632|gb|EEG09807.1| type II and III secretion system protein [Lutiella nitroferrum
           2002]
          Length = 520

 Score =  198 bits (503), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 131/387 (33%), Positives = 211/387 (54%), Gaps = 33/387 (8%)

Query: 78  DVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIAD--SN 135
           DV++ SP  +YL GK+VG  N+IL+G +G+  L +D+ +  D A L+ +L + ++   +N
Sbjct: 119 DVILLSPSEIYLLGKSVGSTNIILLGRNGQCTL-VDVAVGADTASLQASLNQLLSPGANN 177

Query: 136 IRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQ 195
           ++V   SD++VL G V       RA+ L+E +  +S           KV+N++++    Q
Sbjct: 178 VKVSAASDSLVLTGTVADSAKLDRAMTLAEAYAGKS-----------KVINMMSVDAPQQ 226

Query: 196 VTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFS 255
           V L+V IAE+ + +L ++G   +   +  G + S+ + F    +   G   + G+ D  +
Sbjct: 227 VLLEVKIAEISKKLLDKLGVNIAGILNHGGWTYSWNSLFANDPL---GKALLSGINDSAT 283

Query: 256 FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST--GATSVTTHD-- 311
               + A      ++ LAEP L AISGQ  SF +GG+       ++T  G +++T  +  
Sbjct: 284 RAFQIDAQHDDGLLKVLAEPNLMAISGQEGSFLAGGKIFIPVAQNNTNNGGSTITLEEKE 343

Query: 312 YGVVLHFTPTVLSPGRIGLRIQTEVSE--------PVIGVNAGD--MPSYRVRKADTTVE 361
           +GV L FTPTVL  GRI L++  EVSE          IGV AG   +PS+  R+A TTV+
Sbjct: 344 FGVALRFTPTVLDGGRINLKVAPEVSELNPEGVGISAIGV-AGKSILPSFTTRRAATTVQ 402

Query: 362 LPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
           L  G +  + GLLK+++       P L +IPILGALFR++ F  +++E+    TP LVKP
Sbjct: 403 LHDGQSFAIGGLLKNNVTTNISAFPFLGEIPILGALFRSTSFQTDKSELVFVVTPRLVKP 462

Query: 422 VAMRDLSRPDDHYSVEDDAKAFFFNRV 448
           +   D   P D+Y   + A+ F   R+
Sbjct: 463 LP-PDYKLPTDNYIPPNRAELFLGGRM 488


>gi|84516633|ref|ZP_01003992.1| Outer membrane general secretion pathway protein, Secretin
           [Loktanella vestfoldensis SKA53]
 gi|84509669|gb|EAQ06127.1| Outer membrane general secretion pathway protein, Secretin
           [Loktanella vestfoldensis SKA53]
          Length = 476

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 138/455 (30%), Positives = 225/455 (49%), Gaps = 51/455 (11%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
             + + +N+ ++++  V   ++ +++P  AD+   S RT+Y+ GK  G+  + L+  DG+
Sbjct: 40  NALDVPMNRAVVVESDVPFTELSIANPGIADISSLSDRTIYVLGKEPGRTTLTLLSADGR 99

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
            + N+++ +  D+A  +  L + +   NI V   +D +VL G V +     RA++L++ +
Sbjct: 100 LITNVEVHVSPDMAEFKERLTQILPGENIEVRTANDGIVLSGTVSSTARLDRALDLAQRY 159

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDIL----------------- 210
                       +  +V NL+++ G  QV LKV  AE++R +                  
Sbjct: 160 ------------APDRVSNLMSVGGTQQVMLKVRFAEMQRSVSKALSSSLSLNGTSLQNG 207

Query: 211 KQIGFQHSITGSSSGPSKSF------AADFGGKFVSEGGDFSVK-GVLDRFSFETVLHAL 263
           + I    + T   +G + +       A D  G F+   G   V+ GVL        L AL
Sbjct: 208 RNIRGGSNTTVGQAGITNTLNNIVPTANDNNGAFLFGFGAGGVEVGVL--------LEAL 259

Query: 264 ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVL 323
           E    +R+LAEP LTA+SGQ A+F +GG++    VSS  GA SV    +GV L+FTP V+
Sbjct: 260 ESRGVVRSLAEPNLTALSGQQATFLAGGEYPVP-VSSEDGAISVEYKPFGVELNFTPRVV 318

Query: 324 SPGRIGLRIQTEVS--EPV--IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQ 379
               I L +   VS  +P      N  ++ ++  R+  TTVE+  G +  +AGLL DD  
Sbjct: 319 DGDVINLELLAAVSAIDPSNSFSANGFEISAFSRRETSTTVEMRDGESFAIAGLLSDDFT 378

Query: 380 QLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDD 439
            L   +P +  +PILGALFR++ + R +TE+ I  TP LV P     L+ P D      +
Sbjct: 379 DLSGQVPWIGDVPILGALFRSAEYARRQTELVIIVTPHLVSPTRGTALALPTDRVRPPSE 438

Query: 440 AKAFFFNRVNKIYGPKE--ASEVEGQNYKGAIGFI 472
              F F RV     P    A EV  Q++ G+ G++
Sbjct: 439 QDLFLFGRVTAASAPTRGGAGEVARQDFMGSYGYV 473


>gi|294676059|ref|YP_003576674.1| type II and III secretion system protein [Rhodobacter capsulatus SB
           1003]
 gi|294474879|gb|ADE84267.1| type II and III secretion system protein [Rhodobacter capsulatus SB
           1003]
          Length = 469

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 128/448 (28%), Positives = 221/448 (49%), Gaps = 41/448 (9%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++ +N+ ++++      ++ +++P  ADV   S +T+Y+ GK  G+  + ++G DG  +
Sbjct: 40  LAVPMNRAVVVESDQPFSELSIANPGIADVTTLSDKTIYVLGKVPGRTTMTILGADGTLL 99

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            N+++ +  DIA  +  L++ +   NI V   +D +VL G V +     RA++L+  +  
Sbjct: 100 SNVEVQVTPDIAEFKERLKQILPGENIEVRTANDGIVLSGTVSSSAKLDRALDLARRY-- 157

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQ----------IGFQHSI 219
                     + ++V NL+N+ G  QV LKV  AE++R + K           +G  ++ 
Sbjct: 158 ----------AGERVSNLMNVGGTQQVMLKVRFAEMQRSVSKNLASSLAMRGTVGGGNAQ 207

Query: 220 TGSSSGPSKSFAADFGGKFVSEG---------GDFSVKGVLDRFSFETVLHALERATAIR 270
           TG  +G     A D  G    +G         G   +   +    F  +L ALE    +R
Sbjct: 208 TGVITGTGNFTATDAVGNAFDKGTMPISASTQGALGLGFTVGNMEFGVLLEALESKGMVR 267

Query: 271 TLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGL 330
           TLAEP LTA+SGQ A F +GG++    V       ++    +GV + F P V+    I L
Sbjct: 268 TLAEPNLTALSGQQAKFLAGGEYPIPVVDDD--GITIEYKPFGVEMSFIPRVVDGDLINL 325

Query: 331 RIQTEVSEPVIGV----NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
            I   VS     V    N   + +++ R+  TTVE+  G +  +AGLL+DD   L   IP
Sbjct: 326 EIAAAVSAIDTSVTMTNNGTTVNAFKRRETSTTVEMRDGESFAIAGLLQDDFNDLNTQIP 385

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
            L  +P+LG+LFR++ F R+++E+ I  TP LV P     L+ P D   +  +++ F   
Sbjct: 386 WLGDVPVLGSLFRSTAFERKQSELVIIITPHLVTPTHGEALALPTDRIRLPSESELFLRG 445

Query: 447 RVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           +         A EV  Q++ G+ G++ +
Sbjct: 446 KTEG----GAAGEVARQDFSGSYGYVME 469


>gi|330953268|gb|EGH53528.1| type III secretion component [Pseudomonas syringae Cit 7]
          Length = 438

 Score =  197 bits (500), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 137/412 (33%), Positives = 210/412 (50%), Gaps = 28/412 (6%)

Query: 44  IGKGKK----ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANV 99
           I KG K    ++IG  +V+    PVD   V+V++P  AD+ V SP  +Y+FGK  GQ ++
Sbjct: 29  IAKGAKGTVDLAIGEGRVLHFSAPVD--SVMVAEPGIADLQVVSPGVIYVFGKTAGQTSL 86

Query: 100 ILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQR 159
           I +  +G++   L + +    A +   L+     S  R+      V+  G V   QD   
Sbjct: 87  IALDSEGRETATLSLAVSSGTAAVSRPLKALHPQSQARINASGSRVIASGAV---QDVGE 143

Query: 160 AVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
           A +L+   LS  G+N       +  +N    AG  QV ++V  AEV R  L + G   + 
Sbjct: 144 ATDLN-ALLSTEGQN------FQSTVNSATYAGSAQVNIRVRFAEVSRSELLRYGVNWNA 196

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGD-----FSVKGVLDRFSFETVLHALERATAIRTLAE 274
             ++   + SF    GG   ++         S        + + +L AL+    +  LAE
Sbjct: 197 LFNNG--TFSFGLLTGGSLAADAASGASNVISAGLTSGNVNIDAMLEALQNNGVLEVLAE 254

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           P +TA++GQ+ASF +GG+ +   V  +     +    YGV L F+PT+L  GRI L+++ 
Sbjct: 255 PNITAMTGQTASFLAGGE-VAVPVPVNREVVGIEYKPYGVSLLFSPTLLPNGRIALQVRP 313

Query: 335 EVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSK 390
           EVS       + VN   +PS+RVR+ADT VE+ SG T  +AGL + +  Q  + +P+L  
Sbjct: 314 EVSSLMSTTTLDVNGYQVPSFRVRRADTRVEVGSGQTFAIAGLFQRESSQDMDKVPMLGD 373

Query: 391 IPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
           +PILG+LFR+ RF R ETE+ I  TP+LV+PV  R  + P D       A A
Sbjct: 374 MPILGSLFRSKRFQRNETELVILITPYLVEPVKERVAATPLDKQRAASTAAA 425


>gi|163738370|ref|ZP_02145785.1| bacterial type II/III secretion system protein [Phaeobacter
           gallaeciensis BS107]
 gi|161388291|gb|EDQ12645.1| bacterial type II/III secretion system protein [Phaeobacter
           gallaeciensis BS107]
          Length = 484

 Score =  196 bits (497), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 133/459 (28%), Positives = 234/459 (50%), Gaps = 53/459 (11%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
           V+ G    + + +N+ ++++  V   ++ +++P+ AD+   S RT+Y+ GK+ G   + L
Sbjct: 49  VKKGTAANLEVPMNRAVVVESDVPFSELSIANPSIADISSLSDRTIYVLGKSPGLTTLTL 108

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           +   G+ + N+D+ +  D++  +  LR+ +    I V   +D +VL G+V +    QRA+
Sbjct: 109 LDASGRLITNVDVRVAADVSEFKERLRQILPGEKIEVRTANDGIVLSGVVSSSARLQRAL 168

Query: 162 ELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF------ 215
           +L+E +            + ++V NL+++ G  QV LKV  AE++R + K +        
Sbjct: 169 DLAERY------------APERVSNLMSVGGVQQVMLKVRFAEMQRTVSKSLSASLGVKG 216

Query: 216 ---------------QHSITGSSSG--PSKSFAADFGGKFVSEGGDFSVKGVLDRFSFET 258
                          Q ++T S SG  P+ +   D  G FV     F        F    
Sbjct: 217 GNSVGVNGGTSTLNTQGALTNSLSGNIPAGN---DNTGAFV-----FGFNA--GAFQVNL 266

Query: 259 VLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHF 318
           +L ALE+   +RTLAEP L+A+SGQ A F +GG++    V+   G  ++    +G+ L+F
Sbjct: 267 LLEALEQKGVVRTLAEPNLSALSGQEAKFLAGGEYPIP-VAQEDGIITIEFKPFGIELNF 325

Query: 319 TPTVLSPGRIGLRIQTEVS--EPV--IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLL 374
            P V+    I L ++  VS  +P   I +N   + ++  R+  TTVEL  G +  +AGL+
Sbjct: 326 VPRVVDADVINLEMKAAVSAIDPTNSIELNGLSIAAFSRRETSTTVELRDGESFAIAGLI 385

Query: 375 KDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHY 434
           +D+ +     +P +  +P+LG+LFR++ + R +TE+ I  +  LV P     LS P D  
Sbjct: 386 RDEFRDSSSQLPWIGDVPVLGSLFRSANYQRAQTELVIIVSAHLVTPTRGEALSLPTDRI 445

Query: 435 SVEDDAKAFFFNRVNK-IYGPKEASEVEGQNYKGAIGFI 472
               +++ F   RV K   GP  ASEV  Q++ G+ G++
Sbjct: 446 RPPSESELFLMGRVAKGQKGP--ASEVAKQDFNGSYGYV 482


>gi|163742213|ref|ZP_02149601.1| bacterial type II/III secretion system protein [Phaeobacter
           gallaeciensis 2.10]
 gi|161384543|gb|EDQ08924.1| bacterial type II/III secretion system protein [Phaeobacter
           gallaeciensis 2.10]
          Length = 484

 Score =  196 bits (497), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 132/457 (28%), Positives = 234/457 (51%), Gaps = 49/457 (10%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
           V+ G    + + +N+ ++++  V   ++ +++P+ AD+   S RT+Y+ GK+ G   + L
Sbjct: 49  VKKGTAANLEVPMNRAVVVESDVPFSELSIANPSIADISSLSDRTIYVLGKSPGLTTLTL 108

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           +   G+ + N+D+ +  D++  +  LR+ +    I V   +D +VL G+V +    QRA+
Sbjct: 109 LDASGRLITNVDVRVAADVSEFKERLRQILPGEKIEVRTANDGIVLSGVVSSSARLQRAL 168

Query: 162 ELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF------ 215
           +L+E +            + ++V NL+++ G  QV LKV  AE++R + K +        
Sbjct: 169 DLAERY------------APERVSNLMSVGGVQQVMLKVRFAEMQRTVSKSLSASLGVKG 216

Query: 216 ---------------QHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVL 260
                          Q ++T S SG   + A D  G FV     F        F    +L
Sbjct: 217 GNSVGVNGGTSTLNTQGALTNSLSGNIPA-ANDNTGAFV-----FGFNA--GAFQVNLLL 268

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
            ALE+   +RTLAEP L+A+SGQ A F +GG++    V+   G  ++    +G+ L+F P
Sbjct: 269 EALEQKGVVRTLAEPNLSALSGQEAKFLAGGEYPIP-VAQEDGVITIEFKPFGIELNFIP 327

Query: 321 TVLSPGRIGLRIQTEVS--EPV--IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD 376
            V+    I L ++  VS  +P   I +N   + ++  R++ TTVE+  G +  +AGL++D
Sbjct: 328 RVVDADVINLEMKAAVSAIDPTNSIELNGLSIAAFSRRESVTTVEMRDGESFAIAGLIRD 387

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSV 436
           + +     +P +  +P+LG+LFR++ + R +TE+ I  +  LV P     LS P D    
Sbjct: 388 EFRDNSSQLPWIGDVPVLGSLFRSANYQRAQTELVIIVSAHLVTPTRGEALSLPTDRIRP 447

Query: 437 EDDAKAFFFNRVNK-IYGPKEASEVEGQNYKGAIGFI 472
             +++ F   RV K   GP  ASEV  Q++ G+ G++
Sbjct: 448 PSESELFLMGRVAKGQKGP--ASEVAKQDFNGSYGYV 482


>gi|126729098|ref|ZP_01744912.1| bacterial type II/III secretion system protein [Sagittula stellata
           E-37]
 gi|126710088|gb|EBA09140.1| bacterial type II/III secretion system protein [Sagittula stellata
           E-37]
          Length = 473

 Score =  194 bits (493), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 143/481 (29%), Positives = 242/481 (50%), Gaps = 58/481 (12%)

Query: 23  VAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVH 82
           +A + P   A++    I  V  G    +S+ +N+ ++++      ++ +++P+ AD+   
Sbjct: 18  IATMSPPAHADS----IRVVRTGTESVLSVPMNRAVVVESDTPFAELSIANPSIADISSL 73

Query: 83  SPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVS 142
           S RT+Y+ GK  G   + ++   G+ + N+D+ +  D+   +  L + + +  I V   +
Sbjct: 74  SDRTIYVLGKQPGTTTLTILDPQGQLITNVDVRVAADVTEFKERLTQILPEERIEVRTAN 133

Query: 143 DTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTI 202
           D +VL G V +I   +RA++L++ +            +  +V NL+ + G  QV LKV  
Sbjct: 134 DGIVLSGTVSSIARMERALDLAQRY------------APDRVSNLMVVGGIQQVMLKVRF 181

Query: 203 AEVRRDILKQIGFQHSITGSSSG--------------PSKSFAAD--FGGKFVSEGG--- 243
           AE+RR + K +    + TG S+G                +   AD  F  +  +EG    
Sbjct: 182 AEMRRSVSKALRASLA-TGGSTGDLGVELGTGNAGTLAERDLVADKLFPRRLGTEGAVLF 240

Query: 244 DFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTG 303
            F+  G         +L ALE    +RTLAEP LTA+SGQ ASF +GG++    V ++ G
Sbjct: 241 GFNAGG----LEVGILLEALESKGMVRTLAEPNLTALSGQEASFLAGGEY---PVPTAQG 293

Query: 304 ATSVTTH--DYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGVNAGD--MPSYRVRKAD 357
             SVT     +GV L F P V+    I L ++  VS  +   G+   D  +  +  R+A 
Sbjct: 294 DNSVTVEFKPFGVELAFVPRVIDGDLINLELEAAVSSVDSANGITFQDVTIAGFARREAK 353

Query: 358 TTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPF 417
           TTVEL  G +  +AGLL+++   L   +P +  +PILGALFR++ + RE++E+ I  TP 
Sbjct: 354 TTVELRDGESFAIAGLLQENFADLNGQVPWIGDVPILGALFRSTEYQREQSELVIIVTPH 413

Query: 418 LVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYG----PKE--ASEVEGQNYKGAIGF 471
           LV P     L+ P D  ++  + +  F N   KI G    P+   A+EV  Q++ G+ G+
Sbjct: 414 LVTPTRGEALALPTDRVTLPSE-RQLFLN--GKIDGNGRRPRSGAAAEVANQDFNGSYGY 470

Query: 472 I 472
           +
Sbjct: 471 V 471


>gi|259417373|ref|ZP_05741292.1| type II and III secretion system protein [Silicibacter sp.
           TrichCH4B]
 gi|259346279|gb|EEW58093.1| type II and III secretion system protein [Silicibacter sp.
           TrichCH4B]
          Length = 442

 Score =  194 bits (492), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 134/455 (29%), Positives = 227/455 (49%), Gaps = 40/455 (8%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQAN 98
           IS ++ G    + + +N+ ++++  V   ++ +++P  AD+   S RT+Y+ GK+ G   
Sbjct: 5   ISVLKKGTNAVLDVPMNRAVVVEADVPFAELSIANPGIADISSLSDRTIYVLGKSPGMTT 64

Query: 99  VILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQ 158
           + L+   G  + N+D+ +  D++  +  L++ + +  I V   +D +VL G V + Q  Q
Sbjct: 65  LTLLDGSGGLITNVDVRVAADVSEFKQRLQQILPNEKIEVRTANDGIVLSGTVSSAQRLQ 124

Query: 159 RAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
           RA++L+E +            +  +V NL+ + G  QV LKV  AE+ R + K +G    
Sbjct: 125 RALDLAERY------------APDRVSNLMTVGGIQQVMLKVRFAEMERSVSKSLGGSML 172

Query: 219 ITGSSSG--PSKSFA--ADFGGKFVSEGGDFSVKGVLDRFS------------FETVLHA 262
           I GSS G   + +F    + GG F   G D  V    D               F  +L A
Sbjct: 173 I-GSSDGNVSTGTFLNRPEGGGVF---GTDSPVNLKADTLGAAIFGFDIGAVQFNVLLEA 228

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTV 322
           LE+   +RTLAEP L+A+SGQ ASF +GG++    V+   G  +V    +G+ L+F P V
Sbjct: 229 LEQKGLVRTLAEPNLSALSGQEASFLAGGEYPVP-VAQEEGVVTVEFKPFGIELNFIPRV 287

Query: 323 LSPGRIGLRIQTEVSEPVIGVNAGDMPSYRV-----RKADTTVELPSGGTIVLAGLLKDD 377
           +    I L ++  VS  +   NA     + +     R+  TTVEL  G +  +AGL++D+
Sbjct: 288 VDGDLINLELKAAVS-AIDTTNAATFDGFSINAFSRRETATTVELRDGESFAIAGLIEDE 346

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
            +     +P L  +P+LGALFR++ + R ++E+ I  +  LV P     L+ P D     
Sbjct: 347 FRDGAAQVPWLGDVPVLGALFRSADYERNQSELVIIVSAHLVTPTRGEALALPTDRIRPP 406

Query: 438 DDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
            +   F F R  +      A EV  Q++ G+ G++
Sbjct: 407 SEKNLFLFGRTERAQS-GAAGEVANQDFNGSYGYL 440


>gi|86137993|ref|ZP_01056569.1| bacterial type II/III secretion system protein [Roseobacter sp.
           MED193]
 gi|85825585|gb|EAQ45784.1| bacterial type II/III secretion system protein [Roseobacter sp.
           MED193]
          Length = 459

 Score =  194 bits (492), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 130/448 (29%), Positives = 229/448 (51%), Gaps = 34/448 (7%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
           V+ G    + + +N+ ++++      ++ +++P  AD+   S RT+Y+ GK+ G   + L
Sbjct: 27  VKRGTSVTLDVPMNRAVVVESDDPFAELSIANPNIADISSLSDRTIYVLGKSPGLTTLTL 86

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           +   GK + N+++ +  D++  +  LR+ +    I V   +D +VL G V +    QRA+
Sbjct: 87  LDASGKLITNVNVRVAADVSEFKERLRQILPGEQIEVRTANDGIVLSGNVSSAARLQRAL 146

Query: 162 ELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI-- 219
           +L+E +            + ++V NL+++ G  QV LKV  AE++R + K +    ++  
Sbjct: 147 DLAERY------------APERVSNLMSVGGVQQVMLKVRFAEMQRSVSKALHSSVALGS 194

Query: 220 -TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFE---------TVLHALERATAI 269
             G++SG +  +   FG   +         G+    +F+          +L ALE+   +
Sbjct: 195 QNGNASGETGQWL--FGNNGLGNTPIEVKDGIAGALAFQFGVGSLQVGLLLEALEQKGVV 252

Query: 270 RTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIG 329
           RTLAEP L+A+SGQ A F +GG++    VS   G  +V    +G+ L+F P V+    I 
Sbjct: 253 RTLAEPNLSALSGQEAKFLAGGEYPIP-VSQDGGTVTVEFKPFGIELNFIPRVVDGDVIN 311

Query: 330 LRIQTEVS----EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGI 385
           L ++  VS       +  N   + ++  R+  TTVEL  G +  +AGL++DD       I
Sbjct: 312 LELKAAVSAIDTSNTVTANGLSIAAFSRRETSTTVELRDGESFAVAGLVQDDFLDNTSQI 371

Query: 386 PLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           P +  +P+LGALFR++ + RE+TE+ I  +  LV P     LS P D      +++ F  
Sbjct: 372 PWIGDVPVLGALFRSADYQREQTELVIIVSAHLVTPTRGEALSLPTDRIKPPSESELFLL 431

Query: 446 NR-VNKIYGPKEASEVEGQNYKGAIGFI 472
            R V+   GP  ASEV  Q++ G+ G++
Sbjct: 432 GRTVHSQKGP--ASEVAKQDFNGSYGYV 457


>gi|85859139|ref|YP_461341.1| flp pilus assembly protein, secretin [Syntrophus aciditrophicus SB]
 gi|85722230|gb|ABC77173.1| flp pilus assembly protein, secretin [Syntrophus aciditrophicus SB]
          Length = 503

 Score =  193 bits (491), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 129/435 (29%), Positives = 221/435 (50%), Gaps = 39/435 (8%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
           V   + +K+++ + K  I++ P +++ V ++ P  AD++  SPR +YL GK  G  N+ L
Sbjct: 39  VNTSRPQKLTLTVGKSTIVECPQNLKRVSIAAPDYADILTLSPRQIYLTGKMAGNTNLTL 98

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRA 160
              D   M  +D+ +  D+  L+  +   + D  +IRV    D + L G V +  +  + 
Sbjct: 99  WRSDNSVMSVIDVEVLPDVVGLKEKIHSMMPDEKDIRVTATPDAITLSGTVSSAANMNQV 158

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH--- 217
           + L+ ++ +  G+++        V N L + G  QV L+V ++E+ R ++K++G      
Sbjct: 159 MSLANSY-APKGKDKTGG-----VNNFLEVGGVHQVMLEVRVSEMSRSLIKKLGINWNYL 212

Query: 218 SITGSSSG-------------------PSKSFAADFG----GKFVSEGGDFSVKGVLDRF 254
           S  G++ G                   P    +A  G    G  VS     + +      
Sbjct: 213 SEGGNTFGMSMLDNLTYTVSPSDANIQPMTHLSASEGAVSVGTLVSSSVGLAFRFFGGGA 272

Query: 255 SFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGV 314
           ++   + A++    ++ LAEPTL  +SG++ASF +GG+  +          ++    +GV
Sbjct: 273 TWTLFIDAMKDQGLLKVLAEPTLLTLSGKTASFLAGGE--FPIPVPQEENITIEYKPFGV 330

Query: 315 VLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVL 370
            L+FTPTVLS  +I +++  EVS+      + V    +PS   R+  TTVEL  G +  +
Sbjct: 331 GLNFTPTVLSNKKISMQVSPEVSDLDYTNAVAVGGYAVPSITTRRVATTVELADGQSFAI 390

Query: 371 AGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           AGLLKDDI+Q+   +PLL  IP+LG+LFR+S+F + ETE+ I  TP LVKP+ M   + P
Sbjct: 391 AGLLKDDIRQIVRKVPLLGDIPVLGSLFRSSQFRKNETELVIIVTPRLVKPLDMTKQTLP 450

Query: 431 DDHYSVEDDAKAFFF 445
            D Y   +D + +  
Sbjct: 451 TDQYVEPNDFEFYLL 465


>gi|237800794|ref|ZP_04589255.1| type III secretion component [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331023652|gb|EGI03709.1| type III secretion component [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 432

 Score =  193 bits (491), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 135/412 (32%), Positives = 211/412 (51%), Gaps = 28/412 (6%)

Query: 44  IGKGKK----ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANV 99
           I KG +    ++IG  +V+    PVD   V+V++P  AD+ V SP  +Y+FGK  GQ ++
Sbjct: 23  IAKGAEGTIDLAIGEGRVLHFSAPVD--SVMVAEPGIADLQVVSPGVIYVFGKTAGQTSL 80

Query: 100 ILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQR 159
           I +  +G++   L + +    A +   L+     S  R+    + V+  G   ++QD   
Sbjct: 81  IALDSEGRETAALSLAVSSGTAAVTRPLKALHPQSRARISASGNRVIASG---SVQDVGE 137

Query: 160 AVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
           A +L+   LS  G+N       +  +N    AG  QV ++V  AEV R  L + G   + 
Sbjct: 138 ATDLN-ALLSSEGQN------FQSSVNSATYAGAAQVNIRVRFAEVSRSELLRYGVNWNA 190

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGD-----FSVKGVLDRFSFETVLHALERATAIRTLAE 274
             ++   + SF    GG   ++         S        + + +L AL+    +  LAE
Sbjct: 191 LFNNG--TFSFGLLTGGSLAADAASGASNVISAGLTSGNVNIDAMLEALQSNGVLEVLAE 248

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           P +TA++GQ+ASF +GG+ +   V  +     +    YGV L F+PT+L  GRI L+++ 
Sbjct: 249 PNITAMTGQTASFLAGGE-VAVPVPVNREVVGIEYKPYGVSLLFSPTLLPNGRIALQVRP 307

Query: 335 EVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSK 390
           EVS       + VN   +PS+RVR+ADT VE+ SG T  +AGL + +  Q  + +P+L  
Sbjct: 308 EVSSLMSTTTLDVNGYQVPSFRVRRADTRVEVGSGQTFAIAGLFQRESSQDMDKVPMLGD 367

Query: 391 IPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
           +PILG LFR+ RF R ETE+ I  TP+LV+PV  R  + P D       A A
Sbjct: 368 MPILGNLFRSKRFQRNETELVILITPYLVEPVKERVAATPLDKQRATSTASA 419


>gi|325525578|gb|EGD03368.1| flp type pilus assembly protein [Burkholderia sp. TJI49]
          Length = 545

 Score =  193 bits (490), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 132/412 (32%), Positives = 220/412 (53%), Gaps = 28/412 (6%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +S+ L K +++ +P  V++  + +P  A   + SP+T+Y+ G +VG  N+I+ G  G   
Sbjct: 99  VSVPLGKSLLVPMPEPVRNRTIGNPAVAQATMVSPQTLYILGLSVGTTNMIVQGRSGACR 158

Query: 110 LNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +D+ +  D   L+ +L++ + +  +I V   + T+VL G V   Q +Q+AV ++  + 
Sbjct: 159 V-IDVAVGADAGGLQTSLQQLMPNERDIHVSTAAGTIVLAGSVSNSQAAQQAVAIARAYG 217

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG---SSSG 225
             +G           V+N+L++    QV L+V +AEV + ++ Q+G   +I G   S SG
Sbjct: 218 DSAGSGDAGGKPGSGVLNMLSVTSPQQVMLEVKVAEVSKTLINQLGSAFNIQGGFGSWSG 277

Query: 226 P--SKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQ 283
              S   A    G  VS+          +R  F+    A      ++ LAEP L  ISGQ
Sbjct: 278 ALVSNLLAGVASGIAVSKS---------NRRPFQIAADAQNTDNLVKILAEPNLVTISGQ 328

Query: 284 SASFTSGGQHLYKTVSSSTG-ATSVTTHD--YGVVLHFTPTVLSPGRIGLRIQTEVSE-P 339
            A+F +GG+       SS G AT++T  +  +GV L FTPTVL+ GRI L++  EVSE  
Sbjct: 329 EATFLAGGKIFIPVPQSSGGNATTITLQEEEFGVALKFTPTVLANGRISLKVAPEVSELS 388

Query: 340 VIGV--------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKI 391
             GV         A  +P    R+A TTV++  G +  + GL+KD++    + IP + ++
Sbjct: 389 STGVTLSATNVSGASILPLITTRRASTTVQMNDGESFAIGGLIKDNVTGALKAIPGVGEV 448

Query: 392 PILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           P+LGALFR++ F ++ TE+    TP LVKP+ + D+  P D +S  ++A  +
Sbjct: 449 PVLGALFRSTSFQQDRTELIFLITPHLVKPMQIADVPLPTDSFSKPNEADVY 500


>gi|254463467|ref|ZP_05076883.1| bacterial type II/III secretion system protein [Rhodobacterales
           bacterium HTCC2083]
 gi|206680056|gb|EDZ44543.1| bacterial type II/III secretion system protein [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 474

 Score =  192 bits (488), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 145/488 (29%), Positives = 242/488 (49%), Gaps = 46/488 (9%)

Query: 10  TMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDV 69
           T+ + FL  +    A + P   A+A  + I  V  G    + I +N+ ++++  V   ++
Sbjct: 6   TLRAAFLGCAVLFTASVAP---AHADTLRI--VRSGSSSTLPIPMNRAVVVESDVPFAEL 60

Query: 70  LVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRR 129
            +++P+ AD+   S RT+Y+ GK+ G   + L+   G+ + N+D+ +  D++  +  LR+
Sbjct: 61  SIANPSIADISTLSDRTVYVLGKSPGLTTLTLLDDAGRLITNVDVRVSADVSEFKERLRQ 120

Query: 130 FIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLN 189
            +    I V   +D +VL G V +     RA++L++ +            + ++V NLL+
Sbjct: 121 ILPGEKIEVRTANDGIVLSGTVSSAGKVDRAMDLAQRY------------APERVTNLLS 168

Query: 190 IAGEDQVTLKVTIAEVRRDILKQIGFQH-----------SITGSSSGPSKSFAADFGGKF 238
           ++G  QV LKV  AE++R + K +               S+ G ++  +   A+      
Sbjct: 169 VSGVQQVMLKVRFAEMQRSVSKSLSSSLALGGSALGGNLSVRGGTNTLASGAASSAAIAG 228

Query: 239 VSEGGDFSVKGVLDRFSFET-------VLHALERATAIRTLAEPTLTAISGQSASFTSGG 291
            +   + +    L  F F         +L ALE    +RTLAEP LTA+SGQ A F +GG
Sbjct: 229 TAPANNANNGATL--FGFNAGGLEVGILLEALESKGMVRTLAEPNLTALSGQEAKFLAGG 286

Query: 292 QHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGV--NAGD 347
           ++     SSS     +    +GV L F P VL    I L +  EVS  +   G+  +   
Sbjct: 287 EYPIPVQSSS--GVQIQFKPFGVQLAFIPRVLDDKVINLELNAEVSSLDAANGIVSDGFA 344

Query: 348 MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREE 407
           +   +VR+  TTVE+  G +  +AGLL+DD   L   +P L  IP+LGALFR++ + RE+
Sbjct: 345 ISGLKVRRTSTTVEMRDGESFAIAGLLQDDFTDLSGQVPWLGDIPVLGALFRSADYKREQ 404

Query: 408 TEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVN-KIYGPKE--ASEVEGQN 464
           +E+ I  TP LV P     L+ P D  S   +   F F RV      PK+  A+EV  Q+
Sbjct: 405 SELVIIVTPHLVTPTRGEALALPTDRISPPTEKDLFLFGRVTGDSRRPKKGAAAEVARQD 464

Query: 465 YKGAIGFI 472
           + G+ G++
Sbjct: 465 FTGSYGYV 472


>gi|186474103|ref|YP_001861445.1| type II and III secretion system protein [Burkholderia phymatum
           STM815]
 gi|184196435|gb|ACC74399.1| type II and III secretion system protein [Burkholderia phymatum
           STM815]
          Length = 700

 Score =  192 bits (488), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 138/454 (30%), Positives = 230/454 (50%), Gaps = 53/454 (11%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           + ++I + K  ++ V   V+   V +P+    ++ SP+T+YL G +VG  N+I+ G  G 
Sbjct: 116 QTVTIPIGKSTMVNVRESVKTRTVGNPSIVQAMLVSPQTLYLLGTDVGTTNMIVQGRSGS 175

Query: 108 QMLNLDILIERDIAHLEMTLRRFIAD-SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
             + +D+ +  D   L+ TL   + + S ++V+  +DT+VL G V     ++R VEL+  
Sbjct: 176 CTV-IDVAVGADPGGLQQTLAVLMPEESGVQVKAAADTLVLTGTVSDSVKAERIVELARA 234

Query: 167 FLSQSGR--------------------------NQYANSSSKKVMNLLNIAGEDQVTLKV 200
           ++++                                 N ++++++N++++A   QV L+V
Sbjct: 235 YVARQAAPVPVAAPANAGGAQGGAMIPAVLKPAGASGNGNNERIVNMMHVAAPQQVMLEV 294

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAADF--GGKFVSEGGDFSVKGVLDRFSFET 258
            +AEV + ++ Q+G   +I G +   S    ADF  GG     G     K      +F  
Sbjct: 295 KVAEVSKTLIDQLGMAANIQGGTGSWSFGLLADFLSGGM----GALLGSKANNKPLNF-- 348

Query: 259 VLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVT----THDYGV 314
            + A +    ++ LAEPTL AISGQ ASF +GG+ ++  V  S GA   T       +GV
Sbjct: 349 AIDAQKTDQLVKVLAEPTLMAISGQEASFLAGGR-VFIPVPQSNGAAGSTIILQEETFGV 407

Query: 315 VLHFTPTVLSPGRIGLRIQTEVSE--PV-IGVNAGD------MPSYRVRKADTTVELPSG 365
            L FTPTVL  GRI L++  EVSE  P  + V AG       +P    R+A TT+++  G
Sbjct: 408 GLTFTPTVLDNGRINLKVSPEVSELSPTGVAVTAGTVSTTAVLPLITTRRASTTLQVYDG 467

Query: 366 GTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMR 425
            +  + GL+K ++    +G+P L ++P+LGALFR++ F  ++TE+    TP L KP+  +
Sbjct: 468 QSFAIGGLMKSNVTGTLKGLPGLGEVPVLGALFRSTNFQEDKTELVFVVTPRLAKPLP-Q 526

Query: 426 DLSRPDDHYSVEDDAKAFFFNRV--NKIYGPKEA 457
           +   P DH+    +A  FF   +   K   P EA
Sbjct: 527 NYPLPTDHFGKVTEAGVFFTGNMEGKKPQAPAEA 560


>gi|167589424|ref|ZP_02381812.1| type II and III secretion system protein [Burkholderia ubonensis
           Bu]
          Length = 460

 Score =  192 bits (487), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 136/448 (30%), Positives = 222/448 (49%), Gaps = 41/448 (9%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
           G  +++   K  +L +P     + V+DP+ AD+ V SPRT+++FGK  G   +I +G + 
Sbjct: 33  GAPLTLAAGKGDLLSLPEPAATMFVADPSIADIQVPSPRTVFVFGKKAGTTTLIALGANH 92

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           + +L   ++++ D   L+  L        ++V     ++++ G V +  D+   ++    
Sbjct: 93  RPILRRTVIVQADTPSLQRVLDSRFPQWQLKVSGAPGSLMVSGKVPSGADADAVMQSLAP 152

Query: 167 FLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGP 226
           +L             +K++N L ++   QV L+V + EV R+I +Q+G   S  G S   
Sbjct: 153 YLQDK----------EKLVNRLTLSRPIQVNLRVRVTEVSRNITQQLGINWSGLGGSG-- 200

Query: 227 SKSFAADFGGKFV----------SEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAE 274
                  F G+ +          S  G FSV G     R+S + VL AL++   I  LAE
Sbjct: 201 -NFIGGLFNGRTLFDPTTSLFNLSPTGAFSVLGGFRAGRWSIDVVLDALDQEGLITMLAE 259

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSS--STGATSVTTHDYGVVLHFTPTVLSPGRIGLRI 332
           P LTA+SG++ASF +GG+       S  +TGA +V    +GV L FTPTVL+  RI L++
Sbjct: 260 PNLTAMSGETASFLAGGEIPIPVAQSGTTTGAITVEFKPFGVSLDFTPTVLAENRISLKV 319

Query: 333 QTEVSE--PVIGVNAG--DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
           + EVSE  P   V  G   +P+  VR+ +TTVEL SG +  + GLL+     +   IP L
Sbjct: 320 RPEVSEIDPTNSVTTGGVKVPALSVRRVETTVELSSGQSFAIGGLLQSQTSDVVSQIPGL 379

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR- 447
            ++P+LG LF +  F   +TE+ +  TP++V+P     L +  D  +       F   R 
Sbjct: 380 GRLPVLGRLFSSKNFQDNKTEVVVIVTPYIVQPAGPGQLEQAIDTVARPSSDLEFAVQRN 439

Query: 448 --VNKIYGPKEASEVEGQNYKGAIGFIY 473
             ++ + G       +     GA GF+Y
Sbjct: 440 LGLDLLSG-------DTPRLVGAAGFVY 460


>gi|218670938|ref|ZP_03520609.1| putative pilus assembly protein [Rhizobium etli GR56]
          Length = 186

 Score =  191 bits (486), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 98/183 (53%), Positives = 129/183 (70%), Gaps = 5/183 (2%)

Query: 292 QHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSY 351
           Q LY T + S G  +V   +YG+ L F P VLS GRI L I+T VSEPV G  +G+  +Y
Sbjct: 9   QQLYST-TDSDGNVTVVPFNYGINLAFKPVVLSSGRISLEIKTNVSEPVAG--SGNA-TY 64

Query: 352 RVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIF 411
           + R A+T+VELPSGG+I LAGL++D++ Q   G P +SKIP+LG LFR   F R+ETE+ 
Sbjct: 65  QRRSAETSVELPSGGSIALAGLIRDNVSQTMGGTPGVSKIPLLGTLFRQKGFERQETELV 124

Query: 412 IAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGF 471
           I ATP+LV+PVA   L+RPDD++S E+D   FF NRVNK+YG +EA   + Q + G+IGF
Sbjct: 125 IIATPYLVRPVARNQLNRPDDNFSPENDGATFFLNRVNKVYGRREAPVADAQ-FHGSIGF 183

Query: 472 IYK 474
           IYK
Sbjct: 184 IYK 186


>gi|103486617|ref|YP_616178.1| type II and III secretion system protein [Sphingopyxis alaskensis
           RB2256]
 gi|98976694|gb|ABF52845.1| type II and III secretion system protein [Sphingopyxis alaskensis
           RB2256]
          Length = 493

 Score =  191 bits (486), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 140/445 (31%), Positives = 224/445 (50%), Gaps = 49/445 (11%)

Query: 32  ANAAVINIS---DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMY 88
           A  AV N S   D+ +G+G+ IS+          P  + DV V+D   ADV V S R +Y
Sbjct: 34  AAQAVQNASSSIDLSVGRGRLISL----------PAAMSDVFVADDKVADVQVRSSRQLY 83

Query: 89  LFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLH 148
           +F K  G+ ++      G+ + +    +  +I  ++  L   + +++I    ++  V+L 
Sbjct: 84  VFAKAPGETSIYATDASGRVVFSTVARVGNNIETIDQMLSLAMPEASIAANTMNGFVLLT 143

Query: 149 GMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRD 208
           G VR+  D+  A  L + F+              KV++ L  A   QV L+V IAEV R 
Sbjct: 144 GTVRSPDDAAEAERLVQAFVGDQ----------TKVLSRLRTATPLQVNLQVRIAEVNRS 193

Query: 209 ILKQIGFQHSITGSSSGPSKS--FAADFGGK----------------FVSEGGDFSVKGV 250
           ++K++   + +T  + GP  +      FGG+                  +  G  S+ G 
Sbjct: 194 LVKELS-GNLLTRDTDGPLGNGFLGGVFGGRQAGTITTDANGNTIYSITTPPGTRSLAGA 252

Query: 251 LDRFSFETV--LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVT 308
              F  + +  L   ER+  + TLA+P LTAISG++A F +GG+       +  G T++ 
Sbjct: 253 GRLFGLDLIASLDIGERSGLVATLAQPNLTAISGETADFLAGGEFPVPIPGNFAG-TTIE 311

Query: 309 THDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPS 364
              YGV L +TPTVLS GRI LR++ EVSE      I +    +P+  +R+A+TTVEL S
Sbjct: 312 YRKYGVSLAYTPTVLSNGRISLRVRPEVSELSTEGAIEMQGFQIPALTIRRAETTVELGS 371

Query: 365 GGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAM 424
           G + ++AGLL +      + +P L  +P+LG LF++  F R ETE+ I  TP+LV+PV+ 
Sbjct: 372 GESFMIAGLLNNRSIGAIDKMPGLGDVPLLGTLFKSDSFRRGETELVIVVTPYLVEPVSA 431

Query: 425 RDLSRPDDHYSVEDDAKAFFFNRVN 449
            D+  P D +   DD +    N+ +
Sbjct: 432 NDIKLPTDAFRDADDLQRLLLNQTS 456


>gi|78060314|ref|YP_366889.1| Flp pilus assembly protein secretin CpaC [Burkholderia sp. 383]
 gi|77964864|gb|ABB06245.1| Flp pilus assembly protein secretin CpaC [Burkholderia sp. 383]
          Length = 652

 Score =  191 bits (486), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 125/407 (30%), Positives = 212/407 (52%), Gaps = 18/407 (4%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +S+ L K +++ +P  V++  + +P  A   + SP+T+Y+ G +VG  N+I+ G  G   
Sbjct: 100 VSVPLGKSLLVPMPEPVRNRTIGNPAVAQATMVSPQTLYILGLSVGTTNMIVQGRSGACR 159

Query: 110 LNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +D+ +  D   L+ +L + + +  +I V   + T+VL G V +   +Q+A++++  + 
Sbjct: 160 V-IDVAVGADAGGLQASLMQLMPNERDIHVSTAAGTIVLAGTVSSSMAAQQAMQIARAYG 218

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK 228
             +G       +   V+N+LN+    QV L+V +AEV + ++ Q+G   +I G     S 
Sbjct: 219 DSAGDPAGGGKAGGGVLNMLNVTSPQQVMLEVKVAEVSKTLINQMGSALNIQGGFGSWSG 278

Query: 229 SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
           +  ++     V+ G  FS     +   F     A      ++ LAEP L  ISGQ A+F 
Sbjct: 279 ALVSNLLAG-VATGIAFSKA---NNKPFNLAADAQNTDNLVKILAEPNLVTISGQEATFL 334

Query: 289 SGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEVSE------P 339
           +GG+       SS   TS  T    ++GV L FTPTVLS GRI L++  EVSE       
Sbjct: 335 AGGKIFIPIPQSSGNGTSSITLQEEEFGVALKFTPTVLSNGRISLKVAPEVSELSQTGVT 394

Query: 340 VIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
           +   N G    +P    R+A TTV++  G T  + GL+KD+     + +P + +IP+LGA
Sbjct: 395 LSATNIGGTSILPLITTRRASTTVQMGDGETFAIGGLIKDNGTGALKALPGVGEIPVLGA 454

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           L R++ F ++ TE+    TP LVKP+   D+  P D +S  ++   +
Sbjct: 455 LLRSTSFQQDRTELIFVITPHLVKPLQTADVPLPTDSFSKPNEVDVY 501


>gi|254487886|ref|ZP_05101091.1| bacterial type II/III secretion system protein [Roseobacter sp.
           GAI101]
 gi|214044755|gb|EEB85393.1| bacterial type II/III secretion system protein [Roseobacter sp.
           GAI101]
          Length = 486

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 132/458 (28%), Positives = 228/458 (49%), Gaps = 44/458 (9%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
           V  G  + + + +N+ ++++  +   ++ +++P  AD+   S RT+Y+ GK+ G   + L
Sbjct: 44  VNRGTNRALEVPMNRAVVVESDIPFAELSIANPGIADISSLSDRTIYVLGKSPGLTTLTL 103

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           +   G+ + N+D+ +  DI+  +  LR+ +    I V   +D +VL G+V + Q  QRA+
Sbjct: 104 LDAAGQLITNVDVRVASDISEFKERLRQILPGEKIEVRTANDGIVLSGIVSSTQGLQRAL 163

Query: 162 ELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG 221
           +L+E +            + ++V NL+++ G  QV LKV  AE++R + K +    ++ G
Sbjct: 164 DLAERY------------APERVSNLMSVGGIQQVMLKVRFAEMQRSVSKSLSASLALNG 211

Query: 222 ------------SSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFET-------VLHA 262
                       +++  S + A    G   +   +     VL  F F         +L A
Sbjct: 212 LLGSDLAINGGTNTTNGSTAIANSLNGSTPTTNSN--AGAVL--FGFNAGSTQVGLLLEA 267

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTV 322
           LE+  A+R LAEP L A+SGQ A+F +GG++    VS S    SV    +GV + F P V
Sbjct: 268 LEQKGAVRFLAEPNLVALSGQEATFLAGGEYPVP-VSQSGDRISVEYKPFGVEMSFIPRV 326

Query: 323 LSPGRIGLRIQTEVS--EPVIGVNAG---DMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           +    I L ++  VS  +P   V+ G   D+ ++  R+  TTVE+  G +  +AGLL DD
Sbjct: 327 VDKNLINLELKAAVSAIDPSNSVSLGNGFDISAFTRRETSTTVEMRDGESFAIAGLLTDD 386

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
                  +P +  +P+LGALFR++ + R +TE+ I  T  LV P     L+ P D     
Sbjct: 387 FTDTSRQLPWIGDVPVLGALFRSANYQRSQTELVIIITAHLVTPTRGDALALPTDRIKPP 446

Query: 438 DDAKAFFFNRVN---KIYGPKEASEVEGQNYKGAIGFI 472
            + + F   R +   K      A EV  Q++ G+ G++
Sbjct: 447 TENELFLSGRTSSGGKAPTRGAAGEVAKQDFSGSYGYV 484


>gi|254466441|ref|ZP_05079852.1| bacterial type II/III secretion system protein [Rhodobacterales
           bacterium Y4I]
 gi|206687349|gb|EDZ47831.1| bacterial type II/III secretion system protein [Rhodobacterales
           bacterium Y4I]
          Length = 468

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 125/453 (27%), Positives = 231/453 (50%), Gaps = 41/453 (9%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
           V+ G    + + +N+ ++++  +   ++ +++P+ AD+   S RT+Y+ GK+ G   + L
Sbjct: 33  VKKGTAATLDVPMNRAVVVESEIPFAELSIANPSIADISSLSDRTIYVLGKSPGLTTLTL 92

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           +   G+ + N+D+ +  D+   +  LR+ + +  I V   +D +VL G V +    QRA+
Sbjct: 93  LDGSGRLITNVDVRVAADVTEFKQRLRQILPNEKIEVRTANDGIVLSGTVSSSARLQRAL 152

Query: 162 ELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILK----QIGF-- 215
           +L+E +            + ++V NL+++ G  QV LKV  AE++R + K     +GF  
Sbjct: 153 DLAERY------------APERVSNLMSVGGVQQVMLKVRFAEMQRSVSKSLSASLGFNG 200

Query: 216 --------QHSITGSSSGPSKSFAADFGGKFVSEGG---DFSVKGVLDRFSFETVLHALE 264
                    ++   +S   + S A +      + G     F+   V        +L ALE
Sbjct: 201 GTGNGRTGGYNTLNTSGALANSLAGNIPAANENTGAFLFGFNAGSV----QVSLLLEALE 256

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLS 324
           +   +RTLAEP L+A+SGQ A F +GG++    V+   G  ++    +G+ L+F P V+ 
Sbjct: 257 QKGVVRTLAEPNLSALSGQEAKFLAGGEYPVP-VAQEGGVITIEFKPFGIELNFIPRVID 315

Query: 325 PGRIGLRIQTEVS--EPV--IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQ 380
              I L +   VS  +P   + ++   + ++  R+  TTVE+  G +  +AGL++D+   
Sbjct: 316 GDLINLELNAAVSAIDPTNSLELSGLTIDAFSRRETSTTVEMRDGESFAIAGLIRDEFLD 375

Query: 381 LKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDA 440
               +P L  +P+LGALFR++ + RE+TE+ I  +  LV P     L+ P D  +   + 
Sbjct: 376 NSSQLPWLGDVPVLGALFRSADYQREQTELVIIVSAHLVTPTRGEALTLPTDRVAPPSEK 435

Query: 441 KAFFFNRVNK-IYGPKEASEVEGQNYKGAIGFI 472
             F F R ++   GP  A+EV  Q++ G+ G++
Sbjct: 436 DLFLFGRTSRNRAGP--AAEVAKQDFNGSYGYV 466


>gi|298487093|ref|ZP_07005143.1| type II/III secretion system protein [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298158336|gb|EFH99406.1| type II/III secretion system protein [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 437

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 136/410 (33%), Positives = 209/410 (50%), Gaps = 24/410 (5%)

Query: 44  IGKGKK----ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANV 99
           I KG K    ++IG  +V+    PVD   V+V++P  AD+ V SP  +Y+FGK  GQ ++
Sbjct: 28  IAKGAKGTVDLAIGEGRVLHFSAPVD--SVMVAEPGIADLQVVSPGVIYVFGKAAGQTSL 85

Query: 100 ILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQR 159
           I +G +G++   L + +    A +   L+     S  R+      V+  G   ++QD   
Sbjct: 86  IALGSEGRETAALSLAVSSGTAAVTRPLKALHPQSQARINASGSRVIASG---SVQDVGE 142

Query: 160 AVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
           A +L+   LS  G+N       +  +N    AG  QV ++V  AEV R  L + G   + 
Sbjct: 143 ATDLN-ALLSTEGQN------FQSTVNSATYAGSAQVNIRVRFAEVSRSELLRYGVNWNA 195

Query: 220 ---TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPT 276
               G+ S    +  A             S        + + +L AL+    +  LAEP 
Sbjct: 196 LFNNGTFSFGLLTGGALAADAAGGASNVISAGLASGNVNIDAMLEALQSNGVLEVLAEPN 255

Query: 277 LTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           +TA++GQ+ASF +GG+ +   V  +     +    YGV L F+PT+L  GRI L+++ EV
Sbjct: 256 ITAMTGQTASFLAGGE-VAVPVPVNREVVGIEYKPYGVSLLFSPTLLPNGRIALQVRPEV 314

Query: 337 SEPV----IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           S  +    + VN   +PS+RVR+ADT VE+ SG T  +AGL + +  Q  + +P+L  +P
Sbjct: 315 SSLMSTITLDVNGYQVPSFRVRRADTRVEVGSGQTFAIAGLFQRESSQDMDKVPMLGDMP 374

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
           ILG LFR+ RF R ETE+ I  TP+LV+PV  R ++ P D       A A
Sbjct: 375 ILGNLFRSKRFQRNETELVILITPYLVEPVKDRVVATPLDKQRAASTASA 424


>gi|253996769|ref|YP_003048833.1| type II and III secretion system protein [Methylotenera mobilis
           JLW8]
 gi|253983448|gb|ACT48306.1| type II and III secretion system protein [Methylotenera mobilis
           JLW8]
          Length = 513

 Score =  191 bits (484), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 150/475 (31%), Positives = 240/475 (50%), Gaps = 44/475 (9%)

Query: 1   MRYLQRTFFT-MMSIFLFSSNPSVAKLPPIKEAN-----------AAVINISDVEIGKGK 48
           +RY        M+ + L S  P  A  P     N           AA    S  EI    
Sbjct: 16  LRYCVSNLLAAMLGVTLLSIAPLHAAEPQANMQNILVAAVTPKKVAARPTPSSTEIVPSV 75

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           ++S+G + ++ L   V++Q V V D     V V SPR + L  K +G   VI++   G+ 
Sbjct: 76  ELSLGQSHLVRLPAGVNLQRVKVDDDKIVQVDVTSPREVVLHAKTIGSTMVIILDKSGQS 135

Query: 109 MLNLDILI-----ERDIAHLEMTLRRFIADSN-IRVEMVSDTVVLHGMVRTIQDSQRAVE 162
            + +D+ +       D A L+  L++ + +   I+V   ++++VL G V     + +A+ 
Sbjct: 136 AV-MDVRVVAAATAMDAASLQTKLQQIMPNEKGIKVSTAAESLVLSGTVSDAVKADKAMA 194

Query: 163 LSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGS 222
           L+E +    G+++      KKV+N+L +A   QV L+V +AEV +++L ++G     + S
Sbjct: 195 LAEAY---GGKDK-----DKKVINMLQVAAPQQVMLEVKMAEVSKNLLDKLGASFGASRS 246

Query: 223 SSGPSKSFAADF----GGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
           + G + + A+ F    G   +S GG  ++     + +    + A  +   ++ LAEP + 
Sbjct: 247 NGGVAYAIASGFLSLTGADPLSPGGLLTIT----KGNTAIKVDAENKDGVVKILAEPNII 302

Query: 279 AISGQSASFTSGGQHLYKTVSSSTGATS----VTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           AISGQ  SF +GG+       S+TG  S    +   D+GV L FTPTVL  G I LR+  
Sbjct: 303 AISGQEGSFLAGGKIFIPVPQSNTGGGSNVLTLEERDFGVGLKFTPTVLEEGMINLRVAP 362

Query: 335 EVSEPVIG---VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKI 391
           EVSE   G   V     PS+ VR+  TTV+L  G +  +AGL+K+++ +     P+L +I
Sbjct: 363 EVSELNQGGTTVGGSVFPSFTVRRVATTVQLRDGQSFAIAGLIKNNVTENVRRFPILGEI 422

Query: 392 PILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFN 446
           PILGALFR+S F  ++TE+    TP LVKP+   D + P D ++    A+ FF N
Sbjct: 423 PILGALFRSSSFQEDKTELLFVITPRLVKPLP-PDFALPTDKFTPPSKAE-FFLN 475


>gi|167719684|ref|ZP_02402920.1| type II/III secretion system protein [Burkholderia pseudomallei
           DM98]
 gi|167902788|ref|ZP_02489993.1| type II/III secretion system protein [Burkholderia pseudomallei
           NCTC 13177]
          Length = 448

 Score =  190 bits (483), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 126/395 (31%), Positives = 206/395 (52%), Gaps = 36/395 (9%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           ++++P     V V+DP  ADV V +P+ +++ GK  G   +  +G + + +L   ++++ 
Sbjct: 35  MVKLPAPAVAVFVADPDVADVHVPTPQAVFVLGKKAGTTTLFALGANNRTILRETVVVDV 94

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           D   L+  L        + +     ++++ G V +  D+   V+  + +L Q        
Sbjct: 95  DTPSLQRILDARFPQLRLTLAGAPGSLMVSGRVPSAADADAVVQTLKPYLRQQ------- 147

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKF 238
              + ++N L +A   QV L+V I EV R+I +Q+G   S  G+S          F G+ 
Sbjct: 148 ---EALVNRLTLARPIQVHLRVRITEVDRNITQQLGINWSALGASG---NFVGGLFNGRT 201

Query: 239 V----------SEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPTLTAISGQSAS 286
           +          S  G FSV G     R+S + VL AL++   I  LAEP LTAISGQ+AS
Sbjct: 202 LFDTASKAFDLSPSGAFSVVGGFHTSRYSIDGVLDALDQEGLITMLAEPNLTAISGQTAS 261

Query: 287 FTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PVIGVN 344
           F +GG+        +TGA ++    YGV L FTPTVL+  RI L+++ EVSE  P   V 
Sbjct: 262 FLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLADNRISLKVRPEVSEIDPTNSVT 321

Query: 345 AGDM--PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
            G +  P+  VR+ DTTVEL SG +  + GLL+     +   +P L+++P+LG LF +  
Sbjct: 322 TGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDVLAELPGLARLPVLGKLFSSRN 381

Query: 403 FNREETEIFIAATPFLVKPV-------AMRDLSRP 430
           +  ++TE+ +  TP++V+P        A+ D++RP
Sbjct: 382 YLNDKTEVVVIVTPYIVQPANPGELRDALDDVTRP 416


>gi|76811933|ref|YP_333435.1| RhcC2 [Burkholderia pseudomallei 1710b]
 gi|126441311|ref|YP_001058908.1| type II/III secretion system protein [Burkholderia pseudomallei
           668]
 gi|126453026|ref|YP_001066150.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106a]
 gi|134282366|ref|ZP_01769071.1| type II/III secretion system protein [Burkholderia pseudomallei
           305]
 gi|217421397|ref|ZP_03452901.1| type II/III secretion system protein [Burkholderia pseudomallei
           576]
 gi|226196310|ref|ZP_03791892.1| type II/III secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|242314528|ref|ZP_04813544.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106b]
 gi|254179872|ref|ZP_04886471.1| type II/III secretion system protein [Burkholderia pseudomallei
           1655]
 gi|254188722|ref|ZP_04895233.1| type II/III secretion system protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254197611|ref|ZP_04904033.1| type II/III secretion system protein [Burkholderia pseudomallei
           S13]
 gi|254261104|ref|ZP_04952158.1| type II/III secretion system protein [Burkholderia pseudomallei
           1710a]
 gi|254297713|ref|ZP_04965166.1| type II/III secretion system protein [Burkholderia pseudomallei
           406e]
 gi|76581386|gb|ABA50861.1| RhcC2 [Burkholderia pseudomallei 1710b]
 gi|126220804|gb|ABN84310.1| type II/III secretion system protein [Burkholderia pseudomallei
           668]
 gi|126226668|gb|ABN90208.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106a]
 gi|134246404|gb|EBA46493.1| type II/III secretion system protein [Burkholderia pseudomallei
           305]
 gi|157806781|gb|EDO83951.1| type II/III secretion system protein [Burkholderia pseudomallei
           406e]
 gi|157936401|gb|EDO92071.1| type II/III secretion system protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|169654352|gb|EDS87045.1| type II/III secretion system protein [Burkholderia pseudomallei
           S13]
 gi|184210412|gb|EDU07455.1| type II/III secretion system protein [Burkholderia pseudomallei
           1655]
 gi|217395139|gb|EEC35157.1| type II/III secretion system protein [Burkholderia pseudomallei
           576]
 gi|225931527|gb|EEH27532.1| type II/III secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|242137767|gb|EES24169.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106b]
 gi|254219793|gb|EET09177.1| type II/III secretion system protein [Burkholderia pseudomallei
           1710a]
          Length = 482

 Score =  190 bits (483), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 126/395 (31%), Positives = 206/395 (52%), Gaps = 36/395 (9%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           ++++P     V V+DP  ADV V +P+ +++ GK  G   +  +G + + +L   ++++ 
Sbjct: 69  MVKLPAPAVAVFVADPDVADVHVPTPQAVFVLGKKAGTTTLFALGANNRTILRETVVVDV 128

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           D   L+  L        + +     ++++ G V +  D+   V+  + +L Q        
Sbjct: 129 DTPSLQRILDARFPQLRLTLAGAPGSLMVSGRVPSAADADAVVQTLKPYLRQQ------- 181

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKF 238
              + ++N L +A   QV L+V I EV R+I +Q+G   S  G+S          F G+ 
Sbjct: 182 ---EALVNRLTLARPIQVHLRVRITEVDRNITQQLGINWSALGASG---NFVGGLFNGRT 235

Query: 239 V----------SEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPTLTAISGQSAS 286
           +          S  G FSV G     R+S + VL AL++   I  LAEP LTAISGQ+AS
Sbjct: 236 LFDTASKAFDLSPSGAFSVVGGFHTSRYSIDGVLDALDQEGLITMLAEPNLTAISGQTAS 295

Query: 287 FTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PVIGVN 344
           F +GG+        +TGA ++    YGV L FTPTVL+  RI L+++ EVSE  P   V 
Sbjct: 296 FLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLADNRISLKVRPEVSEIDPTNSVT 355

Query: 345 AGDM--PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
            G +  P+  VR+ DTTVEL SG +  + GLL+     +   +P L+++P+LG LF +  
Sbjct: 356 TGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDVLAELPGLARLPVLGKLFSSRN 415

Query: 403 FNREETEIFIAATPFLVKPV-------AMRDLSRP 430
           +  ++TE+ +  TP++V+P        A+ D++RP
Sbjct: 416 YLNDKTEVVVIVTPYIVQPANPGELRDALDDVTRP 450


>gi|326388864|ref|ZP_08210446.1| type II and III secretion system protein [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326206464|gb|EGD57299.1| type II and III secretion system protein [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 565

 Score =  190 bits (483), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 135/424 (31%), Positives = 213/424 (50%), Gaps = 40/424 (9%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           ISIG  +++ L  P ++ DV V++   ADV V S   +Y+FGK  G+  V      G  +
Sbjct: 78  ISIGRGELVTL--PGNMTDVFVANENIADVQVKSGNQLYIFGKAGGETTVYASNGRGDVI 135

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            + +I +  ++  ++  L   + +++I    +++TV+L G V   +D+  A  L + F+ 
Sbjct: 136 WSANIRVGNNLDSIDQMLHMAMPEAHIATATMNNTVLLTGTVSAPEDAAEAERLVKAFVG 195

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS----- 224
           +             V++ L +A   QV L V  AEV R + + I    +   ++S     
Sbjct: 196 E----------KTNVISRLKMATPLQVNLHVKFAEVSRTLTRSIQSNWTTADATSGLKFG 245

Query: 225 -GPSKSFAADF--GGKF---------------VSEGGDFSVKGVLDRFSFETVLHALERA 266
            G  +SF   +  GG                 VS G   ++   +   SF   L   E  
Sbjct: 246 LGQGRSFFPQYVPGGPLGMGTATTTGATAVSPVSTGTTLALASKVFGLSFLAALDLAESI 305

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
             + TLAEP LTA+SG++A F +GG++    VSS  G   V   +YGV L +TPTVL+ G
Sbjct: 306 GLVSTLAEPNLTALSGETAEFLAGGEYPIP-VSSGLGTVPVQYKNYGVSLAYTPTVLANG 364

Query: 327 RIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLK 382
           RI LR++ EVSE      + +N   +P+  VR+A+TT+EL SG + ++AGLLK+  Q   
Sbjct: 365 RISLRVRPEVSELSSDGAVSLNGYSVPALSVRRAETTIELGSGQSFMIAGLLKNSSQNTI 424

Query: 383 EGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
             +P    +PILG+LFR++ + R ETE+ I  TP+LV PV   ++  P D +      K 
Sbjct: 425 AKMPGAGDLPILGSLFRSTSYQRGETELVIIVTPYLVNPVDPSEIHLPTDGFKSAGALKQ 484

Query: 443 FFFN 446
              N
Sbjct: 485 ILGN 488


>gi|167824270|ref|ZP_02455741.1| type II/III secretion system protein [Burkholderia pseudomallei 9]
 gi|167919049|ref|ZP_02506140.1| type II/III secretion system protein [Burkholderia pseudomallei
           BCC215]
          Length = 444

 Score =  190 bits (482), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 126/395 (31%), Positives = 206/395 (52%), Gaps = 36/395 (9%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           ++++P     V V+DP  ADV V +P+ +++ GK  G   +  +G + + +L   ++++ 
Sbjct: 31  MVKLPAPAVAVFVADPDVADVHVPTPQAVFVLGKKAGTTTLFALGANNRTILRETVVVDV 90

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           D   L+  L        + +     ++++ G V +  D+   V+  + +L Q        
Sbjct: 91  DTPSLQRILDARFPQLRLTLAGAPGSLMVSGRVPSAADADAVVQTLKPYLRQQ------- 143

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKF 238
              + ++N L +A   QV L+V I EV R+I +Q+G   S  G+S          F G+ 
Sbjct: 144 ---EALVNRLTLARPIQVHLRVRITEVDRNITQQLGINWSALGASG---NFVGGLFNGRT 197

Query: 239 V----------SEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPTLTAISGQSAS 286
           +          S  G FSV G     R+S + VL AL++   I  LAEP LTAISGQ+AS
Sbjct: 198 LFDTASKAFDLSPSGAFSVVGGFHTSRYSIDGVLDALDQEGLITMLAEPNLTAISGQTAS 257

Query: 287 FTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PVIGVN 344
           F +GG+        +TGA ++    YGV L FTPTVL+  RI L+++ EVSE  P   V 
Sbjct: 258 FLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLADNRISLKVRPEVSEIDPTNSVT 317

Query: 345 AGDM--PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
            G +  P+  VR+ DTTVEL SG +  + GLL+     +   +P L+++P+LG LF +  
Sbjct: 318 TGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDVLAELPGLARLPVLGKLFSSRN 377

Query: 403 FNREETEIFIAATPFLVKPV-------AMRDLSRP 430
           +  ++TE+ +  TP++V+P        A+ D++RP
Sbjct: 378 YLNDKTEVVVIVTPYIVQPANPGELRDALDDVTRP 412


>gi|167738675|ref|ZP_02411449.1| type II/III secretion system protein [Burkholderia pseudomallei 14]
          Length = 434

 Score =  190 bits (482), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 126/395 (31%), Positives = 206/395 (52%), Gaps = 36/395 (9%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           ++++P     V V+DP  ADV V +P+ +++ GK  G   +  +G + + +L   ++++ 
Sbjct: 21  MVKLPAPAVAVFVADPDVADVHVPTPQAVFVLGKKAGTTTLFALGANNRTILRETVVVDV 80

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           D   L+  L        + +     ++++ G V +  D+   V+  + +L Q        
Sbjct: 81  DTPSLQRILDARFPQLRLTLAGAPGSLMVSGRVPSAADADAVVQTLKPYLRQQ------- 133

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKF 238
              + ++N L +A   QV L+V I EV R+I +Q+G   S  G+S          F G+ 
Sbjct: 134 ---EALVNRLTLARPIQVHLRVRITEVDRNITQQLGINWSALGASG---NFVGGLFNGRT 187

Query: 239 V----------SEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPTLTAISGQSAS 286
           +          S  G FSV G     R+S + VL AL++   I  LAEP LTAISGQ+AS
Sbjct: 188 LFDTASKAFDLSPSGAFSVVGGFHTSRYSIDGVLDALDQEGLITMLAEPNLTAISGQTAS 247

Query: 287 FTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PVIGVN 344
           F +GG+        +TGA ++    YGV L FTPTVL+  RI L+++ EVSE  P   V 
Sbjct: 248 FLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLADNRISLKVRPEVSEIDPTNSVT 307

Query: 345 AGDM--PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
            G +  P+  VR+ DTTVEL SG +  + GLL+     +   +P L+++P+LG LF +  
Sbjct: 308 TGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDVLAELPGLARLPVLGKLFSSRN 367

Query: 403 FNREETEIFIAATPFLVKPV-------AMRDLSRP 430
           +  ++TE+ +  TP++V+P        A+ D++RP
Sbjct: 368 YLNDKTEVVVIVTPYIVQPANPGELRDALDDVTRP 402


>gi|53719431|ref|YP_108417.1| putative fimbriae assembly-related protein [Burkholderia
           pseudomallei K96243]
 gi|167815898|ref|ZP_02447578.1| RhcC2 [Burkholderia pseudomallei 91]
 gi|167845816|ref|ZP_02471324.1| RhcC2 [Burkholderia pseudomallei B7210]
 gi|52209845|emb|CAH35817.1| putative fimbriae assembly-related protein [Burkholderia
           pseudomallei K96243]
          Length = 439

 Score =  190 bits (482), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 126/395 (31%), Positives = 206/395 (52%), Gaps = 36/395 (9%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           ++++P     V V+DP  ADV V +P+ +++ GK  G   +  +G + + +L   ++++ 
Sbjct: 26  MVKLPAPAVAVFVADPDVADVHVPTPQAVFVLGKKAGTTTLFALGANNRTILRETVVVDV 85

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           D   L+  L        + +     ++++ G V +  D+   V+  + +L Q        
Sbjct: 86  DTPSLQRILDARFPQLRLTLAGAPGSLMVSGRVPSAADADAVVQTLKPYLRQQ------- 138

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKF 238
              + ++N L +A   QV L+V I EV R+I +Q+G   S  G+S          F G+ 
Sbjct: 139 ---EALVNRLTLARPIQVHLRVRITEVDRNITQQLGINWSALGASG---NFVGGLFNGRT 192

Query: 239 V----------SEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPTLTAISGQSAS 286
           +          S  G FSV G     R+S + VL AL++   I  LAEP LTAISGQ+AS
Sbjct: 193 LFDTASKAFDLSPSGAFSVVGGFHTSRYSIDGVLDALDQEGLITMLAEPNLTAISGQTAS 252

Query: 287 FTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PVIGVN 344
           F +GG+        +TGA ++    YGV L FTPTVL+  RI L+++ EVSE  P   V 
Sbjct: 253 FLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLADNRISLKVRPEVSEIDPTNSVT 312

Query: 345 AGDM--PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
            G +  P+  VR+ DTTVEL SG +  + GLL+     +   +P L+++P+LG LF +  
Sbjct: 313 TGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDVLAELPGLARLPVLGKLFSSRN 372

Query: 403 FNREETEIFIAATPFLVKPV-------AMRDLSRP 430
           +  ++TE+ +  TP++V+P        A+ D++RP
Sbjct: 373 YLNDKTEVVVIVTPYIVQPANPGELRDALDDVTRP 407


>gi|71733713|ref|YP_274717.1| type III secretion component [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71554266|gb|AAZ33477.1| type III secretion component, putative [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 437

 Score =  190 bits (482), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 136/410 (33%), Positives = 207/410 (50%), Gaps = 24/410 (5%)

Query: 44  IGKGKK----ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANV 99
           I KG K    ++IG  +V+    PVD   V+V++P  AD+ V SP  +Y+FGK  GQ ++
Sbjct: 28  IAKGAKGTVDLAIGEGRVLHFSAPVD--SVMVAEPGIADLQVVSPGVIYVFGKAAGQTSL 85

Query: 100 ILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQR 159
           I +  DG++   L + +    A +   L+     S  R+      V+  G   ++QD   
Sbjct: 86  IALDSDGRETAALSLAVSSGTAAVTRPLKALHPQSQARINASGSRVIASG---SVQDVGE 142

Query: 160 AVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
           A +L+   LS  G+N       +  +N    AG  QV ++V  AEV R  L + G   + 
Sbjct: 143 ATDLN-ALLSTEGQN------FQSTVNSATYAGSAQVNIRVRFAEVSRSELLRYGVNWNA 195

Query: 220 ---TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPT 276
               G+ S    +  A             S        + + +L AL+    +  LAEP 
Sbjct: 196 LFNNGTFSFGLLTGGALAADAAGGASNVISAGLASGNVNIDAMLEALQSNGVLEVLAEPN 255

Query: 277 LTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           +TA++GQ+ASF +GG+ +   V  +     +    YGV L F+PT+L  GRI L+++ EV
Sbjct: 256 ITAMTGQTASFLAGGE-VAVPVPVNREVVGIEYKPYGVSLLFSPTLLPNGRIALQVRPEV 314

Query: 337 SE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           S       + VN   +PS+RVR+ADT VE+ SG T  +AGL + +  Q  + +P+L  +P
Sbjct: 315 SSLMSTTTLDVNGYQVPSFRVRRADTRVEVGSGQTFAIAGLFQRESSQDMDKVPMLGDMP 374

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
           ILG LFR+ RF R ETE+ I  TP+LV+PV  R ++ P D       A A
Sbjct: 375 ILGNLFRSKRFQRNETELVILITPYLVEPVKDRVVATPLDKQRAASTASA 424


>gi|167911033|ref|ZP_02498124.1| type II/III secretion system protein [Burkholderia pseudomallei
           112]
          Length = 438

 Score =  190 bits (482), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 126/395 (31%), Positives = 206/395 (52%), Gaps = 36/395 (9%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           ++++P     V V+DP  ADV V +P+ +++ GK  G   +  +G + + +L   ++++ 
Sbjct: 25  MVKLPAPAVAVFVADPDVADVHVPTPQAVFVLGKKAGTTTLFALGANNRTILRETVVVDV 84

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           D   L+  L        + +     ++++ G V +  D+   V+  + +L Q        
Sbjct: 85  DTPSLQRILDARFPQLRLTLAGAPGSLMVSGRVPSAADADAVVQTLKPYLRQQ------- 137

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKF 238
              + ++N L +A   QV L+V I EV R+I +Q+G   S  G+S          F G+ 
Sbjct: 138 ---EALVNRLTLARPIQVHLRVRITEVDRNITQQLGINWSALGASG---NFVGGLFNGRT 191

Query: 239 V----------SEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPTLTAISGQSAS 286
           +          S  G FSV G     R+S + VL AL++   I  LAEP LTAISGQ+AS
Sbjct: 192 LFDTASKAFDLSPSGAFSVVGGFHTSRYSIDGVLDALDQEGLITMLAEPNLTAISGQTAS 251

Query: 287 FTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PVIGVN 344
           F +GG+        +TGA ++    YGV L FTPTVL+  RI L+++ EVSE  P   V 
Sbjct: 252 FLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLADNRISLKVRPEVSEIDPTNSVT 311

Query: 345 AGDM--PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
            G +  P+  VR+ DTTVEL SG +  + GLL+     +   +P L+++P+LG LF +  
Sbjct: 312 TGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDVLAELPGLARLPVLGKLFSSRN 371

Query: 403 FNREETEIFIAATPFLVKPV-------AMRDLSRP 430
           +  ++TE+ +  TP++V+P        A+ D++RP
Sbjct: 372 YLNDKTEVVVIVTPYIVQPANPGELRDALDDVTRP 406


>gi|149186255|ref|ZP_01864569.1| type II secretion system protein [Erythrobacter sp. SD-21]
 gi|148830286|gb|EDL48723.1| type II secretion system protein [Erythrobacter sp. SD-21]
          Length = 522

 Score =  190 bits (482), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 135/427 (31%), Positives = 223/427 (52%), Gaps = 51/427 (11%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           ++I + + +  ++ VP ++ DV +S+   ADV V S R +YLFGK+ G+  V      G 
Sbjct: 37  QEIVLSIGRGELVNVPGNMADVFISNENVADVQVKSRRQLYLFGKSGGETTVYASNAAGD 96

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVE-MVSDTVVLHGMVRTIQDSQRAVELSET 166
            +   ++ +  +I  ++  L   + ++ I V  M ++TV+L G V   +D+  A  L + 
Sbjct: 97  IIWAANVRVGSNIGSIDQMLSLAMPEAKINVATMGNNTVLLTGTVAAPEDAADAQSLVQA 156

Query: 167 FLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSG- 225
           ++ + G N         V++ L +A   QV L+V IAEV R +++ IG   +   SSSG 
Sbjct: 157 YVGE-GTN---------VISRLRMATPLQVNLQVRIAEVSRSVVRAIGVNLATVDSSSGF 206

Query: 226 -----PSKSFAADFGGKFVSE------------GGDFSVKG--VLDRFSFETVLHAL--- 263
                  +   + F   FV+             G +F  +G  ++D+ +  + L A    
Sbjct: 207 QFGVGQGRGAVSQFQPSFVNPVTGERIQGPLAVGQEFEGEGATIIDQITPGSTLGAFGNL 266

Query: 264 ------------ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHD 311
                       E    + TL++P LTA+SG++A F +GG+     +S   G T++   +
Sbjct: 267 LGLDIGAALDLAETQGLVTTLSQPNLTALSGETAEFLAGGEFPIP-LSQGLGTTTIEYKN 325

Query: 312 YGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGT 367
           YGV L +TPTVL+ GRI +R++ EVSE      I +N   +P+   R+A+TTVEL SG +
Sbjct: 326 YGVSLAYTPTVLANGRISIRVRPEVSELSSQGSITLNGFQVPALITRRAETTVELGSGQS 385

Query: 368 IVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDL 427
            ++AGLL ++ Q   E  P L  +P++G LFR++ + + ETE+ I  TP+LVKPV   D+
Sbjct: 386 FMIAGLLSNNSQNSIEKAPGLGDVPVIGNLFRSTTYRKGETELVIVVTPYLVKPVNANDI 445

Query: 428 SRPDDHY 434
             P D Y
Sbjct: 446 RLPTDGY 452


>gi|121600042|ref|YP_993006.1| type II/III secretion system protein [Burkholderia mallei SAVP1]
 gi|124383335|ref|YP_001026338.1| type II secretion system protein [Burkholderia mallei NCTC 10229]
 gi|126450127|ref|YP_001080388.1| RhcC2 [Burkholderia mallei NCTC 10247]
 gi|237812165|ref|YP_002896616.1| type II/III secretion system protein [Burkholderia pseudomallei
           MSHR346]
 gi|254178619|ref|ZP_04885274.1| RhcC2 [Burkholderia mallei ATCC 10399]
 gi|254358540|ref|ZP_04974813.1| RhcC2 [Burkholderia mallei 2002721280]
 gi|121228852|gb|ABM51370.1| type II/III secretion system protein [Burkholderia mallei SAVP1]
 gi|124291355|gb|ABN00624.1| putative type II secretion system protein [Burkholderia mallei NCTC
           10229]
 gi|126242997|gb|ABO06090.1| RhcC2 [Burkholderia mallei NCTC 10247]
 gi|148027667|gb|EDK85688.1| RhcC2 [Burkholderia mallei 2002721280]
 gi|160699658|gb|EDP89628.1| RhcC2 [Burkholderia mallei ATCC 10399]
 gi|237503093|gb|ACQ95411.1| type II/III secretion system protein [Burkholderia pseudomallei
           MSHR346]
          Length = 482

 Score =  190 bits (482), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 126/395 (31%), Positives = 206/395 (52%), Gaps = 36/395 (9%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           ++++P     V V+DP  ADV V +P+ +++ GK  G   +  +G + + +L   ++++ 
Sbjct: 69  MVKLPAPAVAVFVADPDVADVHVPTPQAVFVLGKKAGTTTLFALGANNRTILRETVVVDV 128

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           D   L+  L        + +     ++++ G V +  D+   V+  + +L Q        
Sbjct: 129 DTPSLQRILDARFPQLRLTLAGAPGSLMVSGRVPSAADADAVVQTLKPYLRQQ------- 181

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKF 238
              + ++N L +A   QV L+V I EV R+I +Q+G   S  G+S          F G+ 
Sbjct: 182 ---EALVNRLTLARPIQVHLRVRITEVDRNITQQLGINWSALGASG---NFVGGLFNGRT 235

Query: 239 V----------SEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPTLTAISGQSAS 286
           +          S  G FSV G     R+S + VL AL++   I  LAEP LTAISGQ+AS
Sbjct: 236 LFDTASKAFDLSPSGAFSVVGGFHTSRYSIDGVLDALDQEGLITMLAEPNLTAISGQTAS 295

Query: 287 FTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PVIGVN 344
           F +GG+        +TGA ++    YGV L FTPTVL+  RI L+++ EVSE  P   V 
Sbjct: 296 FLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLADNRISLKVRPEVSEIDPTNSVT 355

Query: 345 AGDM--PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
            G +  P+  VR+ DTTVEL SG +  + GLL+     +   +P L+++P+LG LF +  
Sbjct: 356 TGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDVLAELPGLARLPVLGKLFSSRN 415

Query: 403 FNREETEIFIAATPFLVKPV-------AMRDLSRP 430
           +  ++TE+ +  TP++V+P        A+ D++RP
Sbjct: 416 YLNDKTEVVVIVTPYIVQPANPGELRDALDDVTRP 450


>gi|307294424|ref|ZP_07574268.1| type II and III secretion system protein [Sphingobium
           chlorophenolicum L-1]
 gi|306880575|gb|EFN11792.1| type II and III secretion system protein [Sphingobium
           chlorophenolicum L-1]
          Length = 503

 Score =  189 bits (481), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 142/484 (29%), Positives = 231/484 (47%), Gaps = 57/484 (11%)

Query: 6   RTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVD 65
           ++   + S+   S+  S+  LP   +A  A +N+S+       ++ + LNK  +L     
Sbjct: 5   KSLPMLASLLTLSAGASL--LPIQAQAQIASLNLSNAN--HAGQLDVPLNKSQVLTADRP 60

Query: 66  VQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEM 125
               LV +   ADV+  + R++Y+ GK +G  ++ L       +  +D+ +  D+  L+ 
Sbjct: 61  FAKALVGNAEIADVLPMTNRSVYVLGKKMGTTSLTLYDSRNIMIAVVDVAVGPDVVTLKR 120

Query: 126 TLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVM 185
            L   +    I   + +D+VVL G + +     RAV++++T+            +  KV+
Sbjct: 121 QLSDLLPGQPIGARISNDSVVLTGTLSSAAAVDRAVQIAKTY------------AGDKVV 168

Query: 186 NLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS---------SGPSKSFAADFGG 236
           N++++    QV L+V  +E+ R   KQ G   +    S         +  S +  +D  G
Sbjct: 169 NMMSVGASQQVMLEVRFSEMSRGAAKQFGINTAFLSDSGKVVGGIGNAAQSSAILSDTNG 228

Query: 237 KFVSEGGDFSVKGVLDRF------------SFETVLHALERATAIRTLAEPTLTAISGQS 284
           + + +     +  +LD F            +  T L ALER   + TLAEPTL A+SG++
Sbjct: 229 RPIVD-----LSKILDSFGIGAANFSIGSLNITTALDALERKGVVTTLAEPTLVALSGET 283

Query: 285 ASFTSGGQH-----------LYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQ 333
           ASF +GG+                  +S  A ++    +GV L FTPTVL  G I L ++
Sbjct: 284 ASFLAGGEFPIPVAQSNSGGGGGGGGNSGNAITIEFKPFGVSLGFTPTVLDDGIINLVVE 343

Query: 334 TEVS--EPV--IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLS 389
            EVS  +P   + VN   +P  + R+A TT+EL  G +  LAGLL+ D Q      P+L 
Sbjct: 344 PEVSSIDPSASVTVNGLTIPGLQTRRASTTLELRDGQSFALAGLLRKDFQDTVRQFPILG 403

Query: 390 KIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVN 449
            IPI+GALFR+S F + ETE+ I  TP LVKP+   D++ P D      +   F   R +
Sbjct: 404 SIPIIGALFRSSGFQKSETELVIIVTPRLVKPMRAEDVALPTDRVKPPHELDLFLMGRTD 463

Query: 450 KIYG 453
           K  G
Sbjct: 464 KAVG 467


>gi|167894387|ref|ZP_02481789.1| type II/III secretion system protein [Burkholderia pseudomallei
           7894]
          Length = 426

 Score =  189 bits (481), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 126/395 (31%), Positives = 206/395 (52%), Gaps = 36/395 (9%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           ++++P     V V+DP  ADV V +P+ +++ GK  G   +  +G + + +L   ++++ 
Sbjct: 13  MVKLPAPAVAVFVADPDVADVHVPTPQAVFVLGKKAGTTTLFALGANNRTILRETVVVDV 72

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           D   L+  L        + +     ++++ G V +  D+   V+  + +L Q        
Sbjct: 73  DTPSLQRILDARFPQLRLTLAGAPGSLMVSGRVPSAADADAVVQTLKPYLRQQ------- 125

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKF 238
              + ++N L +A   QV L+V I EV R+I +Q+G   S  G+S          F G+ 
Sbjct: 126 ---EALVNRLTLARPIQVHLRVRITEVDRNITQQLGINWSALGASG---NFVGGLFNGRT 179

Query: 239 V----------SEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPTLTAISGQSAS 286
           +          S  G FSV G     R+S + VL AL++   I  LAEP LTAISGQ+AS
Sbjct: 180 LFDTASKAFDLSPSGAFSVVGGFHTSRYSIDGVLDALDQEGLITMLAEPNLTAISGQTAS 239

Query: 287 FTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PVIGVN 344
           F +GG+        +TGA ++    YGV L FTPTVL+  RI L+++ EVSE  P   V 
Sbjct: 240 FLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLADNRISLKVRPEVSEIDPTNSVT 299

Query: 345 AGDM--PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
            G +  P+  VR+ DTTVEL SG +  + GLL+     +   +P L+++P+LG LF +  
Sbjct: 300 TGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDVLAELPGLARLPVLGKLFSSRN 359

Query: 403 FNREETEIFIAATPFLVKPV-------AMRDLSRP 430
           +  ++TE+ +  TP++V+P        A+ D++RP
Sbjct: 360 YLNDKTEVVVIVTPYIVQPANPGELRDALDDVTRP 394


>gi|330876206|gb|EGH10355.1| type III secretion component [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
          Length = 437

 Score =  189 bits (481), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 134/410 (32%), Positives = 206/410 (50%), Gaps = 24/410 (5%)

Query: 44  IGKGKK----ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANV 99
           I KG K    ++IG  +V+    PVD   V+V++P  AD+ V SP  +Y+FGK  GQ ++
Sbjct: 28  IAKGAKGTVDLAIGEGRVLHFSAPVD--SVMVAEPGIADLQVVSPGVIYVFGKAAGQTSL 85

Query: 100 ILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQR 159
           I +  +G++   L + +    A +   L+     S  R+      V+  G   ++QD   
Sbjct: 86  IALDSEGRETAALSLAVSSGTAAVTRPLKALHPQSQARINASGSRVIASG---SVQDVGE 142

Query: 160 AVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
           A +L+   LS  G+N       +  +N    AG  QV ++V  AEV R  L + G   + 
Sbjct: 143 ATDLN-ALLSTEGQN------FQSTVNSATYAGSAQVNIRVRFAEVSRSELLRYGVNWNA 195

Query: 220 ---TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPT 276
               G+ S    +                S        + + +L AL+    +  LAEP 
Sbjct: 196 LFNNGTFSFGLLTGGGLAADAAGGASNVISAGLASGNVNIDAMLEALQSNGVLEVLAEPN 255

Query: 277 LTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           +TA++GQ+ASF +GG+ +   V  +     +    YGV L F+PT+L  GRI L+++ EV
Sbjct: 256 ITAMTGQTASFLAGGE-VAVPVPVNREVVGIEYKPYGVSLLFSPTLLPNGRIALQVRPEV 314

Query: 337 SE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           S       + VN   +PS+RVR+ADT VE+ SG T  +AGL + +  Q  + +P+L  +P
Sbjct: 315 SSLMSTSTLDVNGYQVPSFRVRRADTRVEVGSGQTFAIAGLFQRESSQDMDKVPMLGDMP 374

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
           ILG LFR+ RF R ETE+ I  TP+LV+PV  R ++ P D       A A
Sbjct: 375 ILGNLFRSKRFQRNETELVILITPYLVEPVKARVVATPLDKQRAASTASA 424


>gi|78062906|ref|YP_372814.1| type II and III secretion system protein [Burkholderia sp. 383]
 gi|77970791|gb|ABB12170.1| type II and III secretion system protein [Burkholderia sp. 383]
          Length = 460

 Score =  189 bits (481), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 135/421 (32%), Positives = 216/421 (51%), Gaps = 42/421 (9%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
           G  +SI   K  +L +P     + V+DP  AD+ V SPRT+++FGK  G   +I +G + 
Sbjct: 33  GAALSIATGKGELLSLPEPATAMFVADPAIADIQVPSPRTVFVFGKKAGTTTLIALGANH 92

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           + +L   ++++ D A L+  L        + V     ++++ G V +  D+   ++    
Sbjct: 93  RPILRKTVIVQVDTASLQGVLDSRFPQLKLSVSGAPGSLMVSGKVPSAADADAVMQSLTP 152

Query: 167 FLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGP 226
           +L             +K++N L ++   QV L+V + EV R+I +Q+G    I  SS G 
Sbjct: 153 YLHDK----------EKIVNRLTLSRPIQVNLRVRVTEVSRNITQQLG----INWSSLGG 198

Query: 227 SKSFAAD-FGGKFV----------SEGGDFSVKGVL--DRFSFETVLHALERATAIRTLA 273
           + +F    F G+ +          S  G FSV G     R+S + VL AL++   I  LA
Sbjct: 199 AGNFVGGLFNGRTLFDPTNGLFNLSPTGAFSVLGGFRAGRWSIDVVLDALDQEGLITMLA 258

Query: 274 EPTLTAISGQSASFTSGGQHLYKTV--SSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           EP LTA+SG++ASF +GG+         SSTGA +V    +GV L FTPTVL+  RI L+
Sbjct: 259 EPNLTAMSGETASFLAGGEIPIPVAQAGSSTGAITVEFKPFGVSLDFTPTVLADNRISLK 318

Query: 332 IQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           ++ EVSE      +      +P   VR+ DTTVEL SG +  + GLL+         IP 
Sbjct: 319 VRPEVSEIDTNNSVTTGGVKVPGLTVRRVDTTVELSSGQSFAIGGLLQSQTADTVSQIPG 378

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPV-------AMRDLSRP--DDHYSVED 438
           L ++PI+G LF +  F   +TE+ +  TP++V+P        A+  ++RP  D  ++V+ 
Sbjct: 379 LGRLPIIGRLFSSKNFQDNKTEVVVIVTPYIVQPTGPGQLEQAIDTVARPSSDLEFAVQH 438

Query: 439 D 439
           +
Sbjct: 439 N 439


>gi|307293450|ref|ZP_07573296.1| type II and III secretion system protein [Sphingobium
           chlorophenolicum L-1]
 gi|306881516|gb|EFN12732.1| type II and III secretion system protein [Sphingobium
           chlorophenolicum L-1]
          Length = 499

 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 139/430 (32%), Positives = 224/430 (52%), Gaps = 34/430 (7%)

Query: 33  NAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGK 92
           NAA  ++ D  I     +S+G +KVI L  P  + DV++ DP   DV V S   +YL  K
Sbjct: 36  NAAPASMQDNAI----LLSVGGSKVINL--PAKMSDVVIGDPDVVDVHVRSQNQLYLIAK 89

Query: 93  NVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVR 152
             G+  V     +GK + +  + +  ++  ++  L+  + ++ I V  ++  V+L G + 
Sbjct: 90  KAGETTVFATAINGKVLFSGTVRVGNNLTSIDDMLKLAMPNAEIAVNKMNGMVLLTGTIA 149

Query: 153 TIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQ 212
             +D+  A  L++ F+ +             V++ L  A   QV L+V IAEV +D+  +
Sbjct: 150 APEDAAEAERLTQAFVGKE----------VTVVSRLRTATPLQVNLQVKIAEVSKDVGHK 199

Query: 213 IGFQHS-----------ITGSSSGPSKSFAADFGG--KFVSEGGDFSVKGVLDRFSFE-- 257
           IG                 G  +  + +F +  GG   F ++GG +S+ GV      +  
Sbjct: 200 IGMNWKSQDLTGGKWAGGIGGGTRDAITFNSGGGGTFNFTADGG-YSLAGVARVLGLDLG 258

Query: 258 TVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLH 317
            VL   E +    TLA+P LT++SG++ASF +GG++ Y TVS+ T   S+    YGV L 
Sbjct: 259 AVLDLAESSGLATTLAQPNLTSLSGETASFLAGGEYPY-TVSNGTQGNSIEFKQYGVQLA 317

Query: 318 FTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           FTPTVL+ GRI LR++  VS  +    +  +P+ R R A+TTVEL SG   ++AGLL +D
Sbjct: 318 FTPTVLADGRISLRVRPTVSS-LDFSVSSSVPALRSRTAETTVELGSGQAFMIAGLLNND 376

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
                  +P +  +PILG+LF++  F R ETE+ I  TP+LVKP+   D+  P D +   
Sbjct: 377 TANNINKVPGIGNLPILGSLFKSRNFQRHETELVIVVTPYLVKPMNASDVRLPTDGFRNA 436

Query: 438 DDAKAFFFNR 447
           ++ +  F  +
Sbjct: 437 NEGQGLFLQQ 446


>gi|320324504|gb|EFW80581.1| type III secretion component, putative [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320328376|gb|EFW84379.1| type III secretion component, putative [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 429

 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 135/410 (32%), Positives = 207/410 (50%), Gaps = 24/410 (5%)

Query: 44  IGKGKK----ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANV 99
           I KG K    ++IG  +V+    PVD   V+V++P  AD+ V SP  +Y+FG+  GQ ++
Sbjct: 20  IAKGAKGTVDLAIGEGRVLHFSAPVD--SVMVAEPGIADLQVVSPGVIYVFGQAAGQTSL 77

Query: 100 ILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQR 159
           I +  DG++   L + +    A +   L+     S  R+      V+  G   ++QD   
Sbjct: 78  IALDSDGRETAALSLAVSSGTAAVTRPLKALHPQSQARINASGSRVIASG---SVQDVGE 134

Query: 160 AVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
           A +L+   LS  G+N       +  +N    AG  QV ++V  AEV R  L + G   + 
Sbjct: 135 ATDLN-ALLSTEGQN------FQSTVNSATYAGSAQVNIRVRFAEVSRSELLRYGVNWNA 187

Query: 220 ---TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPT 276
               G+ S    +  A             S        + + +L AL+    +  LAEP 
Sbjct: 188 LFNNGTFSFGLLTGGALAADAAGGASNVISAGLASGNVNIDAMLEALQSNGVLEVLAEPN 247

Query: 277 LTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           +TA++GQ+ASF +GG+ +   V  +     +    YGV L F+PT+L  GRI L+++ EV
Sbjct: 248 ITAMTGQTASFLAGGE-VAVPVPVNREVVGIEYKPYGVSLLFSPTLLPNGRIALQVRPEV 306

Query: 337 SE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           S       + VN   +PS+RVR+ADT VE+ SG T  +AGL + +  Q  + +P+L  +P
Sbjct: 307 SSLMSTTTLDVNGYQVPSFRVRRADTRVEVGSGQTFAIAGLFQHESSQDMDKVPMLGDMP 366

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
           ILG LFR+ RF R ETE+ I  TP+LV+PV  R ++ P D       A A
Sbjct: 367 ILGNLFRSKRFQRNETELVILITPYLVEPVKDRVVATPLDKQRAASTASA 416


>gi|56697919|ref|YP_168290.1| type II/III secretion system protein [Ruegeria pomeroyi DSS-3]
 gi|56679656|gb|AAV96322.1| bacterial type II/III secretion system protein [Ruegeria pomeroyi
           DSS-3]
          Length = 475

 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 128/451 (28%), Positives = 228/451 (50%), Gaps = 33/451 (7%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
           V+ G  + + + +N+ I+++      ++ +++   AD+   S RT+Y+ GK+ G   + L
Sbjct: 40  VKQGAAETLDVPMNRAIVVESETPFAELSIANAGIADISSLSDRTIYVLGKSPGLTTLSL 99

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
               G+ + N+++ +  D+A  +  L++ + +  I V   +D +VL G   +    QRA+
Sbjct: 100 FDAGGRLITNVNVRVSFDVAEFKERLKQILPNEKIEVRTANDGIVLSGTASSTARLQRAL 159

Query: 162 ELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG 221
           +L+E +            + ++V NL+++AG  QV LKV  AE++R + K +     ++G
Sbjct: 160 DLAERY------------APERVSNLMSVAGVQQVMLKVRFAEMQRSVSKSLSASLGVSG 207

Query: 222 -------SSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFS-----FETVLHALERATAI 269
                  ++   S S     GG   +   +     +L  FS        +L ALER   +
Sbjct: 208 GNIVGGLNTLNSSGSLTNAIGGSIPALNDN--AGAILFGFSAGSTQVRLLLEALERKGVV 265

Query: 270 RTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIG 329
           RTLAEP L+A+SGQ A F +GG++    V+   G  +V    +GV + F P V+    I 
Sbjct: 266 RTLAEPNLSALSGQEAKFLAGGEYPIP-VAQRDGLFTVEYKPFGVEMAFIPRVVDGDLIN 324

Query: 330 LRIQTEVS--EP--VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGI 385
           L +   VS  +P   + VN  D+ +++ R+  TTVEL  G +  +AGL++D+     + +
Sbjct: 325 LELLAAVSSLDPNNSVTVNGFDIAAFQRRETSTTVELKDGESFAIAGLIEDEFLDNNQQL 384

Query: 386 PLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           P L  +P+LGALFR++ + R +TE+ I  T  LV P     L+ P D      +A  F  
Sbjct: 385 PWLGDVPVLGALFRSANYQRSQTELVIIITAHLVSPTRGEALALPTDRVKPPSEADLFLR 444

Query: 446 NRVNKIYGPK--EASEVEGQNYKGAIGFIYK 474
            +  +    +   ASEV  Q++ G+ G++ +
Sbjct: 445 GKTARTERARGGAASEVARQDFSGSYGYVLE 475


>gi|99082186|ref|YP_614340.1| type II and III secretion system protein [Ruegeria sp. TM1040]
 gi|99038466|gb|ABF65078.1| Hypothetical 443 kDa protein y4xJ [Ruegeria sp. TM1040]
          Length = 497

 Score =  188 bits (478), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 125/460 (27%), Positives = 225/460 (48%), Gaps = 48/460 (10%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQAN 98
           IS ++ G    + + +N+ ++++  V   ++ +++P+ AD+   S RT+Y+ GK+ G   
Sbjct: 58  ISVLKKGTNAVLDVPMNRAVVVEADVPFAELSIANPSIADISSLSDRTIYVLGKSPGLTT 117

Query: 99  VILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQ 158
           + L+   G  + N+D+ +  D++  +  L++ + +  I V   +D +VL G V + Q  Q
Sbjct: 118 LTLLDGSGGLITNVDVRVAADVSEFKQRLQQILPNEKIEVRTANDGIVLSGTVSSAQRLQ 177

Query: 159 RAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
           RA++L+E +            +  +V NL+ + G  QV LKV  AE+ R + K +G    
Sbjct: 178 RALDLAERY------------APDRVSNLMTVGGIQQVMLKVRFAEMERSVSKSLGGSML 225

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKG---------------------VLDRFSFE 257
           I  S    +        G F + GG+ ++ G                      +    F 
Sbjct: 226 IRSSDGAIAT-------GSFQNRGGNGNIFGDSVTSPVQLQSETLGAALFGFDIGAVQFN 278

Query: 258 TVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLH 317
            +L ALE+   +RTLAEP L+A+SGQ A+F +GG++    V+   G  +V    +G+ L+
Sbjct: 279 VLLEALEQKGLVRTLAEPNLSALSGQEANFLAGGEYPVP-VAQEDGVITVEFKPFGIELN 337

Query: 318 FTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRV-----RKADTTVELPSGGTIVLAG 372
           F P V+    I L ++  VS  +   N+     + +     R+  TTVEL  G +  +AG
Sbjct: 338 FIPRVVDGDLINLELKAAVSA-IDTTNSATFDGFSINAFSRRETATTVELRDGESFAIAG 396

Query: 373 LLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDD 432
           L++D+ +     +P L  +P+LGALFR++ + R ++E+ I  +  LV P     L+ P D
Sbjct: 397 LIEDEFRDGAAQVPWLGDVPVLGALFRSADYARNQSELVIIVSAHLVTPTRGEALALPTD 456

Query: 433 HYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFI 472
                 +   F F +  +      A EV  Q++ G+ G++
Sbjct: 457 RIRPPSEKNLFLFGQTERAQA-GAAGEVANQDFNGSYGYL 495


>gi|254475652|ref|ZP_05089038.1| type II and III secretion system protein:Transport-associated
           [Ruegeria sp. R11]
 gi|214029895|gb|EEB70730.1| type II and III secretion system protein:Transport-associated
           [Ruegeria sp. R11]
          Length = 452

 Score =  188 bits (478), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 130/457 (28%), Positives = 230/457 (50%), Gaps = 49/457 (10%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
           V+ G    + + +N+ ++++  V   ++ +++P+ AD+   S RT+Y+ GK+ G  +   
Sbjct: 17  VKKGTSSNLEVPMNRAVVVESDVPFSELSIANPSIADISSLSDRTIYVLGKSPGPDHPHA 76

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
            G  G+ + N+D+ +  D++  +  LR+ +    I V   +D +VL G+V +    QRA+
Sbjct: 77  FGCVGRLITNVDVRVAADVSEFKERLRQILPGEKIEVRTANDGIVLSGVVSSSARLQRAL 136

Query: 162 ELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQ--------- 212
           +L+E +            +  +V NL+++ G  QV LKV  AE++R + K          
Sbjct: 137 DLAERY------------APDRVSNLMSVGGVQQVMLKVRFAEMQRTVSKSLSASLGVNG 184

Query: 213 ------------IGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVL 260
                       +  Q ++T S +G +   A D  G FV     F        F    +L
Sbjct: 185 GNSVGVNGGTSTLNTQGALTNSLTG-NIPAANDNTGAFV-----FGFNA--GAFQVNLLL 236

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
            ALE+   +RTLAEP L+A+SGQ A F +GG++    V+   G  ++    +G+ L+F P
Sbjct: 237 EALEQKGVVRTLAEPNLSALSGQEAKFLAGGEYPIP-VAQEDGVITIEFKPFGIELNFIP 295

Query: 321 TVLSPGRIGLRIQTEVS--EPV--IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD 376
            V+    I L ++  VS  +P   I +N   + ++  R++ TTVE+  G +  +AGL++D
Sbjct: 296 RVVDADVINLEMKAAVSAIDPTNSIELNGLSIAAFSRRESVTTVEMRDGESFAIAGLIRD 355

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSV 436
           + +     +P +  +P+LG+LFR++ + R +TE+ I  +  LV P     LS P D    
Sbjct: 356 EFRDNSSQLPWIGDVPVLGSLFRSANYQRAQTELVIIVSAHLVTPTRGEALSLPTDRIRP 415

Query: 437 EDDAKAFFFNRVNKIY-GPKEASEVEGQNYKGAIGFI 472
             +   F F  V +   GP  ASEV  Q++ G+ G++
Sbjct: 416 PSETDLFLFGNVARERKGP--ASEVAKQDFNGSYGYV 450


>gi|289624387|ref|ZP_06457341.1| type III secretion component, putative [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289646614|ref|ZP_06477957.1| type III secretion component, putative [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330868629|gb|EGH03338.1| type III secretion component [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 429

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 135/410 (32%), Positives = 207/410 (50%), Gaps = 24/410 (5%)

Query: 44  IGKGKK----ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANV 99
           I KG K    ++IG  +V+    PVD   V+V++P  AD+ V SP  +Y+FGK  GQ ++
Sbjct: 20  IAKGAKGTVDLAIGEGRVLHFSAPVD--SVMVAEPGIADLQVVSPGVIYVFGKAAGQTSL 77

Query: 100 ILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQR 159
           I +  +G++   L + +    A +   L+     S  R+      V+  G   ++QD   
Sbjct: 78  IALDSEGRETAALSLAVSSGTAAVTRPLKALHPQSQARINASGSRVIASG---SVQDVGE 134

Query: 160 AVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
           A +L+   LS  G+N       +  +N    AG  QV ++V  AEV R  L + G   + 
Sbjct: 135 ATDLN-ALLSTEGQN------FQSTVNSATYAGSAQVNIRVRFAEVSRSELLRYGVNWNA 187

Query: 220 ---TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPT 276
               G+ S    +  A             S        + + +L AL+    +  LAEP 
Sbjct: 188 LFNNGTFSFGLLTGGALAADAAGGASNVISAGLASGNVNIDAMLEALQSNGVLEVLAEPN 247

Query: 277 LTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           +TA++GQ+ASF +GG+ +   V  +     +    YGV L F+PT+L  GRI L+++ EV
Sbjct: 248 ITAMTGQTASFLAGGE-VAVPVPVNREVVGIEYKPYGVSLLFSPTLLPNGRIALQVRPEV 306

Query: 337 SE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           S       + VN   +PS+RVR+ADT VE+ SG T  +AGL + +  Q  + +P+L  +P
Sbjct: 307 SSLMSTTTLDVNGYQVPSFRVRRADTRVEVGSGQTFAIAGLFQRESSQDMDKVPMLGDMP 366

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
           ILG LFR+ RF R ETE+ I  TP+LV+PV  R ++ P D       A A
Sbjct: 367 ILGNLFRSKRFQRNETELVILITPYLVEPVKDRVVATPLDKQRAASTASA 416


>gi|296284552|ref|ZP_06862550.1| type II and III secretion system protein [Citromicrobium
           bathyomarinum JL354]
          Length = 502

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 142/451 (31%), Positives = 219/451 (48%), Gaps = 52/451 (11%)

Query: 26  LPPIKEANAAVINISDV--EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHS 83
           +P + +A + V    D+   IGKG+          ++ VP  + DV +++ + AD+ V S
Sbjct: 15  VPTMADAQSVVRPTQDIVLSIGKGE----------LINVPGSMADVFIANDSIADIQVKS 64

Query: 84  PRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVE-MVS 142
            R +YLFGK+ G+  V      G  +   ++ +  +I  L+  L   +  + I V  M S
Sbjct: 65  QRQLYLFGKSGGETTVYASNAAGDVIWAANVRVGSNIGSLDQMLALAMPQAKISVATMGS 124

Query: 143 DTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTI 202
           +TV+L G V   +D+  A  L   FL               V+  L  A   QV L+V  
Sbjct: 125 NTVLLTGTVANPEDAAEAERLVSAFLGDE----------TNVIARLTTATPLQVNLQVRF 174

Query: 203 AEVRRDILKQIG-----------FQHSIT-GSSSGPS----------KSFAADFGGKFVS 240
           AEV R +++ IG           FQ  +T G +  P            +  +D       
Sbjct: 175 AEVSRSLVRAIGANLLSSDATNGFQFGVTRGRNFAPQYTPGGPVGVGVTGGSDGSTVITG 234

Query: 241 EGGDFSVKGVLDRFSFE--TVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV 298
            G   ++ G+   F  +    L   E    + TL++P LTA+SG++A F +GG+     +
Sbjct: 235 NGTGATIAGLGSLFGMDLAAALDLAETNGLVSTLSQPNLTALSGETADFLAGGEFPIP-I 293

Query: 299 SSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVR 354
           S   GATSV   +YGV L +TPTVL+ GRI +R+  EVSE      + ++   +P+   R
Sbjct: 294 SQGLGATSVEYRNYGVKLTYTPTVLANGRISIRVSPEVSELSSQGAVSLDGVQIPALITR 353

Query: 355 KADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAA 414
           +A TTVEL SG + ++AGL+ ++ Q   +  P L  +PILG LFR++ F + ETE+ I  
Sbjct: 354 RASTTVELGSGQSFMIAGLMTNNSQSTIDKAPGLGDVPILGNLFRSNSFRKGETELVIVI 413

Query: 415 TPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           TP+LVKPV   D+  P D Y+  D      F
Sbjct: 414 TPYLVKPVDGNDIRLPTDGYNSPDTLSQLGF 444


>gi|197295153|ref|YP_002153694.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
 gi|195944632|emb|CAR57236.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
          Length = 644

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 124/407 (30%), Positives = 213/407 (52%), Gaps = 18/407 (4%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++ L K +++ +P  V++  + +P  A   + SP+T+Y+ G  VG  N+I+ G  G   
Sbjct: 100 VAVPLGKSLLVPMPEPVRNRTIGNPAVAQATMVSPQTLYILGLAVGTTNMIVQGKSGACR 159

Query: 110 LNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +D+ +  D   L+ +L + + +  +I V   + T+VL G V + Q +Q+AV+++  + 
Sbjct: 160 V-IDVAVGADAGGLQASLLQLMPNERDIHVSTAAGTIVLAGTVSSSQAAQQAVQIAHAYG 218

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK 228
             +G           V+N+LN+    QV L+V +AEV + ++ Q+G   +I G     S 
Sbjct: 219 DSAGDAAGGGKQGGGVLNMLNVTSPQQVMLEVKVAEVSKTLINQMGSAFNIQGGFGSWSG 278

Query: 229 SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
           +  ++     V+ G  F+     +   F     A      ++ LAEP L  ISGQ A+F 
Sbjct: 279 ALVSNLLAG-VASGAVFNKA---NNRPFSIAADAQNTDNLVKILAEPNLVTISGQEATFL 334

Query: 289 SGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEVSE------P 339
           +GG+       SS   TS  T    ++GV L FTPTVL+ GRI L++  EVSE       
Sbjct: 335 AGGKIFIPIPQSSGNGTSSITLQEEEFGVALKFTPTVLANGRISLKVAPEVSELSQTGVT 394

Query: 340 VIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
           +   N G    +P    R+A TTV++  G +  + GL+KD+     + IP + ++P+LGA
Sbjct: 395 LSATNIGGTSILPLITTRRASTTVQMSDGESFAIGGLIKDNATGALKAIPGVGEVPVLGA 454

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           LFR++ F ++ TE+    TP LVKP+   D++ P D +S  ++   +
Sbjct: 455 LFRSTSFQQDRTELIFLITPHLVKPLQTADVALPTDSFSKPNEVDVY 501


>gi|83716099|ref|YP_440456.1| type II and III secretion system protein [Burkholderia
           thailandensis E264]
 gi|83649924|gb|ABC33988.1| Bacterial type II and III secretion system protein domain protein
           [Burkholderia thailandensis E264]
          Length = 679

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 130/421 (30%), Positives = 219/421 (52%), Gaps = 31/421 (7%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
           +G+   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ G
Sbjct: 96  MGESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQG 155

Query: 104 HDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAVE 162
             G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV 
Sbjct: 156 KSGACRI-IDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAVA 214

Query: 163 LSETFLSQSGRNQYANSSSKK---VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
           +++ +  ++               V+N+L +    QV L+V +AEV + ++ Q+G   ++
Sbjct: 215 IAKAYSDRTNAGALGGGGGGTRAGVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNL 274

Query: 220 TGSSSGPSKSFAADF-----GGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAE 274
            G     + +           G  VS+     + G +D         A      ++ LAE
Sbjct: 275 QGGFGSWTGALVTSLLTGVGNGIAVSKSNKLPLNGSID---------AQNTDQPVKILAE 325

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLR 331
           P L  ISGQ A+F +GG+       SS   TS  T    ++GV L FTPTVLS GRI L+
Sbjct: 326 PRLVTISGQEATFLAGGKIFIPVPQSSGVGTSTITLQQEEFGVGLKFTPTVLSNGRINLK 385

Query: 332 IQTEVSE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLK 382
           +  EVSE       +   N G    +P    R+A TTV++  G T  + GL+KD+ Q   
Sbjct: 386 VAPEVSELSPTGVTLSAANVGGVSILPLITTRRASTTVQMNDGETFAIGGLIKDNAQGTL 445

Query: 383 EGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
           + +P + ++P+LGALFR++ F ++ TE+    TP LVKP+A  D+  P D ++  ++A  
Sbjct: 446 KALPGIGELPVLGALFRSTSFQQDRTELVFIITPHLVKPLAAADVPLPTDSFTQPNEADV 505

Query: 443 F 443
           +
Sbjct: 506 Y 506


>gi|167617230|ref|ZP_02385861.1| Bacterial type II and III secretion system protein domain protein
           [Burkholderia thailandensis Bt4]
          Length = 468

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 130/421 (30%), Positives = 219/421 (52%), Gaps = 31/421 (7%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
           +G+   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ G
Sbjct: 17  MGESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQG 76

Query: 104 HDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAVE 162
             G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV 
Sbjct: 77  KSGACRI-IDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAVA 135

Query: 163 LSETFLSQSGRNQYANSSSKK---VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
           +++ +  ++               V+N+L +    QV L+V +AEV + ++ Q+G   ++
Sbjct: 136 IAKAYSDRTNAGALGGGGGGTRAGVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNL 195

Query: 220 TGSSSGPSKSFAADF-----GGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAE 274
            G     + +           G  VS+     + G +D         A      ++ LAE
Sbjct: 196 QGGFGSWTGALVTSLLTGVGNGIAVSKSNKLPLNGSID---------AQNTDQPVKILAE 246

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLR 331
           P L  ISGQ A+F +GG+       SS   TS  T    ++GV L FTPTVLS GRI L+
Sbjct: 247 PRLVTISGQEATFLAGGKIFIPVPQSSGVGTSTITLQQEEFGVGLKFTPTVLSNGRINLK 306

Query: 332 IQTEVSE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLK 382
           +  EVSE       +   N G    +P    R+A TTV++  G T  + GL+KD+ Q   
Sbjct: 307 VAPEVSELSPTGVTLSAANVGGVSILPLITTRRASTTVQMNDGETFAIGGLIKDNAQGTL 366

Query: 383 EGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
           + +P + ++P+LGALFR++ F ++ TE+    TP LVKP+A  D+  P D ++  ++A  
Sbjct: 367 KALPGIGELPVLGALFRSTSFQQDRTELVFIITPHLVKPLAAADVPLPTDSFTQPNEADV 426

Query: 443 F 443
           +
Sbjct: 427 Y 427


>gi|167579115|ref|ZP_02371989.1| Bacterial type II and III secretion system protein domain protein
           [Burkholderia thailandensis TXDOH]
          Length = 462

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 130/421 (30%), Positives = 219/421 (52%), Gaps = 31/421 (7%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
           +G+   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ G
Sbjct: 17  MGESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQG 76

Query: 104 HDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAVE 162
             G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV 
Sbjct: 77  KSGACRI-IDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAVA 135

Query: 163 LSETFLSQSGRNQYANSSSKK---VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
           +++ +  ++               V+N+L +    QV L+V +AEV + ++ Q+G   ++
Sbjct: 136 IAKAYSDRTNAAALGGGGGGPRAGVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNL 195

Query: 220 TGSSSGPSKSFAADF-----GGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAE 274
            G     + +           G  VS+     + G +D         A      ++ LAE
Sbjct: 196 QGGFGSWTGALVTSLLTGVGNGIAVSKSNKLPLNGSID---------AQNTDQPVKILAE 246

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLR 331
           P L  ISGQ A+F +GG+       SS   TS  T    ++GV L FTPTVLS GRI L+
Sbjct: 247 PRLVTISGQEATFLAGGKIFIPVPQSSGVGTSTITLQQEEFGVGLKFTPTVLSNGRINLK 306

Query: 332 IQTEVSE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLK 382
           +  EVSE       +   N G    +P    R+A TTV++  G T  + GL+KD+ Q   
Sbjct: 307 VAPEVSELSPTGVTLSAANVGGVSILPLITTRRASTTVQMNDGETFAIGGLIKDNAQGTL 366

Query: 383 EGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
           + +P + ++P+LGALFR++ F ++ TE+    TP LVKP+A  D+  P D ++  ++A  
Sbjct: 367 KALPGIGELPVLGALFRSTSFQQDRTELVFIITPHLVKPLAAADVPLPTDSFTQPNEADV 426

Query: 443 F 443
           +
Sbjct: 427 Y 427


>gi|170734868|ref|YP_001773982.1| type II and III secretion system protein [Burkholderia cenocepacia
           MC0-3]
 gi|169820906|gb|ACA95487.1| type II and III secretion system protein [Burkholderia cenocepacia
           MC0-3]
          Length = 646

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 127/407 (31%), Positives = 217/407 (53%), Gaps = 19/407 (4%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++ L K +++ +P  V++  + +P  A   + SP+T+Y+ G  VG  N+I+ G  G   
Sbjct: 100 VAVPLGKSLLVPMPEPVRNRTIGNPAVAQATMVSPQTLYILGLAVGTTNMIVQGRSGACR 159

Query: 110 LNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +D+ +  D   L+ +L + + +  +I V   + T+VL G V + Q +Q+AV+++  + 
Sbjct: 160 V-IDVAVGADAGGLQASLLQLMPNERDIHVSTAAGTIVLAGTVSSSQAAQQAVQIAHAYG 218

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK 228
             +G +         V+N+LN+    QV L+V +AEV + ++ Q+G   +I G     S 
Sbjct: 219 DSAG-DAAGGKQGGGVLNMLNVTSPQQVMLEVKVAEVSKTLINQMGSAFNIQGGFGSWSG 277

Query: 229 SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
           +  ++     V+ G  F+     +   F     A      ++ LAEP L  ISGQ A+F 
Sbjct: 278 ALVSNLLAG-VASGAVFNKA---NNKPFSIAADAQNTDNLVKILAEPNLVTISGQEATFL 333

Query: 289 SGGQHLYKTV-SSSTGATSVTTHD--YGVVLHFTPTVLSPGRIGLRIQTEVSE-PVIGV- 343
           +GG+       S S G +S+T  +  +GV L FTPTVL+ GRI L++  EVSE    GV 
Sbjct: 334 AGGKIFIPIPQSGSNGVSSITLQEEEFGVALKFTPTVLANGRISLKVAPEVSELSQTGVT 393

Query: 344 ----NAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
               N G    +P    R+A TTV++  G +  + GL+KD+     + IP + ++P+LGA
Sbjct: 394 LSASNIGGTSILPLITTRRASTTVQMSDGESFAIGGLIKDNASGALKAIPGVGEVPVLGA 453

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           LFR++ F ++ TE+    TP LVKP+   D++ P D +S  ++   F
Sbjct: 454 LFRSTSFQQDRTELIFLITPHLVKPLQTADVALPTDSFSKPNEVDVF 500


>gi|46580524|ref|YP_011332.1| type II/III secretion system protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602159|ref|YP_966559.1| type II and III secretion system protein [Desulfovibrio vulgaris
           DP4]
 gi|46449943|gb|AAS96592.1| type II/III secretion system protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120562388|gb|ABM28132.1| type II and III secretion system protein [Desulfovibrio vulgaris
           DP4]
 gi|311234263|gb|ADP87117.1| type II and III secretion system protein [Desulfovibrio vulgaris
           RCH1]
          Length = 484

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 130/427 (30%), Positives = 209/427 (48%), Gaps = 51/427 (11%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           +++ G + V+    PV    + ++D   A VVV SP+ +Y+ GK  G   + L    G  
Sbjct: 44  QVATGKSSVVSTSRPVG--RLAIADEAIAGVVVLSPQQVYVTGKKAGTTTLTLWDGGGAV 101

Query: 109 MLNLDILIERDIAHLEMTLRRFIADSN-IRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
           +   D+ +  DIA L+  L R +   N I V  V+DTV L G VR+      A++++  +
Sbjct: 102 IGVYDVQVTPDIAQLKEMLHRVLPGENDIMVMGVNDTVTLAGTVRSAASMTTAMDMARLY 161

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG--FQHSITGS--- 222
                       +  KV NL+ + G  QV L+V +AE+RR++++++G    ++  G    
Sbjct: 162 ------------APDKVTNLMQVGGVHQVMLEVKVAEMRRNVMERLGIDLTYAWRGDFIF 209

Query: 223 ----------------SSGPSKS-FAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
                            +GPS +  + +  G F    G  S+ G LD          L++
Sbjct: 210 GMLNQLFTLDSQKGVVDAGPSGAVLSPNVNGAFRITSGQVSIMGFLD---------VLKQ 260

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
              ++ LAEPTL   SG+ A F +GG+ +   V    G  ++   ++GV L F PTV+  
Sbjct: 261 NGLVKVLAEPTLVCRSGEKAEFLAGGE-IPIPVPQGLGTVAIEYKEFGVTLQFLPTVVGD 319

Query: 326 GRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
           GRI +++  EVSE     V+ +    +P+   R+A TTVEL  G +  +AGLL+DD++Q 
Sbjct: 320 GRISMKVAPEVSELDYTNVVQIQGFTIPAITSRRASTTVELADGQSFAIAGLLRDDVRQA 379

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
               P+L  +P+LG LFR+S + + ETE+ I  TP L KP+       P D Y      +
Sbjct: 380 VNKYPVLGDMPVLGTLFRSSNWQKNETELVIIVTPHLAKPLEANATRLPTDAYREPSAFE 439

Query: 442 AFFFNRV 448
            F   R+
Sbjct: 440 YFILGRM 446


>gi|107028248|ref|YP_625343.1| type II and III secretion system protein [Burkholderia cenocepacia
           AU 1054]
 gi|116687159|ref|YP_840406.1| type II and III secretion system protein [Burkholderia cenocepacia
           HI2424]
 gi|105897412|gb|ABF80370.1| type II and III secretion system protein [Burkholderia cenocepacia
           AU 1054]
 gi|116652874|gb|ABK13513.1| type II and III secretion system protein [Burkholderia cenocepacia
           HI2424]
          Length = 642

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 127/407 (31%), Positives = 217/407 (53%), Gaps = 19/407 (4%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++ L K +++ +P  V++  + +P  A   + SP+T+Y+ G  VG  N+I+ G  G   
Sbjct: 100 VAVPLGKSLLVPMPEPVRNRTIGNPAVAQATMVSPQTLYILGLAVGTTNMIVQGRSGACR 159

Query: 110 LNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +D+ +  D   L+ +L + + +  +I V   + T+VL G V + Q +Q+AV+++  + 
Sbjct: 160 V-IDVAVGADAGGLQASLLQLMPNERDIHVSTAAGTIVLAGTVSSSQAAQQAVQIAHAYG 218

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK 228
             +G +         V+N+LN+    QV L+V +AEV + ++ Q+G   +I G     S 
Sbjct: 219 DSAG-DAAGGKQGGGVLNMLNVTSPQQVMLEVKVAEVSKTLINQMGSAFNIQGGFGSWSG 277

Query: 229 SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
           +  ++     V+ G  F+     +   F     A      ++ LAEP L  ISGQ A+F 
Sbjct: 278 ALVSNLLAG-VASGAVFNKA---NNKPFSIAADAQNTDNLVKILAEPNLVTISGQEATFL 333

Query: 289 SGGQHLYK-TVSSSTGATSVTTHD--YGVVLHFTPTVLSPGRIGLRIQTEVSE-PVIGV- 343
           +GG+       S S G +S+T  +  +GV L FTPTVL+ GRI L++  EVSE    GV 
Sbjct: 334 AGGKIFIPIPQSGSNGVSSITLQEEEFGVALKFTPTVLANGRISLKVAPEVSELSQTGVT 393

Query: 344 ----NAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
               N G    +P    R+A TTV++  G +  + GL+KD+     + IP + ++P+LGA
Sbjct: 394 LSASNIGGTSILPLITTRRASTTVQMSDGESFAIGGLIKDNASGALKAIPGVGEVPVLGA 453

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           LFR++ F ++ TE+    TP LVKP+   D++ P D +S  ++   F
Sbjct: 454 LFRSTSFQQDRTELIFLITPHLVKPLQTADVALPTDSFSKPNEVDVF 500


>gi|16520026|ref|NP_444146.1| outermembrane protein RhcC2; component of type III secretion
           apparatus [Sinorhizobium fredii NGR234]
 gi|2495099|sp|P55702|Y4XJ_RHISN RecName: Full=Uncharacterized protein y4xJ
 gi|2182718|gb|AAB91933.1| outermembrane protein RhcC2; component of type III secretion
           apparatus [Sinorhizobium fredii NGR234]
          Length = 423

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 128/384 (33%), Positives = 193/384 (50%), Gaps = 20/384 (5%)

Query: 60  LQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERD 119
           + +P     + V+DPT AD    S RT+++FGK  G+ ++  +  +G+ +  L +++ + 
Sbjct: 23  VHLPAPAATIFVADPTIADYQAPSNRTIFVFGKKFGRTSLFALDENGEALAELHVVVTQP 82

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANS 179
           IA L   LR  + D  I V       +L G     +    A  ++E FL           
Sbjct: 83  IADLRAMLRDQVGDYPIHVSYTPRGAILSGTAPNAEVVDIAKRVTEQFLGDGA------- 135

Query: 180 SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG---G 236
               ++N + +AG  QV L V +AEV R  LK +G   S  G   G  K    + G   G
Sbjct: 136 ---PIVNNIKVAGSLQVNLSVRVAEVSRSGLKALGINLSAFGQF-GNFKVGVLNRGAGLG 191

Query: 237 KFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYK 296
                GG   +    D  S   VL AL +      LAEP LTA+SG++ASF +GG+    
Sbjct: 192 SATGSGGTAEIGFDNDAVSVGAVLDALAKEHIASVLAEPNLTAMSGETASFLAGGEFPIP 251

Query: 297 TVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYR 352
            +  + G TSV    +GV L F PTVL    I + ++ EVSE      + VN   +P+  
Sbjct: 252 VLQEN-GQTSVEFRRFGVSLEFVPTVLDNNLINIHVKPEVSELSLQGAVQVNGIAVPAVS 310

Query: 353 VRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFI 412
            R+ADT VEL SG + V+ GL++ ++       P L +IPILGALFR+S F +EE+E+ I
Sbjct: 311 TRRADTVVELASGQSFVIGGLIRRNVNNDISAFPWLGRIPILGALFRSSSFQKEESELVI 370

Query: 413 AATPFLVKPVAMRD-LSRPDDHYS 435
             TP++V+P +  + +S P D  +
Sbjct: 371 LVTPYIVRPGSNPNQMSAPTDRMA 394


>gi|167841781|ref|ZP_02468465.1| type II/III secretion system protein [Burkholderia thailandensis
           MSMB43]
          Length = 433

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 125/395 (31%), Positives = 206/395 (52%), Gaps = 36/395 (9%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           ++++P     V V+DP  ADV V +P+ +++ GK  G   +  +G + + +L   ++++ 
Sbjct: 20  MVKLPEPAVAVFVADPDVADVHVPTPQAVFVLGKKAGTTTLFALGANNRTILRETVVVDV 79

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           D   L+  L       ++ +     ++++ G V +  D+    +  + +L Q        
Sbjct: 80  DTPSLQRILDARFPQLHLTLAGAPGSLMVSGRVPSAADADAVAQTLKPYLRQQ------- 132

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKF 238
              + ++N L +A   QV L+V I EV R+I +Q+G   S  G+S          F G+ 
Sbjct: 133 ---ESLVNRLTLARPIQVHLRVRITEVDRNITQQLGINWSALGASG---NFVGGLFNGRT 186

Query: 239 V----------SEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPTLTAISGQSAS 286
           +          S  G FSV G     R+S + VL AL++   I  LAEP LTAISGQ+AS
Sbjct: 187 LFDTASKAFDLSPSGAFSVLGGFHTSRYSIDGVLDALDQEGLITMLAEPNLTAISGQTAS 246

Query: 287 FTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PVIGVN 344
           F +GG+        +TGA ++    YGV L FTPTVL+  RI L+++ EVSE  P   V 
Sbjct: 247 FLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLADNRISLKVRPEVSEIDPTNSVT 306

Query: 345 AGDM--PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
            G +  P+  VR+ DTTVEL SG +  + GLL+     +   +P L+++P+LG LF +  
Sbjct: 307 TGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDVLAELPGLARLPVLGKLFSSRN 366

Query: 403 FNREETEIFIAATPFLVKPV-------AMRDLSRP 430
           +  ++TE+ +  TP++V+P        A+ D++RP
Sbjct: 367 YLNDKTEVVVIVTPYIVQPANPGELHDALDDVTRP 401


>gi|330985203|gb|EGH83306.1| type III secretion component [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 429

 Score =  187 bits (475), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 134/410 (32%), Positives = 207/410 (50%), Gaps = 24/410 (5%)

Query: 44  IGKGKK----ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANV 99
           I KG K    ++IG  +V+    P+D   V+V++P  AD+ V SP  +Y+FGK  GQ ++
Sbjct: 20  IAKGAKGTVDLAIGEGRVLHFSAPLD--SVMVAEPGIADLQVVSPGVIYVFGKAAGQTSL 77

Query: 100 ILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQR 159
           I +  +G++   L + +    A +   L+     S  R+      V+  G   ++QD   
Sbjct: 78  IALDSEGRETAALSLAVSSSTAAVTRPLKALHPQSQARINASGSRVIASG---SVQDVGE 134

Query: 160 AVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
           A +L+   LS  G+N       +  +N    AG  QV ++V  AEV R  L + G   + 
Sbjct: 135 ATDLN-ALLSTEGQN------FQSTVNSATYAGSAQVNIRVRFAEVSRSELLRYGVNWNA 187

Query: 220 ---TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPT 276
               G+ S    +  A             S        + + +L AL+    +  LAEP 
Sbjct: 188 LFNNGTFSFGLLTGGALAADAAGGASNVISAGLASGNVNIDAMLEALQSNGVLEVLAEPN 247

Query: 277 LTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           +TA++GQ+ASF +GG+ +   V  +     +    YGV L F+PT+L  GRI L+++ EV
Sbjct: 248 ITAMTGQTASFLAGGE-VAVPVPVNREVVGIEYKPYGVSLLFSPTLLPNGRIALQVRPEV 306

Query: 337 SE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           S       + VN   +PS+RVR+ADT VE+ SG T  +AGL + +  Q  + +P+L  +P
Sbjct: 307 SSLMSTTTLDVNGYQVPSFRVRRADTRVEVGSGQTFAIAGLFQRESSQDMDKVPMLGDMP 366

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
           ILG LFR+ RF R ETE+ I  TP+LV+PV  R ++ P D       A A
Sbjct: 367 ILGNLFRSKRFQRNETELVILITPYLVEPVKDRVVATPLDKQRAASTASA 416


>gi|126737254|ref|ZP_01752989.1| bacterial type II/III secretion system protein [Roseobacter sp.
           SK209-2-6]
 gi|126721839|gb|EBA18542.1| bacterial type II/III secretion system protein [Roseobacter sp.
           SK209-2-6]
          Length = 446

 Score =  187 bits (475), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 136/462 (29%), Positives = 233/462 (50%), Gaps = 35/462 (7%)

Query: 26  LPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPR 85
           LP  + A A  + +  V+ G    + + +N+ I+++      ++ +++P  AD+   S R
Sbjct: 3   LPVAEPAQANGLRV--VKQGTSITLDVPMNRAIVVESDAPFAELSIANPNIADISSLSDR 60

Query: 86  TMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTV 145
           T+Y+ GK+ G   + L+   GK + N+++ +  D++  +  LR+ +    I V   +D +
Sbjct: 61  TIYVLGKSPGLTTLTLLDGAGKLITNVNVRVAADVSEFKERLRQILPGEKIEVRTANDGI 120

Query: 146 VLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEV 205
           VL G V +    QRA++L+E +            + ++V NL+++ G  QV LKV  AE+
Sbjct: 121 VLSGTVSSSARLQRALDLAERY------------APERVSNLMSVGGVQQVMLKVRFAEM 168

Query: 206 RRDILK----QIGFQHSITGSSSGPSKSFAADFGGKF----VSEGGDFSVKGVLDRFSFE 257
            R + K     + F +S  G   G + ++     G      V++G + +V       SF 
Sbjct: 169 ERSVSKTLSSSLAFGNS--GDVIGETGTWLDGNNGLGNPVQVTQGTEGAVAISFGAGSFR 226

Query: 258 --TVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVV 315
              +L ALE+   +RTLAEP L+A+SGQ ASF +GG++    V +      +    +G+ 
Sbjct: 227 VGVLLEALEQKGIVRTLAEPNLSALSGQEASFLAGGEYPIPVVDAD--GIGIEYKPFGIE 284

Query: 316 LHFTPTVLSPGRIGLRIQTEVS--EPVIGV--NAGDMPSYRVRKADTTVELPSGGTIVLA 371
           L F P V+    I L ++  VS  +P   V  N   +  +  R   TTVEL  G +  +A
Sbjct: 285 LDFIPRVVDQDVINLELEAVVSAIDPTTTVVQNGLTINGFTRRATSTTVELRDGESFAIA 344

Query: 372 GLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           GL++D+       +P +  IPI+GALFR++ + RE+TE+ I  +  LV P     L+ P 
Sbjct: 345 GLVQDEFTDSNGQVPWVGDIPIIGALFRSASYQREQTELVIIVSAHLVTPTRGEALTLPT 404

Query: 432 DHYSVEDDAKAFFFNRV-NKIYGPKEASEVEGQNYKGAIGFI 472
           D      + + F F R  +   GP   +EV GQ+Y G+ G++
Sbjct: 405 DRVKPPSENELFLFGRTEHNRSGP--VNEVAGQDYNGSYGYV 444


>gi|85705151|ref|ZP_01036251.1| bacterial type II/III secretion system protein [Roseovarius sp.
           217]
 gi|85670473|gb|EAQ25334.1| bacterial type II/III secretion system protein [Roseovarius sp.
           217]
          Length = 428

 Score =  187 bits (475), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 129/441 (29%), Positives = 215/441 (48%), Gaps = 37/441 (8%)

Query: 54  LNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLD 113
           +N+ ++++      ++ +++P  AD    S RT+Y+ GK  G+  + L    G+ + N+D
Sbjct: 1   MNRAVVVESDSPFAELSIANPAIADFSTLSDRTIYVLGKTPGRTTLSLFDGAGQLITNID 60

Query: 114 ILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGR 173
           + +  DI   +  L++ +    I V   +D +V+ G V +    QRA++L+E +      
Sbjct: 61  VHVSTDIEEFKERLKQILPGEPIEVRSANDGIVISGTVSSSSRMQRALDLAERY------ 114

Query: 174 NQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAAD 233
                 + ++V NL++++G+ QV LKV  AE++R + K +    SI    +     F   
Sbjct: 115 ------APERVSNLMSVSGKQQVMLKVRFAEMQRSVSKALSTSLSIDARGANQVGVFGGT 168

Query: 234 -----FGGKFVSEGGDFSVKGVLDR-----FSFET-------VLHALERATAIRTLAEPT 276
                 GG   S  G  ++ G  D      F F+        +L ALE    +RTLAEP 
Sbjct: 169 NTTNTLGGVLGSTAG--TIPGANDNNGVFNFGFDVGSVEVGILLEALETKGVVRTLAEPN 226

Query: 277 LTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           LTA+SGQ A F +GG+     V+     T+V    +GV L+F P V+  G I L +   V
Sbjct: 227 LTALSGQEAKFLAGGEFPVP-VAQDNDTTTVEFKPFGVELNFVPRVVDDGIINLEMAAAV 285

Query: 337 SE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           S       +  +   +P++R R   TTV L  G +  +AGLL+DD +     +P L  +P
Sbjct: 286 SSIDTSNSLVSDGFSIPAFRRRDTSTTVALRDGESFAIAGLLQDDFRDNAGQVPWLGDVP 345

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV-NKI 451
           +LGALFR++ + R +TE+ I  +  LV P     L+ P D   +  +   F   RV N +
Sbjct: 346 VLGALFRSADYQRSQTELVIIVSAHLVSPSRGEALALPTDRVKLPSEKDLFLNGRVANGV 405

Query: 452 YGPKEASEVEGQNYKGAIGFI 472
                  EV  Q++ G+ G++
Sbjct: 406 SDRGAVGEVAKQDFTGSYGYV 426


>gi|91788411|ref|YP_549363.1| type II and III secretion system protein [Polaromonas sp. JS666]
 gi|91697636|gb|ABE44465.1| type II and III secretion system protein [Polaromonas sp. JS666]
          Length = 514

 Score =  187 bits (475), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 146/488 (29%), Positives = 247/488 (50%), Gaps = 42/488 (8%)

Query: 16  LFSSNPSVAKLPPIKEANAA----VINISDVEI-GK---GKKISIGLNKVIILQVPVDVQ 67
           L + NP  A   P K+A  A    V+  +   I GK     +I++   K  ++++P    
Sbjct: 40  LAAKNPPTATSGPGKQAATAQPKAVVTQARAPITGKVELAPQINLSEGKSTLMRLPSPAT 99

Query: 68  DVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTL 127
            + V D    DV++ +P  +Y+ GK+VG  N+IL        + +DI +  D   L   L
Sbjct: 100 RLSVGDARIVDVILLNPSELYMLGKSVGSTNLILWNKANDATI-IDIAVGMDTVALRSRL 158

Query: 128 RR-FIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS------ 180
            + F ++ ++++   +DT++L GMV  +  + + + ++  ++ +S R+  A  +      
Sbjct: 159 EQMFASEKDLKITTAADTLILSGMVSDVVKADQILSVANAYVQRSSRSGQAGGASGGSAG 218

Query: 181 -----SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG 235
                S KV+N+L+IA   QV L+V +AEV + +  Q+G   SI G  +  + S+     
Sbjct: 219 GQQSDSAKVVNMLSIAAPQQVMLEVQVAEVSKTLADQLG--ASIGGRKT--TGSWTYTLL 274

Query: 236 GKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLY 295
              ++ G   S+  V +  +F T+  A +    ++ LAEPT+ AISGQ ASF +GG+   
Sbjct: 275 SNLLT-GAASSIGAVKNSGNFLTI-DAQKGDGLLKILAEPTIMAISGQEASFLAGGKIFI 332

Query: 296 KTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE---PVIGVNAGD----- 347
              S + G  ++   ++GV + F PTVL  GRI L++  EVS+     +G++A       
Sbjct: 333 PVKSGNNGEIALEEKEFGVSVKFLPTVLEGGRINLKVAPEVSDLNRQGVGISATGSSTTA 392

Query: 348 -MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNRE 406
            +PS+  R+A TTV+L  G +  + GL+K+++       PLL ++P+LGALFR+S F  +
Sbjct: 393 ILPSFTTRRASTTVQLFDGQSFAIGGLIKNNVTANINAFPLLGEVPVLGALFRSSDFQTD 452

Query: 407 ETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYK 466
            +E+    TP LVKP+   D   P D Y ++     FF     +   P E ++  G    
Sbjct: 453 RSELVFIVTPHLVKPLPA-DYKLPTDPY-IQPSRSEFFLGGKMEGAAPPEGNKPAGP--- 507

Query: 467 GAIGFIYK 474
            A GF  K
Sbjct: 508 -ATGFEVK 514


>gi|83943939|ref|ZP_00956396.1| bacterial type II/III secretion system protein [Sulfitobacter sp.
           EE-36]
 gi|83954512|ref|ZP_00963223.1| bacterial type II/III secretion system protein [Sulfitobacter sp.
           NAS-14.1]
 gi|83840796|gb|EAP79967.1| bacterial type II/III secretion system protein [Sulfitobacter sp.
           NAS-14.1]
 gi|83845186|gb|EAP83066.1| bacterial type II/III secretion system protein [Sulfitobacter sp.
           EE-36]
          Length = 479

 Score =  187 bits (475), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 127/458 (27%), Positives = 230/458 (50%), Gaps = 44/458 (9%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
           V+ G  + + + +N+ ++++  +   ++ +++P  AD+   S RT+Y+ GK+ G   + L
Sbjct: 37  VKKGTNRVLEVPMNRAVVVESDIPFAELSIANPGIADISSLSDRTIYVLGKSPGLTTLTL 96

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           +   G+ + N+D+ +  D++  +  LR+ +    I V   +D +VL G+V + Q  QRA+
Sbjct: 97  LDAAGQLITNVDVRVAADVSEFKERLRQILPGEKIEVRTANDGIVLSGIVSSTQRLQRAL 156

Query: 162 ELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG 221
           +L+E +            + ++V NL+++ G  QV +KV  AE+ R + K +    ++ G
Sbjct: 157 DLAERY------------APERVSNLMSVGGIQQVMMKVRFAEMSRSVSKSLSASLALNG 204

Query: 222 ------------SSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFET-------VLHA 262
                       +++  + + A   GG   +   + +   VL  F F         +L A
Sbjct: 205 LVGNDLAINGGTNTTNTAGAIANSLGG--TTPASNSNAGAVL--FGFNAGSTQVGLLLEA 260

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTV 322
           LE+  A+R LAEP L A+SGQ A+F +GG++    V+ +    SV    +GV + F P V
Sbjct: 261 LEQKGAVRFLAEPNLVALSGQEATFLAGGEYPVP-VAQTGDQISVQYKPFGVEMSFIPRV 319

Query: 323 LSPGRIGLRIQTEV-----SEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           +    I L ++  V     S  V   N  D+ ++  R+  TTVE+  G +  +AGLL DD
Sbjct: 320 VDKDLINLELKAAVSAIDASNSVSLGNGFDISAFTRRETSTTVEMRDGESFAIAGLLTDD 379

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
                  +P +  +P+LGALFR++ + R ++E+ I  T  LV P     L+ P D     
Sbjct: 380 FTDNSSQLPWIGDVPVLGALFRSANYQRSQSELVIIITAHLVTPTRGEALALPTDRIKPP 439

Query: 438 DDAKAFFFNRVNK-IYGPKE--ASEVEGQNYKGAIGFI 472
            +++ F   R +K    P +  A EV  Q++ G+ G++
Sbjct: 440 TESELFLSGRTSKGSTAPTKGAAGEVAKQDFSGSYGYV 477


>gi|257141104|ref|ZP_05589366.1| type II and III secretion system protein [Burkholderia
           thailandensis E264]
          Length = 826

 Score =  187 bits (475), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 130/421 (30%), Positives = 219/421 (52%), Gaps = 31/421 (7%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
           +G+   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ G
Sbjct: 96  MGESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQG 155

Query: 104 HDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAVE 162
             G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV 
Sbjct: 156 KSGACRI-IDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAVA 214

Query: 163 LSETFLSQSGRNQYANSSSKK---VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
           +++ +  ++               V+N+L +    QV L+V +AEV + ++ Q+G   ++
Sbjct: 215 IAKAYSDRTNAGALGGGGGGTRAGVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNL 274

Query: 220 TGSSSGPSKSFAADF-----GGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAE 274
            G     + +           G  VS+     + G +D         A      ++ LAE
Sbjct: 275 QGGFGSWTGALVTSLLTGVGNGIAVSKSNKLPLNGSID---------AQNTDQPVKILAE 325

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLR 331
           P L  ISGQ A+F +GG+       SS   TS  T    ++GV L FTPTVLS GRI L+
Sbjct: 326 PRLVTISGQEATFLAGGKIFIPVPQSSGVGTSTITLQQEEFGVGLKFTPTVLSNGRINLK 385

Query: 332 IQTEVSE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLK 382
           +  EVSE       +   N G    +P    R+A TTV++  G T  + GL+KD+ Q   
Sbjct: 386 VAPEVSELSPTGVTLSAANVGGVSILPLITTRRASTTVQMNDGETFAIGGLIKDNAQGTL 445

Query: 383 EGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
           + +P + ++P+LGALFR++ F ++ TE+    TP LVKP+A  D+  P D ++  ++A  
Sbjct: 446 KALPGIGELPVLGALFRSTSFQQDRTELVFIITPHLVKPLAAADVPLPTDSFTQPNEADV 505

Query: 443 F 443
           +
Sbjct: 506 Y 506


>gi|94309592|ref|YP_582802.1| type II and III secretion system protein [Cupriavidus metallidurans
           CH34]
 gi|93353444|gb|ABF07533.1| Flp pilus assembly protein secretin CpaC [Cupriavidus metallidurans
           CH34]
          Length = 620

 Score =  187 bits (475), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 126/419 (30%), Positives = 225/419 (53%), Gaps = 34/419 (8%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + IG +++I L  P  V++  + +P      + SP+T+Y+ G++VG  N+I+ G  G   
Sbjct: 94  VPIGKSQLIPL--PEPVRNRTLGNPNVVQATMVSPQTLYVLGRSVGTTNMIVQGRSGGCS 151

Query: 110 LNLDILIERDIAHLEMTLRRFI-ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +++++  D   L+ +L + +  +S IRV   +D +VL G V + Q + +A+++++ + 
Sbjct: 152 I-INVVVNADSNGLQTSLAQLLPGESGIRVMTAADNLVLTGSVSSSQAALQAMDIAQAY- 209

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK 228
           + + +   AN     V+N++++    QV L+V +AEV + +L Q+G   +I G       
Sbjct: 210 ANAAQGDGANGKKGGVLNMMSVDTPQQVMLEVKVAEVSKTLLNQLGSAVNIQGG------ 263

Query: 229 SFAADFGGKFV-----SEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQ 283
            F +  GG        +  G F  K   +   F   + A +  + ++ LAEP L  ISGQ
Sbjct: 264 -FGSWTGGVISNLLTGAAAGIFGSKA--NNKPFNLAIDAQKNDSLVKVLAEPNLVTISGQ 320

Query: 284 SASFTSGGQHLYKTVSSST---GATSVTTHD--YGVVLHFTPTVLSPGRIGLRIQTEVSE 338
            ASF +GG+ +Y  V+ S    GA+++T  +  +GV L FTPTVL+ GRI L++  EVSE
Sbjct: 321 EASFLAGGK-IYIPVAQSNALGGASTITLQEEEFGVGLKFTPTVLANGRIHLKVSPEVSE 379

Query: 339 --PVIGVNAGD-------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLS 389
             P     +G        +P    R+A TTV++  G +  + GLL+D  +   + +P   
Sbjct: 380 LSPTGATVSGSTLTGQTILPLITTRRASTTVQMRDGESFAIGGLLQDSARGSLKALPGAG 439

Query: 390 KIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV 448
           ++P+LG LFR+++F ++ TE+    TP LVKP+  ++   P D ++  D    +F   +
Sbjct: 440 EVPVLGTLFRSTQFQQDLTELVFIITPHLVKPMQTQNYPLPTDGFTTPDPLSLYFMGNM 498


>gi|149200847|ref|ZP_01877822.1| bacterial type II/III secretion system protein [Roseovarius sp.
           TM1035]
 gi|149145180|gb|EDM33206.1| bacterial type II/III secretion system protein [Roseovarius sp.
           TM1035]
          Length = 472

 Score =  187 bits (474), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 130/452 (28%), Positives = 217/452 (48%), Gaps = 35/452 (7%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
           V  G    +S+ +N+ ++++      ++ +++P  AD    S RT+Y+ GK  G+  + L
Sbjct: 33  VRNGTSSALSVAMNRAVVVESDSPFAELSIANPAIADFSTLSERTIYVLGKTPGRTTLSL 92

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
               GK + N+D+ +  DI   +  L++ +    I V   +D +V+ G V +    QRA+
Sbjct: 93  FDGLGKLITNIDVHVSTDIEEFKERLKQILPGEPIEVRSANDGIVISGTVSSTSRMQRAL 152

Query: 162 ELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI-- 219
           +L+E +            + ++V NL++++G+ QV LKV  AE++R + K +    SI  
Sbjct: 153 DLAERY------------APERVSNLMSVSGKQQVMLKVRFAEMQRSVSKALSSSLSIDA 200

Query: 220 --------------TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
                         T +  G   + A    G   +    F+    +       +L ALE 
Sbjct: 201 RGANSVGVIGGTNTTNTQGGVLGTLAGAIPGTNENNAA-FAFGFDVGSVEVGILLEALET 259

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
              +RTLAEP LTA+SGQ A F +GG+     V+     TS+    +GV L+F P V+  
Sbjct: 260 KGVVRTLAEPNLTALSGQEAKFLAGGEFPVP-VAQDNDTTSIEFKPFGVELNFVPRVVDD 318

Query: 326 GRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
           G I L +   VS       +  N   +P++R R   TTV L  G +  +AGLL+DD +  
Sbjct: 319 GIINLEMAAAVSSIDTANSLVSNGFAIPAFRRRDTSTTVALRDGESFAIAGLLQDDFRDN 378

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
              +P L  +P+LGALFR++ + R +TE+ I  +  LV P     L+ P D   +  +  
Sbjct: 379 AGQVPWLGDVPVLGALFRSADYQRSQTELVIIVSAHLVSPSRGEALALPTDRVKLPSEKD 438

Query: 442 AFFFNRVNKIYGPK-EASEVEGQNYKGAIGFI 472
            F   RV +    K    EV  Q++ G+ G++
Sbjct: 439 LFLNGRVARGVSDKGPVGEVAKQDFTGSYGYV 470


>gi|260431084|ref|ZP_05785055.1| bacterial type II/III secretion system protein [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260414912|gb|EEX08171.1| bacterial type II/III secretion system protein [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 452

 Score =  187 bits (474), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 132/461 (28%), Positives = 214/461 (46%), Gaps = 49/461 (10%)

Query: 38  NISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQA 97
           N+  V+ G  + + + +N+ I+++      ++ +++   AD+   S RT+Y+ GK  G  
Sbjct: 13  NLRVVKKGTAETLDVPMNRAIVVESETPFAELSIANAGIADISSLSDRTIYVLGKAPGLT 72

Query: 98  NVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDS 157
            + L    G  + N+ + +  D+   +  LR+ + +  I V   +D +VL G V +    
Sbjct: 73  TLTLFDGAGNLIANVRVRVAPDVTEFKERLRQILPNERIEVRTANDGIVLSGTVSSSAKL 132

Query: 158 QRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH 217
            RA+EL+E +            + ++V NL+N+ G  QV LKV  AE+ R + K +    
Sbjct: 133 ARALELAERY------------APERVSNLMNVGGVQQVMLKVRFAEMNRSVAKSLSASL 180

Query: 218 SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDR-------------FSF-------E 257
              GS          D  G   S    FS+   L               F F        
Sbjct: 181 GFGGS----------DVTGGINSLNNSFSLSNALGNNIPVSQSNTGAILFGFGAGSTQVR 230

Query: 258 TVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLH 317
            +L ALE     R+LAEP L+A+SGQ A+F +GG+ +   V    G  ++    +GV + 
Sbjct: 231 LLLEALEAKGLARSLAEPNLSALSGQEATFLAGGE-VPIPVPQDDGVVAIEYKSFGVEID 289

Query: 318 FTPTVLSPGRIGLRIQTEVS----EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGL 373
           F P V+    I L +   VS         +N   +PS+  R+  TTVEL  G +  +AGL
Sbjct: 290 FIPRVVDGDLINLEMAASVSAIDTSSDFTINGDSVPSFVTRQTSTTVELRDGESFAIAGL 349

Query: 374 LKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDH 433
           ++DD   L   IP L  +P+LGALFR++ + RE++E+ I  T  LV P     L+ P D 
Sbjct: 350 IQDDFTDLSNQIPWLGDVPVLGALFRSAEYQREQSELVIIITAHLVSPTRGEALALPTDR 409

Query: 434 YSVEDDAKAFFFNRVNKI--YGPKEASEVEGQNYKGAIGFI 472
                +   F   RV++    G   ASEV  Q++  + G++
Sbjct: 410 VKPPSEFDLFLNGRVSRTERAGNGAASEVANQDFGSSYGYV 450


>gi|167620125|ref|ZP_02388756.1| type II/III secretion system protein [Burkholderia thailandensis
           Bt4]
          Length = 427

 Score =  186 bits (472), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 125/395 (31%), Positives = 205/395 (51%), Gaps = 36/395 (9%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           ++++P     V V+DP  ADV V +P+ +++ GK  G   +  +G + + +L   +++  
Sbjct: 14  MVKLPQPAVAVFVADPDVADVHVPTPQAVFVLGKKAGTTTLFALGANDRTILRETVVVNV 73

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           D   L+  L       ++ +     ++++ G V +  D+   V+  + +L Q        
Sbjct: 74  DTPSLQRILDARFPQLHLTLAGAPGSLMVSGRVPSAADADAVVQTLKPYLRQQ------- 126

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKF 238
              + ++N L +A   QV L+V I EV R+I +Q+G   S  G+S          F G+ 
Sbjct: 127 ---ESLVNRLTLARPIQVHLRVRITEVDRNITQQLGINWSALGASG---NFVGGLFNGRT 180

Query: 239 V----------SEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPTLTAISGQSAS 286
           +          S  G FSV G      +S + VL AL++   I  LAEP LTAISGQ+AS
Sbjct: 181 LFDTASKAFDLSPSGAFSVVGGFHTSHYSIDGVLDALDQEGLITMLAEPNLTAISGQTAS 240

Query: 287 FTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PVIGVN 344
           F +GG+        +TGA ++    YGV L FTPTVL+  RI L+++ EVSE  P   V 
Sbjct: 241 FLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLADNRISLKVRPEVSEIDPTNSVT 300

Query: 345 AGDM--PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
            G +  P+  VR+ DTTVEL SG +  + GLL+     +   +P L+++P+LG LF +  
Sbjct: 301 TGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDVLAELPGLARLPVLGKLFSSRN 360

Query: 403 FNREETEIFIAATPFLVKPV-------AMRDLSRP 430
           +  ++TE+ +  TP++V+P        A+ D++RP
Sbjct: 361 YLNDKTEVVVIVTPYIVQPANPGELRDALDDITRP 395


>gi|83719085|ref|YP_442980.1| type II/III secretion system protein [Burkholderia thailandensis
           E264]
 gi|257139204|ref|ZP_05587466.1| type II/III secretion system protein [Burkholderia thailandensis
           E264]
 gi|83652910|gb|ABC36973.1| type II/III secretion system protein [Burkholderia thailandensis
           E264]
          Length = 492

 Score =  186 bits (472), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 125/395 (31%), Positives = 205/395 (51%), Gaps = 36/395 (9%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           ++++P     V V+DP  ADV V +P+ +++ GK  G   +  +G + + +L   +++  
Sbjct: 79  MVKLPQPAVAVFVADPDVADVHVPTPQAVFVLGKKAGTTTLFALGANDRTILRETVVVNV 138

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           D   L+  L       ++ +     ++++ G V +  D+   V+  + +L Q        
Sbjct: 139 DTPSLQRILDARFPQLHLTLAGAPGSLMVSGRVPSAADADAVVQTLKPYLRQQ------- 191

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKF 238
              + ++N L +A   QV L+V I EV R+I +Q+G   S  G+S          F G+ 
Sbjct: 192 ---ESLVNRLTLARPIQVHLRVRITEVDRNITQQLGINWSALGASG---NFVGGLFNGRT 245

Query: 239 V----------SEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPTLTAISGQSAS 286
           +          S  G FSV G      +S + VL AL++   I  LAEP LTAISGQ+AS
Sbjct: 246 LFDTASKAFDLSPSGAFSVVGGFHTSHYSIDGVLDALDQEGLITMLAEPNLTAISGQTAS 305

Query: 287 FTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PVIGVN 344
           F +GG+        +TGA ++    YGV L FTPTVL+  RI L+++ EVSE  P   V 
Sbjct: 306 FLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLADNRISLKVRPEVSEIDPTNSVT 365

Query: 345 AGDM--PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
            G +  P+  VR+ DTTVEL SG +  + GLL+     +   +P L+++P+LG LF +  
Sbjct: 366 TGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDVLAELPGLARLPVLGKLFSSRN 425

Query: 403 FNREETEIFIAATPFLVKPV-------AMRDLSRP 430
           +  ++TE+ +  TP++V+P        A+ D++RP
Sbjct: 426 YLNDKTEVVVIVTPYIVQPANPGELRDALDDITRP 460


>gi|167841773|ref|ZP_02468457.1| type II/III secretion system protein [Burkholderia thailandensis
           MSMB43]
          Length = 484

 Score =  186 bits (472), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 132/422 (31%), Positives = 223/422 (52%), Gaps = 26/422 (6%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ 
Sbjct: 16  EMRESTNVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQ 75

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV
Sbjct: 76  GKSGACQI-IDVAVGADADGLQTSLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAV 134

Query: 162 ELSETFLSQSGRNQYAN--------SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
            +++ +  ++      N        SS   V+N+L +    QV L+V +AEV + ++ Q+
Sbjct: 135 AIAKAYSDRTNAGAAGNGNGNGGGGSSRADVLNMLTVTSPQQVMLEVKVAEVSKTLINQM 194

Query: 214 GFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLA 273
           G   +I G       S+        ++  G   V    ++      + A +    ++ LA
Sbjct: 195 GSAVNIQGGFG----SWTGALMTSLLTGVGSGIVASKSNKLPLSGAIDAQDTDQPVKILA 250

Query: 274 EPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGL 330
           EP L  ISGQ A+F +GG+       SS   T+  T    ++GV L FTPTVLS GRI L
Sbjct: 251 EPRLVTISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISL 310

Query: 331 RIQTEVSE-PVIGV-----NAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
           ++  EVSE    GV     N G+   +P    R+A TTV++  G T  + GL+KD+ Q  
Sbjct: 311 KVAPEVSELSPTGVTLSASNVGNVSILPLITTRRASTTVQMNDGETFAIGGLIKDNAQGT 370

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
            + +P + ++P+LGALFR++ F ++ TE+    TP LVKP+   D+  P D ++  ++A 
Sbjct: 371 LKALPGIGELPVLGALFRSTSFQQDRTELVFIITPHLVKPLDTADVPLPTDSFTKPNEAD 430

Query: 442 AF 443
            +
Sbjct: 431 VY 432


>gi|167581961|ref|ZP_02374835.1| type II/III secretion system protein [Burkholderia thailandensis
           TXDOH]
          Length = 441

 Score =  186 bits (472), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 125/395 (31%), Positives = 205/395 (51%), Gaps = 36/395 (9%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           ++++P     V V+DP  ADV V +P+ +++ GK  G   +  +G + + +L   +++  
Sbjct: 28  MVKLPQPAVAVFVADPDVADVHVPTPQAVFVLGKKAGTTTLFALGANDRTILRETVVVNV 87

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           D   L+  L       ++ +     ++++ G V +  D+   V+  + +L Q        
Sbjct: 88  DTPSLQRILDARFPQLHLTLAGAPGSLMVSGRVPSAADADAVVQTLKPYLRQQ------- 140

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKF 238
              + ++N L +A   QV L+V I EV R+I +Q+G   S  G+S          F G+ 
Sbjct: 141 ---ESLVNRLTLARPIQVHLRVRITEVDRNITQQLGINWSALGASG---NFVGGLFNGRT 194

Query: 239 V----------SEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPTLTAISGQSAS 286
           +          S  G FSV G      +S + VL AL++   I  LAEP LTAISGQ+AS
Sbjct: 195 LFDTASKAFDLSPSGAFSVVGGFHTSHYSIDGVLDALDQEGLITMLAEPNLTAISGQTAS 254

Query: 287 FTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PVIGVN 344
           F +GG+        +TGA ++    YGV L FTPTVL+  RI L+++ EVSE  P   V 
Sbjct: 255 FLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLADNRISLKVRPEVSEIDPTNSVT 314

Query: 345 AGDM--PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
            G +  P+  VR+ DTTVEL SG +  + GLL+     +   +P L+++P+LG LF +  
Sbjct: 315 TGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDVLAELPGLARLPVLGKLFSSRN 374

Query: 403 FNREETEIFIAATPFLVKPV-------AMRDLSRP 430
           +  ++TE+ +  TP++V+P        A+ D++RP
Sbjct: 375 YLNDKTEVVVIVTPYIVQPANPGELRDALDDITRP 409


>gi|82703477|ref|YP_413043.1| type II and III secretion system protein [Nitrosospira multiformis
           ATCC 25196]
 gi|82411542|gb|ABB75651.1| type II and III secretion system protein [Nitrosospira multiformis
           ATCC 25196]
          Length = 574

 Score =  186 bits (471), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 135/437 (30%), Positives = 222/437 (50%), Gaps = 57/437 (13%)

Query: 55  NKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG----KQML 110
            K  +L++P  V  + V +P  ADV + SP  +Y+ GK++G  NVIL    G     Q  
Sbjct: 95  GKSALLRLPAPVTRISVGNPDVADVTLISPGEIYVLGKSIGTTNVILWTRGGLAGSSQTA 154

Query: 111 NLDILIERDIAHLEMTLRRFI-ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            +++ +  D A L+  LR  +  +++I+V    D++VL G V     + RAV L++ ++ 
Sbjct: 155 VINVTVILDAAALQAKLRELMPGETDIKVTAAGDSLVLSGTVSDTLKADRAVALADAYVR 214

Query: 170 QSG-------------------------RNQYANSSSKKVMNLLNIAGEDQVTLKVTIAE 204
            +                          +       S +V+NLL +    QV L+V +AE
Sbjct: 215 AAAGGQGGQRGGKQGGDASGGQGGGDEPKGAGQGLGSVQVVNLLQVGSNQQVMLEVKVAE 274

Query: 205 VRRDILKQIGF--QHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKG---VLDRFSFETV 259
           + R + +++GF  Q +   + S  ++      GG   + G  F  +G   + D F    +
Sbjct: 275 INRKVAERLGFDFQRAARKAGSAWTQIMTGIIGG---APGMLFQSRGTPEIGDAF----L 327

Query: 260 LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFT 319
           + A ++      LAEP + AISGQ ASF  GG+ +   +    G  ++ +  +GV L FT
Sbjct: 328 IDAEKKDELFHILAEPNIVAISGQEASFLVGGEVMIP-IPQYAGVITLQSRQFGVGLRFT 386

Query: 320 PTVLSPGRIGLRIQTEVSEPVI----------GVNAGDMPSYRVRKADTTVELPSGGTIV 369
           PTVL  GRI L +  EV+E V           GV A  +P++  R+  TTV+L  G ++ 
Sbjct: 387 PTVLEEGRINLVVSPEVTELVKFDTIATTGLGGVLA--VPTFTTRRVSTTVQLRDGQSLA 444

Query: 370 LAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSR 429
           + GLL+D+I++  +  P+L +IPILGALFR+S F +++TE+ +  TP L+KP+   D + 
Sbjct: 445 IGGLLQDNIKETIKRFPVLGEIPILGALFRSSDFQKDKTELMVVVTPRLIKPL-QPDYAL 503

Query: 430 PDDHYSVEDDAKAFFFN 446
           P D + V+ D   F F+
Sbjct: 504 PTDAF-VQPDRPDFLFD 519


>gi|162147491|ref|YP_001601952.1| type II and III secretion system protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209545598|ref|YP_002277827.1| type II and III secretion system protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786068|emb|CAP55650.1| type II and III secretion system protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533275|gb|ACI53212.1| type II and III secretion system protein [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 473

 Score =  186 bits (471), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 128/404 (31%), Positives = 207/404 (51%), Gaps = 33/404 (8%)

Query: 68  DVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTL 127
           ++ V+DP   +V   SP +M++FG   GQ  VI     G  +    +++    ++    L
Sbjct: 62  NIFVADPKVVEVRAASPDSMFVFGVGAGQTTVIATSRSGGVVARYTVVVLPS-SYRASAL 120

Query: 128 RRFIADSNIRVEM---VSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKV 184
           RR +   N RV +      ++ + G   + + +++A+E +   + + GR          V
Sbjct: 121 RRDVGQQNPRVRIGTGADGSIGIEGTETSSESAEQALEGATALVGKGGR----------V 170

Query: 185 MNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGD 244
            +  ++ G  QV LKV I E+ R +++++G +     ++ G + +          +   +
Sbjct: 171 GDYASVPGSIQVNLKVRIVEMSRSLVRELGVEWQSV-NALGTAAAIGISTSNPLAALTTE 229

Query: 245 FSVKGVLDRFS-------FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKT 297
            S    L RFS        ETV+ AL +   I +LAEP LT +SGQ+ASF  GG++    
Sbjct: 230 QSAFNFLSRFSAAGRPVTVETVIDALSQDGLIHSLAEPNLTTVSGQAASFIVGGEYPIP- 288

Query: 298 VSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS----EPVIGVNAGD----MP 349
           VSS     +V    YG+ L F PTVL+ GRI L ++ EVS    +  + ++  +    +P
Sbjct: 289 VSSYNNNINVQYKQYGISLAFVPTVLADGRISLHVRPEVSALSTQGAVTLSEANGNLQIP 348

Query: 350 SYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETE 409
           +  VR+ADTTVEL SG +  +AGL++D       G+P L  IP+LGALF++S F + E+E
Sbjct: 349 ALTVRRADTTVELGSGQSFAIAGLMQDSTNMQGLGLPFLGDIPVLGALFKSSSFQKNESE 408

Query: 410 IFIAATPFLVKPVAMRD-LSRPDDHYSVEDDAKAFFFNRVNKIY 452
           + I  TP+LV+PV     L  PDD+++   D    F  R N IY
Sbjct: 409 LVIVVTPYLVRPVDNESMLHSPDDNWAPPGDLDRIFLMRQN-IY 451


>gi|194288836|ref|YP_002004743.1| pilus assembly secretion protein [Cupriavidus taiwanensis LMG
           19424]
 gi|193222671|emb|CAQ68674.1| pilus assembly secretion protein [Cupriavidus taiwanensis LMG
           19424]
          Length = 621

 Score =  186 bits (471), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 129/418 (30%), Positives = 226/418 (54%), Gaps = 33/418 (7%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + +G +++I LQ PV  ++  + +P+     + SP+T+Y+ G+ VG  N+I+ G  G   
Sbjct: 95  VPVGKSQLITLQEPV--RNRTLGNPSVVQATMVSPQTLYVLGRTVGTTNMIVQGRSGSCS 152

Query: 110 LNLDILIERDIAHLEMTLRRFI-ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +++++  D   L+ +L + +  +  IRV   +D +VL G V   Q +Q+A+E+++ + 
Sbjct: 153 I-INVVVNADSGGLQTSLGQLLPGEPGIRVTTAADNLVLTGSVTNAQAAQQAMEIAQAYA 211

Query: 169 SQSGRNQYANSSSK-KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
           + +   Q  + + K  V+N++++    QV L+V +AEV + +L Q+G   ++ G      
Sbjct: 212 NAA---QGGDGNKKGSVLNMMSVDTPQQVMLEVKVAEVSKTLLNQLGSAVNLQG------ 262

Query: 228 KSFAADFGGKFVS--EGGDFSVKGV-LDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
             F +  GG   S   G   +V G   +   FE  L A +  + ++ LAEP L  ISGQ 
Sbjct: 263 -GFGSWSGGLVTSLLTGASAAVFGSKANNRPFEFALDAQKNDSLVKILAEPNLVTISGQE 321

Query: 285 ASFTSGGQHLYKTVSSS---TGATSVTTH--DYGVVLHFTPTVLSPGRIGLRIQTEVSE- 338
           ASF +GG+ +Y  V+ +    GA +VT    ++GV L FTPTVL+ GRI L++  EVSE 
Sbjct: 322 ASFLAGGK-IYIPVAQANVLNGAGTVTLQEEEFGVGLKFTPTVLANGRIHLKVAPEVSEL 380

Query: 339 -PV-----IGVNAGD--MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSK 390
            P       G  AG   +P    R+A TTV++  G +  + GLL D  +   + +P   +
Sbjct: 381 SPTGATIRGGTLAGQTILPVITTRRASTTVQMRDGESFAIGGLLTDSARGSLKALPGAGE 440

Query: 391 IPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV 448
           +P+LG LFR++++ ++ +E+    TP LVKP+   +   P D +S  +    +F   +
Sbjct: 441 VPVLGTLFRSTQYQQDLSELVFIITPRLVKPMQTNNYPLPTDSFSAPNPLSLYFMGNM 498


>gi|187927687|ref|YP_001898174.1| type II and III secretion system protein [Ralstonia pickettii 12J]
 gi|187724577|gb|ACD25742.1| type II and III secretion system protein [Ralstonia pickettii 12J]
          Length = 663

 Score =  185 bits (470), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 135/462 (29%), Positives = 234/462 (50%), Gaps = 47/462 (10%)

Query: 15  FLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDP 74
              S NP++A  P    A+    N +    G+   + + + K  ++ +P  V++  + +P
Sbjct: 75  MTISMNPALATAP---VADVRGPNCTGAVRGE-SSVVVPVGKSSLISLPEPVRNRTLGNP 130

Query: 75  TKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS 134
                 + SP++MYL G++VG  N+I+ G  G   + +++++  D   L+ +L + +   
Sbjct: 131 AVVQATMVSPQSMYLLGRSVGTTNMIVQGRSGACSI-VNVVVNADAGGLQTSLAQLMPGE 189

Query: 135 N-IRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS------------GRNQYANSSS 181
           N IRV   +D++VL G V + Q +Q+A+E++  + + +                   +  
Sbjct: 190 NKIRVMTAADSLVLAGNVSSAQAAQQAMEIAHAYAASAQSGADKGGGAAGALGGGGAAGG 249

Query: 182 KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS- 240
             V+N++ +    QV L+V +AEV + +L Q+G   ++ G        F +  GG   S 
Sbjct: 250 ANVINMMIVDTPQQVMLEVKVAEVSKTLLNQLGSALNVQGG-------FGSWSGGLLTSL 302

Query: 241 ----EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYK 296
                 G F+ K   +   F+  L A +  + ++ LAEP L  +SGQ ASF +GG+ +Y 
Sbjct: 303 LTGSSTGFFANKA--NNRPFQVELDAQKNDSLVKILAEPNLVTLSGQEASFLAGGK-IYI 359

Query: 297 TV---SSSTGATSVTTHD--YGVVLHFTPTVLSPGRIGLRIQTEVSE------PVIGVNA 345
            V   SSS GA ++T  +  YGV L FTPTV++ GRI L++  EVSE       V G N 
Sbjct: 360 PVAQSSSSGGAPTITLQEEEYGVGLKFTPTVMANGRINLKVAPEVSELSPTGATVTGANT 419

Query: 346 GD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
                +P    R+A TTV++  G +  + GLL+D+ +   + +P   +IP+LG LFR+++
Sbjct: 420 NGQTILPLITTRRASTTVQMRDGESFAIGGLLQDNARGSLKALPGAGEIPVLGTLFRSTQ 479

Query: 403 FNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF 444
           F  + TE+ I  TP LV+P+       P D +S  ++   + 
Sbjct: 480 FQHDLTELVIVITPRLVQPMQTASYPLPTDSFSTPNELAVYL 521


>gi|171320618|ref|ZP_02909638.1| type II and III secretion system protein [Burkholderia ambifaria
           MEX-5]
 gi|171094131|gb|EDT39218.1| type II and III secretion system protein [Burkholderia ambifaria
           MEX-5]
          Length = 460

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 139/453 (30%), Positives = 224/453 (49%), Gaps = 57/453 (12%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +SI   K  +L +      + V+DP+ AD+ V SPRT+++FGK  G   +I +G + + +
Sbjct: 36  LSIATGKGEMLSLSEPATAMFVADPSIADIQVPSPRTVFVFGKKAGTTTLIALGANHRPI 95

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
           L   ++++ D A L+  L        + V     ++++ G V +  D+   ++    +L+
Sbjct: 96  LRRTVIVQVDTASLQTVLDSRFPQLKLSVSGAPGSLMVSGKVPSAADADAVMQSLTPYLN 155

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKS 229
                       +K++N L ++   QV L+V + EV R++ +Q+G    I  SS G + +
Sbjct: 156 DK----------EKIVNRLTLSRPIQVNLRVRVTEVSRNVTQQLG----INWSSLGAAGN 201

Query: 230 FAADFGGKF--------------VSEGGDFSVKGVL--DRFSFETVLHALERATAIRTLA 273
           F    GG F              +S  G +SV G     R+S + VL AL++   I  LA
Sbjct: 202 F---IGGLFNGRTLMDPTTKLFNLSPTGAYSVLGGFHAGRWSIDVVLDALDQEGLITMLA 258

Query: 274 EPTLTAISGQSASFTSGGQHLYKTV--SSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           EP LTA+SGQ+ASF +GG+         S+TGA +V    +GV L FTPTVL+  RI L+
Sbjct: 259 EPNLTAMSGQTASFLAGGEIPIPVAQAGSTTGAITVEFKPFGVSLDFTPTVLADNRISLK 318

Query: 332 IQTEVSEPVIGVNAGD--------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKE 383
           ++ EVSE    V+A +        +P   VR+ +TTVEL SG +  + GLL+        
Sbjct: 319 VRPEVSE----VDANNSVTTGGVTVPGLTVRRVETTVELSSGQSFAIGGLLQSQTADTVS 374

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
            IP L ++PI+G LF +  F   +TE+ +  TP++V+P     L +  D  +       F
Sbjct: 375 QIPGLGRLPIIGRLFSSKNFQDNKTEVVVIVTPYIVQPTGPGQLEQALDTVARPSSDLEF 434

Query: 444 FFNR---VNKIYGPKEASEVEGQNYKGAIGFIY 473
              R   ++ + G       E     GA GF+Y
Sbjct: 435 AVQRNLGLDLLSG-------ETPRLVGAAGFVY 460


>gi|167851182|ref|ZP_02476690.1| Putative phospholipid-binding domain family protein [Burkholderia
           pseudomallei B7210]
          Length = 449

 Score =  184 bits (468), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 126/416 (30%), Positives = 220/416 (52%), Gaps = 20/416 (4%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   +S+ L K ++L +   V++  + +P  A   + SPRT+YL G +VG  N+I+ 
Sbjct: 15  EMRESTSVSVPLGKSLLLPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQ 74

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV
Sbjct: 75  GKSGACRI-IDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAV 133

Query: 162 ELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
            +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +I
Sbjct: 134 AIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNI 193

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            G       S+        ++  G        ++      + A      ++ LAEP L  
Sbjct: 194 QGGFG----SWTGALVTSLLTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLVT 249

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           ISGQ A+F +GG+       SS   T+  T    ++GV L FTPTVLS GRI L++  EV
Sbjct: 250 ISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPEV 309

Query: 337 SE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           SE       +   N G+   +P    R+A TTV++  G T  + GL+KD+ Q   + +P 
Sbjct: 310 SELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALPG 369

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +
Sbjct: 370 IGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVY 425


>gi|170703887|ref|ZP_02894570.1| type II and III secretion system protein [Burkholderia ambifaria
           IOP40-10]
 gi|170131202|gb|EDS99846.1| type II and III secretion system protein [Burkholderia ambifaria
           IOP40-10]
          Length = 460

 Score =  184 bits (468), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 138/456 (30%), Positives = 225/456 (49%), Gaps = 57/456 (12%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
           G  +SI   K  +L +      + V+DP+ AD+ V SPRT+++FGK  G   +I +G + 
Sbjct: 33  GAPLSIATGKGEMLSLSEPATAMFVADPSIADIQVPSPRTVFVFGKKAGTTTLIALGANH 92

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           + +L   ++++ D A L+  L        + V     ++++ G V +  D+   ++    
Sbjct: 93  RPILRRTVIVQVDTASLQTVLDSRFPQLKLAVSGAPGSLMVSGKVPSAADADAVMQSLTP 152

Query: 167 FLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGP 226
           +L+            ++++N L ++   QV L+V + EV R++ +Q+G    I  SS G 
Sbjct: 153 YLNDK----------ERIVNRLTLSRPIQVNLRVRVTEVSRNVTQQLG----INWSSLGA 198

Query: 227 SKSFAADFGGKF--------------VSEGGDFSVKGVL--DRFSFETVLHALERATAIR 270
           + +F    GG F              +S  G +SV G     R+S + VL AL++   I 
Sbjct: 199 AGNF---IGGLFNGRTLMDPTTRLFNLSPTGAYSVLGGFHAGRWSIDVVLDALDQEGLIT 255

Query: 271 TLAEPTLTAISGQSASFTSGGQHLYKTVSS--STGATSVTTHDYGVVLHFTPTVLSPGRI 328
            LAEP LTA+SGQ+ASF +GG+       +  +TGA +V    +GV L FTPTVL+  RI
Sbjct: 256 MLAEPNLTAMSGQTASFLAGGEIPIPVAQAGNTTGAITVEFKPFGVSLDFTPTVLADNRI 315

Query: 329 GLRIQTEVSEPVIGVNAGD--------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQ 380
            L+++ EVSE    V+A +        +P   VR+ +TTVEL SG +  + GLL+     
Sbjct: 316 SLKVRPEVSE----VDANNSVTTGGVTVPGLTVRRVETTVELSSGQSFAIGGLLQSQTAN 371

Query: 381 LKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDA 440
               IP L ++PI+G LF +  F   +TE+ +  TP++V+P     L +  D  +     
Sbjct: 372 TVSQIPGLGRLPIIGRLFSSKNFQDNKTEVVVIVTPYIVQPTGPGQLEQALDTVARPSSD 431

Query: 441 KAFFFNR---VNKIYGPKEASEVEGQNYKGAIGFIY 473
             F   R   ++ + G       E     GA GF+Y
Sbjct: 432 LEFAVQRNLGLDLMSG-------ETPRPVGAAGFVY 460


>gi|163745846|ref|ZP_02153205.1| bacterial type II/III secretion system protein [Oceanibulbus
           indolifex HEL-45]
 gi|161380591|gb|EDQ05001.1| bacterial type II/III secretion system protein [Oceanibulbus
           indolifex HEL-45]
          Length = 478

 Score =  184 bits (468), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 131/458 (28%), Positives = 223/458 (48%), Gaps = 45/458 (9%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
           V+ G    + + +N+ ++++  +   ++ +++P  AD+   S RT+Y+ GK+ G   + L
Sbjct: 37  VKRGTNSSLDVPMNRAVVVESDIPFAELSIANPGIADISSLSDRTIYVLGKSPGLTTLTL 96

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           +   G+ + N+D+ +  D++  +  LR+ +    I V   +D +VL G+V + Q  QRA+
Sbjct: 97  LDAGGQLITNVDVRVAADVSEFKERLRQILPGEKIEVRTANDGIVLSGIVSSTQRLQRAL 156

Query: 162 ELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT- 220
           +L+E +            + ++V NL+++ G  QV +KV  AE++R++ K +G   +I  
Sbjct: 157 DLAERY------------APERVSNLMSVGGIQQVMMKVRFAEMQRNVSKSLGSSLAING 204

Query: 221 ----------GSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFET-------VLHAL 263
                       S+  S   A+  GG   S   + +   VL  F F         +L AL
Sbjct: 205 AIGGTGINGGTGSTNSSGGVASSLGGTIPSS--NQNAGAVL--FGFNAGSTQVGILLEAL 260

Query: 264 ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGAT-SVTTHDYGVVLHFTPTV 322
           E    +R LAEP L A+SGQ A F +GG+  Y    + TG T +V    +GV L F P V
Sbjct: 261 EEKGVVRFLAEPNLVALSGQEAKFLAGGE--YPVPVAQTGDTIAVEFKPFGVELAFIPRV 318

Query: 323 LSPGRIGLRIQTEV-----SEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           +    I L +   V     S  +   N  ++ ++  R+  TTVE+  G +  +AGLL DD
Sbjct: 319 VDKDIINLEMNAAVSAIDGSNSIALGNGIEISAFTRRETSTTVEMRDGESFAIAGLLTDD 378

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
                  +P +  +P+LGALFR++ + R +TE+ I  T  LV P     L  P D     
Sbjct: 379 FTDSTRQLPWIGDVPVLGALFRSADYQRSQTELVIIVTAHLVTPTRSEALVLPTDRIKPP 438

Query: 438 DDAKAFFFNR-VNKIYGPKE--ASEVEGQNYKGAIGFI 472
            +   F   R  +    P    A EV  Q+++G+ G++
Sbjct: 439 SEKDLFLHGRTADGTRTPTRGAAGEVAKQDFRGSYGYV 476


>gi|172062959|ref|YP_001810610.1| type II and III secretion system protein [Burkholderia ambifaria
           MC40-6]
 gi|171995476|gb|ACB66394.1| type II and III secretion system protein [Burkholderia ambifaria
           MC40-6]
          Length = 460

 Score =  184 bits (468), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 138/456 (30%), Positives = 225/456 (49%), Gaps = 57/456 (12%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
           G  +SI   K  +L +      + V+DP+ AD+ V SPRT+++FGK  G   +I +G + 
Sbjct: 33  GAPLSIATGKGEMLSLSEPATAMFVADPSIADIQVPSPRTVFVFGKKAGTTTLIALGANH 92

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           + +L   ++++ D A L+  L        + V     ++++ G V +  D+   ++    
Sbjct: 93  RPILRRTVIVQVDTASLQTVLDSRFPQLKLAVSGAPGSLMVSGKVPSAADADAVMQSLTP 152

Query: 167 FLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGP 226
           +L+            ++++N L ++   QV L+V + EV R++ +Q+G    I  SS G 
Sbjct: 153 YLNDK----------ERIVNRLTLSRPIQVNLRVRVTEVSRNVTQQLG----INWSSLGA 198

Query: 227 SKSFAADFGGKF--------------VSEGGDFSVKGVL--DRFSFETVLHALERATAIR 270
           + +F    GG F              +S  G +SV G     R+S + VL AL++   I 
Sbjct: 199 AGNF---IGGLFNGRTLMDPTTKLFNLSPTGAYSVLGGFHAGRWSIDVVLDALDQEGLIT 255

Query: 271 TLAEPTLTAISGQSASFTSGGQHLYKTVSS--STGATSVTTHDYGVVLHFTPTVLSPGRI 328
            LAEP LTA+SGQ+ASF +GG+       +  +TGA +V    +GV L FTPTVL+  RI
Sbjct: 256 MLAEPNLTAMSGQTASFLAGGEIPIPVAQAGNTTGAITVEFKPFGVSLDFTPTVLADNRI 315

Query: 329 GLRIQTEVSEPVIGVNAGD--------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQ 380
            L+++ EVSE    V+A +        +P   VR+ +TTVEL SG +  + GLL+     
Sbjct: 316 SLKVRPEVSE----VDANNSVTTGGVTVPGLTVRRVETTVELSSGQSFAIGGLLQSQTAN 371

Query: 381 LKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDA 440
               IP L ++PI+G LF +  F   +TE+ +  TP++V+P     L +  D  +     
Sbjct: 372 TVSQIPGLGRLPIIGRLFSSKNFQDNKTEVVVIVTPYIVQPTGPGQLEQALDTVARPSSD 431

Query: 441 KAFFFNR---VNKIYGPKEASEVEGQNYKGAIGFIY 473
             F   R   ++ + G       E     GA GF+Y
Sbjct: 432 LEFAVQRNLGLDLMSG-------ETPRPVGAAGFVY 460


>gi|153834055|ref|ZP_01986722.1| Flp pilus assembly protein [Vibrio harveyi HY01]
 gi|148869610|gb|EDL68600.1| Flp pilus assembly protein [Vibrio harveyi HY01]
          Length = 486

 Score =  184 bits (467), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 131/422 (31%), Positives = 215/422 (50%), Gaps = 23/422 (5%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
           GK +S+  ++   L +    + V + DP   D++V     ++L GK +G  NV +    G
Sbjct: 26  GKVVSVAHHQSTQLMISGKAKKVTLGDPEVLDIIVLRSNELFLVGKKLGTTNVSVWDSRG 85

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           + +   ++ +  D+  L+  L +F+ D +I V    + VVL G+V T Q+   AV+++ET
Sbjct: 86  RLIEQFNVEVTHDLNTLKSKLYQFLPDESIEVHSAQEKVVLRGLVSTQQNMDTAVKIAET 145

Query: 167 FLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIG-----FQHSI 219
           F +    ++  + S     V+NLL+I G  QVTL+VT+AEV+R ++++       FQ S 
Sbjct: 146 FAAGEAADEGEDDSKDDSMVINLLSIGGAQQVTLEVTVAEVQRTLVRRFDSNFHFFQKSG 205

Query: 220 TGSSSGPSKSFAADFGGKFVS--EGGDFSVKG-VLDRFSFETVLHALERATAI-RTLAEP 275
             +    +     D  G  ++     DF   G  +D  +  T    + R   + + LAEP
Sbjct: 206 DFTWGATTAGGGIDNIGPILNIPSVDDFGFLGSFIDSNTLFTFALDVARQNGVAKVLAEP 265

Query: 276 TLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
           +LTA+SG  A F +GG+     V +  G T +   +YGV L F P +LS  RI L++   
Sbjct: 266 SLTALSGTQAEFVAGGEFPIP-VPNEDGIT-IDYKEYGVQLDFVPYILSDKRINLKMNVN 323

Query: 336 VSE----PVIGVNAGD------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGI 385
           VSE     V+  N  +      +P    R A TT+EL  G TI +AGLL ++ + + +GI
Sbjct: 324 VSEIANSGVLTFNPNEVNATFFIPPITKRSAGTTIELADGQTIGIAGLLSENARNVADGI 383

Query: 386 PLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           P  S +P+LG LF++  F   ETE+ I  TP L  P+  R ++ P D +   +D + +  
Sbjct: 384 PGASDLPVLGRLFKSEEFTSGETELVILVTPRLATPIDRRRITLPTDGFVSPNDVEFYLL 443

Query: 446 NR 447
            +
Sbjct: 444 GK 445


>gi|167908129|ref|ZP_02495334.1| type II/III secretion system protein [Burkholderia pseudomallei
           NCTC 13177]
          Length = 460

 Score =  184 bits (467), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 126/416 (30%), Positives = 220/416 (52%), Gaps = 20/416 (4%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   +S+ L K ++L +   V++  + +P  A   + SPRT+YL G +VG  N+I+ 
Sbjct: 20  EMRESTSVSVPLGKSLLLPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQ 79

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV
Sbjct: 80  GKSGACRI-IDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAV 138

Query: 162 ELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
            +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +I
Sbjct: 139 AIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNI 198

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            G       S+        ++  G        ++      + A      ++ LAEP L  
Sbjct: 199 QGGFG----SWTGALVTSLLTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLVT 254

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           ISGQ A+F +GG+       SS   T+  T    ++GV L FTPTVLS GRI L++  EV
Sbjct: 255 ISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPEV 314

Query: 337 SE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           SE       +   N G+   +P    R+A TTV++  G T  + GL+KD+ Q   + +P 
Sbjct: 315 SELSPTGVTLSAANMGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALPG 374

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +
Sbjct: 375 IGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVY 430


>gi|134281876|ref|ZP_01768583.1| type II/III secretion system protein [Burkholderia pseudomallei
           305]
 gi|134246938|gb|EBA47025.1| type II/III secretion system protein [Burkholderia pseudomallei
           305]
          Length = 685

 Score =  184 bits (467), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 126/416 (30%), Positives = 220/416 (52%), Gaps = 20/416 (4%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   +S+ L K ++L +   V++  + +P  A   + SPRT+YL G +VG  N+I+ 
Sbjct: 95  EMRESTSVSVPLGKSLLLPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQ 154

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV
Sbjct: 155 GKSGACRI-IDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAV 213

Query: 162 ELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
            +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +I
Sbjct: 214 AIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNI 273

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            G       S+        ++  G        ++      + A      ++ LAEP L  
Sbjct: 274 QGGFG----SWTGALVTSLLTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLVT 329

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           ISGQ A+F +GG+       SS   T+  T    ++GV L FTPTVLS GRI L++  EV
Sbjct: 330 ISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPEV 389

Query: 337 SE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           SE       +   N G+   +P    R+A TTV++  G T  + GL+KD+ Q   + +P 
Sbjct: 390 SELSPTGVTLSAANMGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALPG 449

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +
Sbjct: 450 IGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVY 505


>gi|187919324|ref|YP_001888355.1| type II and III secretion system protein [Burkholderia phytofirmans
           PsJN]
 gi|187717762|gb|ACD18985.1| type II and III secretion system protein [Burkholderia phytofirmans
           PsJN]
          Length = 595

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 130/435 (29%), Positives = 219/435 (50%), Gaps = 47/435 (10%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           ++I + K  ++ V   V+   V +P     ++ SP+T+YL G +VG  N+I+ G  G   
Sbjct: 115 VTIPVGKSTMVDVREPVKSRSVGNPAIVQAMLVSPQTLYLLGSDVGTTNMIVQGRSGSCT 174

Query: 110 LNLDILIERDIAHLEMTLRRFIAD-SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +D+ +  D   L+ TL   + + + I+V+  +DT+VL G V     ++R +EL+  F+
Sbjct: 175 I-IDVSVGADPGGLQQTLAALMPEETGIQVKAAADTLVLTGTVSDAVKAERVLELARAFV 233

Query: 169 S------QSGRNQ--------------------YANSSSKKVMNLLNIAGEDQVTLKVTI 202
           +      Q G                          +S ++++N++++A   QV L+V +
Sbjct: 234 ARPTAALQGGAPMGSGPLPVGAAPRAMGMPAPTLGGASGERIINMMHVAAPQQVMLEVKV 293

Query: 203 AEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHA 262
           AEV + ++ Q+G   +I G     S    AD+    +S G         +       + A
Sbjct: 294 AEVSKTLIDQLGVAANINGGIGSWSFGLLADY----LSGGLSALTASKANNSPLRAAIDA 349

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVT----THDYGVVLHF 318
            +    ++ LAEP L AISGQ ASF +GG+ +Y  V  S GA   T       YGV L F
Sbjct: 350 QKTDQLVKILAEPNLMAISGQEASFLAGGK-VYIPVPQSNGANGTTIVLQEEQYGVGLTF 408

Query: 319 TPTVLSPGRIGLRIQTEVSE---PVIGVNAGD------MPSYRVRKADTTVELPSGGTIV 369
           TPTVL  GRI L++  EVSE     + V+AG+      +P    R+A TT+++  G +  
Sbjct: 409 TPTVLEGGRINLKVSPEVSELSSTGVVVSAGNSNNQTILPLITTRRASTTLQVFDGQSFA 468

Query: 370 LAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSR 429
           + GLLK +I    +G+P  +++P+LGALFR++ + +++TE+    TP L KP+  +    
Sbjct: 469 IGGLLKSNITGSIKGLPGAAELPVLGALFRSTSYEQDKTELVFVVTPRLAKPLP-QHYPL 527

Query: 430 PDDHYSVEDDAKAFF 444
           P DH+    +A  + 
Sbjct: 528 PTDHFGDASEANVYL 542


>gi|261820214|ref|YP_003258320.1| type II and III secretion system protein [Pectobacterium wasabiae
           WPP163]
 gi|261604227|gb|ACX86713.1| type II and III secretion system protein [Pectobacterium wasabiae
           WPP163]
          Length = 475

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 130/387 (33%), Positives = 207/387 (53%), Gaps = 29/387 (7%)

Query: 69  VLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLR 128
           VLV+DP  A   + SP  ++++ KNVG   +  +  +GK +  + ++ E D+  L   ++
Sbjct: 72  VLVADPNIASFELPSPGNLFVYAKNVGTTTLYAMDENGKVINAIRLVSEHDLKALSERIK 131

Query: 129 RFIADSNIRVEM-VSDTVVLHGMVRTIQDSQRAVELSETFLSQSGR---------NQYAN 178
           R    ++I++E  +   V++ G V T QD++R ++  +T+++ S           +Q   
Sbjct: 132 REFPGADIQLEASIPSGVIVRGSVDTPQDAKRVIDSIQTYINASSNGAQGGGGGGDQLPG 191

Query: 179 SS--SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGG 236
           SS  S KV+N L I    Q+ ++V + EV R +  ++GF  + + S+   S +  A  G 
Sbjct: 192 SSETSGKVVNQLKIKTPSQINIQVRVVEVSRKLTSELGFNWAASLSTG--SGNMTAGSGS 249

Query: 237 K---FVSEGGDFSV---KGVLD--RFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
           +   F +  G F+     G L+  R     +L A+ +      LAEP LTA+SG++A+F 
Sbjct: 250 RLNLFNATTGRFANPTDSGFLNFGRSRLGGLLTAMNQQGMATVLAEPNLTAMSGETAAFA 309

Query: 289 SGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVN 344
           +GG+     V  +  + S+    YGV+L  TPT+LS  RI L I  EVSE      + + 
Sbjct: 310 AGGE--VPIVLITNNSVSIDYKSYGVILRMTPTLLSANRISLHIAPEVSELTDVGSVQLE 367

Query: 345 AGD-MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRF 403
            G  +P+  VR+ADTTVEL SG +  LAG+L+    Q   G+P LS IP+ G LF +   
Sbjct: 368 GGSRIPALTVRRADTTVELASGQSFALAGMLRSAGSQTINGVPGLSGIPMFGRLFESEST 427

Query: 404 NREETEIFIAATPFLVKPVAMRDLSRP 430
           N EETE+ I AT ++V+PV   DL  P
Sbjct: 428 NHEETELVIIATAYVVEPVNAGDLQTP 454


>gi|167744175|ref|ZP_02416949.1| Putative phospholipid-binding domain family protein [Burkholderia
           pseudomallei 14]
          Length = 439

 Score =  183 bits (465), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 220/416 (52%), Gaps = 20/416 (4%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ 
Sbjct: 7   EMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQ 66

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV
Sbjct: 67  GKSGACRI-IDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAV 125

Query: 162 ELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
            +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +I
Sbjct: 126 AIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNI 185

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            G       S+        ++  G        ++      + A      ++ LAEP L  
Sbjct: 186 QGGFG----SWTGALVTSLLTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLVT 241

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           ISGQ A+F +GG+       SS   T+  T    ++GV L FTPTVLS GRI L++  EV
Sbjct: 242 ISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPEV 301

Query: 337 SE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           SE       +   N G+   +P    R+A TTV++  G T  + GL+KD+ Q   + +P 
Sbjct: 302 SELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALPG 361

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +
Sbjct: 362 IGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVY 417


>gi|115358171|ref|YP_775309.1| type II and III secretion system protein [Burkholderia ambifaria
           AMMD]
 gi|115283459|gb|ABI88975.1| type II and III secretion system protein [Burkholderia ambifaria
           AMMD]
          Length = 460

 Score =  183 bits (465), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 139/461 (30%), Positives = 227/461 (49%), Gaps = 59/461 (12%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
           VE G    I+ G  +++ L  P     + V+DP+ AD+ V SPRT+++FGK  G   +I 
Sbjct: 30  VEAGATLSIATGKGEMLSLSEPATA--MFVADPSIADIQVPSPRTVFVFGKKAGTTTLIA 87

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           +G + + +L   ++++ D   L+  L        + V     ++++ G V +  D+   +
Sbjct: 88  LGANHRPILRKTVIVQVDTVSLQAVLDSRFPQLKLSVSGAPGSLMVSGKVPSAADADAVM 147

Query: 162 ELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG 221
           +    +L+            ++++N L ++   QV L+V + EV R++ +Q+G    I  
Sbjct: 148 QSLAPYLNDK----------ERIVNRLTLSRPIQVNLRVRVTEVSRNVTQQLG----INW 193

Query: 222 SSSGPSKSFAADFGGKF--------------VSEGGDFSVKGVL--DRFSFETVLHALER 265
           SS G + +F    GG F              +S  G +SV G     R+S + VL AL++
Sbjct: 194 SSLGAAGNF---IGGLFNGRTLMDPTNRLFNLSPTGAYSVLGGFHTGRWSIDVVLDALDQ 250

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS--STGATSVTTHDYGVVLHFTPTVL 323
              I  LAEP LTA+SGQ+ASF +GG+       +  +TGA +V    +GV L FTPTVL
Sbjct: 251 EGLITMLAEPNLTAMSGQTASFLAGGEIPIPVAQAGNTTGAITVEFKPFGVSLDFTPTVL 310

Query: 324 SPGRIGLRIQTEVSEPVIGVNAGD--------MPSYRVRKADTTVELPSGGTIVLAGLLK 375
           +  RI L+++ EVSE    V+A +        +P   VR+ +TTVEL SG +  + GLL+
Sbjct: 311 ADNRISLKVRPEVSE----VDANNSVTTGGVTVPGLTVRRVETTVELSSGQSFAIGGLLQ 366

Query: 376 DDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYS 435
                    IP L ++PI+G LF +  F   +TE+ +  TP++V+P     L +  D  +
Sbjct: 367 SQTANTVSQIPGLGRLPIIGRLFSSKNFQDNKTEVVVIVTPYIVQPTGPGQLEQALDTVA 426

Query: 436 VEDDAKAFFFNR---VNKIYGPKEASEVEGQNYKGAIGFIY 473
                  F   R   ++ + G       E     GA GF+Y
Sbjct: 427 RPSSDLEFAVQRNLGLDLMSG-------ETPRPVGAAGFVY 460


>gi|113866744|ref|YP_725233.1| flp pilus assembly protein secretin [Ralstonia eutropha H16]
 gi|113525520|emb|CAJ91865.1| flp pilus assembly protein secretin [Ralstonia eutropha H16]
          Length = 618

 Score =  183 bits (465), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 128/420 (30%), Positives = 224/420 (53%), Gaps = 37/420 (8%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + +G +++I LQ PV  ++  + +P      + SP+T+Y+ G+ VG  N+I+ G  G   
Sbjct: 96  VPVGKSQLITLQEPV--RNRTLGNPNVVQATMVSPQTLYVLGRAVGTTNMIVQGRSGSCS 153

Query: 110 LNLDILIERDIAHLEMTLRRFI-ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +++++  D   L+ +L + +  +  IRV   +D +VL G V   Q +Q+A+E+++ + 
Sbjct: 154 I-INVVVNADAGGLQTSLGQLLPGEPGIRVMTAADNLVLTGSVTNAQTAQQAMEIAQAYA 212

Query: 169 SQSGRNQYANSSSKK-VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
           + +   Q  + + K  V+N+L++    QV L+V +AEV + +L Q+G   ++ G      
Sbjct: 213 NAA---QGGDGNKKGGVLNMLSVDTPQQVMLEVKVAEVSKTLLNQLGSTVNLQGG----- 264

Query: 228 KSFAADFGGKFVS-----EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISG 282
             F +  GG   S         F+ K   +   F+  + A +  + ++ LAEP L  ISG
Sbjct: 265 --FGSWSGGLVTSLLTGASSAIFASKA--NNRPFDIAIDAQKNDSLVKILAEPNLVTISG 320

Query: 283 QSASFTSGGQHLYKTVSSST---GATSVTTHD--YGVVLHFTPTVLSPGRIGLRIQTEVS 337
           Q ASF +GG+ +Y  V+ +    GA +VT  +  +GV L FTPTVL+ GRI L++  EVS
Sbjct: 321 QEASFLAGGK-IYIPVAQANVLNGAGTVTLQEEEFGVGLKFTPTVLANGRIHLKVSPEVS 379

Query: 338 E--PVI-----GVNAGD--MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
           E  P       G  AG   +P    R+A TTV++  G +  + GLL D  +   + +P  
Sbjct: 380 ELSPTGATIRGGTLAGQSILPVITTRRASTTVQMRDGESFAIGGLLTDSARGSLKALPGA 439

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV 448
            ++P+LG LFR++++ ++ TE+    TP LVKP+   +   P D +S  +    +F   +
Sbjct: 440 GEVPVLGTLFRSTQYQQDLTELVFVITPRLVKPMQTSNYPLPTDSFSTPNPLSLYFMGNM 499


>gi|167821374|ref|ZP_02453054.1| Putative phospholipid-binding domain family protein [Burkholderia
           pseudomallei 91]
          Length = 494

 Score =  183 bits (465), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 220/416 (52%), Gaps = 20/416 (4%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ 
Sbjct: 64  EMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQ 123

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV
Sbjct: 124 GKSGACRI-IDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAV 182

Query: 162 ELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
            +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +I
Sbjct: 183 AIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNI 242

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            G       S+        ++  G        ++      + A      ++ LAEP L  
Sbjct: 243 QGGFG----SWTGALVTSLLTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLVT 298

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           ISGQ A+F +GG+       SS   T+  T    ++GV L FTPTVLS GRI L++  EV
Sbjct: 299 ISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPEV 358

Query: 337 SE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           SE       +   N G+   +P    R+A TTV++  G T  + GL+KD+ Q   + +P 
Sbjct: 359 SELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALPG 418

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +
Sbjct: 419 IGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVY 474


>gi|254182583|ref|ZP_04889177.1| type II/III secretion system protein [Burkholderia pseudomallei
           1655]
 gi|184213118|gb|EDU10161.1| type II/III secretion system protein [Burkholderia pseudomallei
           1655]
          Length = 690

 Score =  183 bits (464), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 220/416 (52%), Gaps = 20/416 (4%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ 
Sbjct: 95  EMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQ 154

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV
Sbjct: 155 GKSGACRI-IDVAVGADAGGLQASLRQLMPREHDIRVSTAADTIVLAGNVSSAQAAQQAV 213

Query: 162 ELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
            +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +I
Sbjct: 214 AIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNI 273

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            G       S+        ++  G        ++      + A      ++ LAEP L  
Sbjct: 274 QGGFG----SWTGALVTSLLTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLVT 329

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           ISGQ A+F +GG+       SS   T+  T    ++GV L FTPTVLS GRI L++  EV
Sbjct: 330 ISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPEV 389

Query: 337 SE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           SE       +   N G+   +P    R+A TTV++  G T  + GL+KD+ Q   + +P 
Sbjct: 390 SELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALPG 449

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +
Sbjct: 450 IGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVY 505


>gi|167829715|ref|ZP_02461186.1| Putative phospholipid-binding domain family protein [Burkholderia
           pseudomallei 9]
          Length = 510

 Score =  183 bits (464), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 220/416 (52%), Gaps = 20/416 (4%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ 
Sbjct: 73  EMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQ 132

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV
Sbjct: 133 GKSGACRI-IDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAV 191

Query: 162 ELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
            +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +I
Sbjct: 192 AIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNI 251

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            G       S+        ++  G        ++      + A      ++ LAEP L  
Sbjct: 252 QGGFG----SWTGALVTSLLTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLVT 307

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           ISGQ A+F +GG+       SS   T+  T    ++GV L FTPTVLS GRI L++  EV
Sbjct: 308 ISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPEV 367

Query: 337 SE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           SE       +   N G+   +P    R+A TTV++  G T  + GL+KD+ Q   + +P 
Sbjct: 368 SELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALPG 427

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +
Sbjct: 428 IGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVY 483


>gi|167899813|ref|ZP_02487214.1| Putative phospholipid-binding domain family protein [Burkholderia
           pseudomallei 7894]
          Length = 473

 Score =  183 bits (464), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 220/416 (52%), Gaps = 20/416 (4%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ 
Sbjct: 37  EMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQ 96

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV
Sbjct: 97  GKSGACRI-IDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAV 155

Query: 162 ELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
            +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +I
Sbjct: 156 AIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNI 215

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            G       S+        ++  G        ++      + A      ++ LAEP L  
Sbjct: 216 QGGFG----SWTGALVTSLLTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLVT 271

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           ISGQ A+F +GG+       SS   T+  T    ++GV L FTPTVLS GRI L++  EV
Sbjct: 272 ISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPEV 331

Query: 337 SE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           SE       +   N G+   +P    R+A TTV++  G T  + GL+KD+ Q   + +P 
Sbjct: 332 SELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALPG 391

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +
Sbjct: 392 IGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVY 447


>gi|167725247|ref|ZP_02408483.1| Putative phospholipid-binding domain family protein [Burkholderia
           pseudomallei DM98]
          Length = 448

 Score =  183 bits (464), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 220/416 (52%), Gaps = 20/416 (4%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ 
Sbjct: 15  EMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQ 74

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV
Sbjct: 75  GKSGACRI-IDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAV 133

Query: 162 ELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
            +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +I
Sbjct: 134 AIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNI 193

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            G       S+        ++  G        ++      + A      ++ LAEP L  
Sbjct: 194 QGGFG----SWTGALVTSLLTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLVT 249

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           ISGQ A+F +GG+       SS   T+  T    ++GV L FTPTVLS GRI L++  EV
Sbjct: 250 ISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPEV 309

Query: 337 SE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           SE       +   N G+   +P    R+A TTV++  G T  + GL+KD+ Q   + +P 
Sbjct: 310 SELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALPG 369

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +
Sbjct: 370 IGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVY 425


>gi|76819084|ref|YP_336469.1| phospholipid-binding domain-containing protein [Burkholderia
           pseudomallei 1710b]
 gi|254264517|ref|ZP_04955382.1| type II/III secretion system protein [Burkholderia pseudomallei
           1710a]
 gi|76583557|gb|ABA53031.1| Putative phospholipid-binding domain family [Burkholderia
           pseudomallei 1710b]
 gi|254215519|gb|EET04904.1| type II/III secretion system protein [Burkholderia pseudomallei
           1710a]
          Length = 690

 Score =  183 bits (464), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 220/416 (52%), Gaps = 20/416 (4%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ 
Sbjct: 95  EMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQ 154

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV
Sbjct: 155 GKSGACRI-IDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAV 213

Query: 162 ELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
            +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +I
Sbjct: 214 AIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNI 273

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            G       S+        ++  G        ++      + A      ++ LAEP L  
Sbjct: 274 QGGFG----SWTGALVTSLLTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLVT 329

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           ISGQ A+F +GG+       SS   T+  T    ++GV L FTPTVLS GRI L++  EV
Sbjct: 330 ISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPEV 389

Query: 337 SE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           SE       +   N G+   +P    R+A TTV++  G T  + GL+KD+ Q   + +P 
Sbjct: 390 SELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALPG 449

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +
Sbjct: 450 IGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVY 505


>gi|126456485|ref|YP_001076989.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106a]
 gi|242311194|ref|ZP_04810211.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106b]
 gi|126230253|gb|ABN93666.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106a]
 gi|242134433|gb|EES20836.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106b]
          Length = 690

 Score =  183 bits (464), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 220/416 (52%), Gaps = 20/416 (4%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ 
Sbjct: 95  EMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQ 154

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV
Sbjct: 155 GKSGACRI-IDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAV 213

Query: 162 ELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
            +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +I
Sbjct: 214 AIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNI 273

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            G       S+        ++  G        ++      + A      ++ LAEP L  
Sbjct: 274 QGGFG----SWTGALVTSLLTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLVT 329

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           ISGQ A+F +GG+       SS   T+  T    ++GV L FTPTVLS GRI L++  EV
Sbjct: 330 ISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPEV 389

Query: 337 SE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           SE       +   N G+   +P    R+A TTV++  G T  + GL+KD+ Q   + +P 
Sbjct: 390 SELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALPG 449

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +
Sbjct: 450 IGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVY 505


>gi|237509564|ref|ZP_04522279.1| type II/III secretion system protein [Burkholderia pseudomallei
           MSHR346]
 gi|235001769|gb|EEP51193.1| type II/III secretion system protein [Burkholderia pseudomallei
           MSHR346]
          Length = 690

 Score =  183 bits (464), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 220/416 (52%), Gaps = 20/416 (4%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ 
Sbjct: 95  EMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQ 154

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV
Sbjct: 155 GKSGACRI-IDVAVGADAGGLQASLRQLMPREHDIRVSTAADTIVLAGNVSSAQAAQQAV 213

Query: 162 ELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
            +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +I
Sbjct: 214 AIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNI 273

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            G       S+        ++  G        ++      + A      ++ LAEP L  
Sbjct: 274 QGGFG----SWTGALVTSLLTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLVT 329

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           ISGQ A+F +GG+       SS   T+  T    ++GV L FTPTVLS GRI L++  EV
Sbjct: 330 ISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPEV 389

Query: 337 SE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           SE       +   N G+   +P    R+A TTV++  G T  + GL+KD+ Q   + +P 
Sbjct: 390 SELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALPG 449

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +
Sbjct: 450 IGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVY 505


>gi|167916476|ref|ZP_02503567.1| Putative phospholipid-binding domain family protein [Burkholderia
           pseudomallei 112]
          Length = 452

 Score =  183 bits (464), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 220/416 (52%), Gaps = 20/416 (4%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ 
Sbjct: 15  EMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQ 74

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV
Sbjct: 75  GKSGACRI-IDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAV 133

Query: 162 ELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
            +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +I
Sbjct: 134 AIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNI 193

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            G       S+        ++  G        ++      + A      ++ LAEP L  
Sbjct: 194 QGGFG----SWTGALVTSLLTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLVT 249

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           ISGQ A+F +GG+       SS   T+  T    ++GV L FTPTVLS GRI L++  EV
Sbjct: 250 ISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPEV 309

Query: 337 SE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           SE       +   N G+   +P    R+A TTV++  G T  + GL+KD+ Q   + +P 
Sbjct: 310 SELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALPG 369

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +
Sbjct: 370 IGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVY 425


>gi|134291857|ref|YP_001115626.1| type II and III secretion system protein [Burkholderia
           vietnamiensis G4]
 gi|134135046|gb|ABO59371.1| type II and III secretion system protein [Burkholderia
           vietnamiensis G4]
          Length = 647

 Score =  183 bits (464), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 126/417 (30%), Positives = 219/417 (52%), Gaps = 18/417 (4%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +S+ L K +++ +P  V++  + +P  A   + SP+T+Y+ G +VG  N+I+ G  G   
Sbjct: 100 VSVPLGKSLLVPMPEAVRNRTIGNPAVAQATMVSPQTLYILGLSVGTTNMIVQGKSGACR 159

Query: 110 LNLDILIERDIAHLEMTLRRFI-ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +D+ +  D   L+ +L + + A+ +I V   + T+VL G V   Q +Q+AV+++  + 
Sbjct: 160 V-IDVAVGADAGGLQASLLQLMPAERDIHVSTAAGTIVLAGTVSNSQAAQQAVQIARAYS 218

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK 228
             +G  +   +    V+N+L++    QV L+V +AEV + ++ Q+G   +I G     S 
Sbjct: 219 DSAGGGEGGTAKGGGVLNMLSVTSPQQVMLEVKVAEVSKTLINQMGSALNIQGGFGSWSG 278

Query: 229 SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
           +  ++      S     +V    +   F     A      ++ LAEP L  ISGQ A+F 
Sbjct: 279 ALVSNLLAGVASA----AVFNKANNKPFSIAADAQNTDNLVKILAEPNLVTISGQEATFL 334

Query: 289 SGGQHLYKTV-SSSTGATSVTTH--DYGVVLHFTPTVLSPGRIGLRIQTEVSE------P 339
           +GG+       SS TG +++T    ++GV L FTPTVL+ GRI L++  EVSE       
Sbjct: 335 AGGKIFIPVPQSSGTGVSTITLQQEEFGVALKFTPTVLANGRISLKVAPEVSELSQTGVT 394

Query: 340 VIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
           +   N G    +P    R+A TTV++  G +  + GL+KD+     + IP + ++P+LGA
Sbjct: 395 LSATNIGGTSILPLITTRRASTTVQMSDGESFAIGGLIKDNATGALKAIPGVGEVPVLGA 454

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYG 453
           LFR++ F ++ TE+    TP LVKP+   D   P D +S  ++A  +    +   +G
Sbjct: 455 LFRSTSFQQDRTELIFLITPHLVKPLQSADQPMPTDSFSKPNEADVYATGNMEGRHG 511


>gi|53723207|ref|YP_112192.1| outer membrane protein [Burkholderia pseudomallei K96243]
 gi|52213621|emb|CAH39675.1| putative outer membrane protein [Burkholderia pseudomallei K96243]
          Length = 690

 Score =  183 bits (464), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 220/416 (52%), Gaps = 20/416 (4%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ 
Sbjct: 95  EMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQ 154

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV
Sbjct: 155 GKSGACRI-IDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAV 213

Query: 162 ELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
            +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +I
Sbjct: 214 AIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNI 273

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            G       S+        ++  G        ++      + A      ++ LAEP L  
Sbjct: 274 QGGFG----SWTGALVTSLLTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLVT 329

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           ISGQ A+F +GG+       SS   T+  T    ++GV L FTPTVLS GRI L++  EV
Sbjct: 330 ISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPEV 389

Query: 337 SE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           SE       +   N G+   +P    R+A TTV++  G T  + GL+KD+ Q   + +P 
Sbjct: 390 SELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALPG 449

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +
Sbjct: 450 IGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVY 505


>gi|217424167|ref|ZP_03455666.1| outer membrane protein [Burkholderia pseudomallei 576]
 gi|217392632|gb|EEC32655.1| outer membrane protein [Burkholderia pseudomallei 576]
          Length = 673

 Score =  183 bits (464), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 220/416 (52%), Gaps = 20/416 (4%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ 
Sbjct: 95  EMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQ 154

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV
Sbjct: 155 GKSGACRI-IDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAV 213

Query: 162 ELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
            +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +I
Sbjct: 214 AIAKAYSNRTNAGAAGSGVGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNI 273

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            G       S+        ++  G        ++      + A      ++ LAEP L  
Sbjct: 274 QGGFG----SWTGALVTSLLTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLVT 329

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           ISGQ A+F +GG+       SS   T+  T    ++GV L FTPTVLS GRI L++  EV
Sbjct: 330 ISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPEV 389

Query: 337 SE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           SE       +   N G+   +P    R+A TTV++  G T  + GL+KD+ Q   + +P 
Sbjct: 390 SELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALPG 449

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +
Sbjct: 450 IGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVY 505


>gi|218458719|ref|ZP_03498810.1| pilus assembly secretion protein [Rhizobium etli Kim 5]
          Length = 258

 Score =  183 bits (464), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 92/193 (47%), Positives = 132/193 (68%), Gaps = 17/193 (8%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           +++ +GLNK +++ +P D  D+LVSDP+ AD V  + R +YLFGK VGQ N+ + G  G+
Sbjct: 58  RRLKLGLNKAVVVDLPEDAHDILVSDPSMADAVTRTSRRIYLFGKKVGQTNIFVFGAGGQ 117

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
           +++NLDI IERD++ LE  LRRFI DS I VE+VSD +VL G VRT QD+ +A +L++ F
Sbjct: 118 EIINLDIEIERDVSGLEANLRRFIPDSAINVEIVSDNIVLTGTVRTPQDATQAADLAQVF 177

Query: 168 L---SQSGRNQYANSS--------------SKKVMNLLNIAGEDQVTLKVTIAEVRRDIL 210
           L     + R + A+ +              + +V+NLL I GEDQVTLKVTIAEVRR++L
Sbjct: 178 LKGGEATTRTETASGTGGDSAVALFAEGRQTSQVVNLLKIEGEDQVTLKVTIAEVRREVL 237

Query: 211 KQIGFQHSITGSS 223
           KQ+GF + ++ SS
Sbjct: 238 KQLGFDNLVSNSS 250


>gi|116748930|ref|YP_845617.1| type II and III secretion system protein [Syntrophobacter
           fumaroxidans MPOB]
 gi|116697994|gb|ABK17182.1| type II and III secretion system protein [Syntrophobacter
           fumaroxidans MPOB]
          Length = 482

 Score =  183 bits (464), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 136/437 (31%), Positives = 207/437 (47%), Gaps = 49/437 (11%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           +KI + + K +I++    V    +  P  AD+V  SP  +Y+ GK  G  N+ L   D K
Sbjct: 45  RKIHLQVGKSVIVRSGAPVVRTTLGSPDVADIVALSPTQIYITGKATGVTNLTLWQSDDK 104

Query: 108 QMLNLDILIERDIAHLEMTLRRFI-ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
                DI +  D   L+  L   +  + +I+V    D++ L G + +     +A+ L+E 
Sbjct: 105 VSAIYDIEVAPDTMRLKEKLHEVLPGERDIKVSASHDSLTLSGTISSSTHLAQAMTLAEA 164

Query: 167 FLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH--------- 217
           +           S  KKV+NLL ++G  QV L+V +AE+ R +  ++G            
Sbjct: 165 Y-----------SGGKKVINLLQVSGVHQVMLEVRVAEMSRTLTNRLGINSIWNVNGSMG 213

Query: 218 -SITGSSSGPSK------------SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALE 264
            S+ G+ +   K            +FA      F   GG F+    +D         AL+
Sbjct: 214 ASLLGNLASLDKFAGSASGSSSEFTFAPTVNSLFHILGGPFTWTAFID---------ALK 264

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLS 324
               ++ LAEPTL A+SGQSASF +GG+     V    G   +    +GV L FTPTVL+
Sbjct: 265 EDGLVKVLAEPTLIAMSGQSASFLAGGEFPIP-VPQGLGTVGIEYKQFGVSLAFTPTVLN 323

Query: 325 PGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQ 380
             R+ + +  EVSE      I +    +P    RK  T +EL  G +  +AGLLKD I++
Sbjct: 324 DKRMNIIVAPEVSELDYTTAINIAGVAVPGLTTRKVSTAIELNDGQSFAIAGLLKDTIRE 383

Query: 381 LKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDA 440
             +  P+L  IP+LGALFR+  F R ETE+ +  TP L KP+ +     P D + +E   
Sbjct: 384 DAKKFPILGSIPVLGALFRSVSFQRNETELIVIVTPRLAKPIDVATQPLPTDKF-IEPSD 442

Query: 441 KAFFFNRVNKIYGPKEA 457
             FFF  + +   PK A
Sbjct: 443 SEFFFLGLLQGRAPKPA 459


>gi|254192422|ref|ZP_04898861.1| type II/III secretion system protein [Burkholderia pseudomallei
           S13]
 gi|169649180|gb|EDS81873.1| type II/III secretion system protein [Burkholderia pseudomallei
           S13]
          Length = 690

 Score =  182 bits (463), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 220/416 (52%), Gaps = 20/416 (4%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ 
Sbjct: 95  EMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQ 154

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV
Sbjct: 155 GKSGACRI-IDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAV 213

Query: 162 ELSETFLSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
            +++ + +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +I
Sbjct: 214 AIAKAYSNRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNI 273

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            G       S+        ++  G        ++      + A      ++ LAEP L  
Sbjct: 274 QGGFG----SWTGALVTSLLTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLVT 329

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           ISGQ A+F +GG+       SS   T+  T    ++GV L FTPTVLS GRI L++  EV
Sbjct: 330 ISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPEV 389

Query: 337 SE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           SE       +   N G+   +P    R+A TTV++  G T  + GL+KD+ Q   + +P 
Sbjct: 390 SELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALPG 449

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +
Sbjct: 450 IGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVY 505


>gi|90411206|ref|ZP_01219219.1| Flp pilus assembly protein [Photobacterium profundum 3TCK]
 gi|90328052|gb|EAS44373.1| Flp pilus assembly protein [Photobacterium profundum 3TCK]
          Length = 489

 Score =  182 bits (463), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 130/441 (29%), Positives = 218/441 (49%), Gaps = 43/441 (9%)

Query: 40  SDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANV 99
           ++V   + + IS+  NK  ++++P   + + V +P  AD+++     +Y+ GK  G  NV
Sbjct: 28  TNVSATRTESISVPHNKSRLIEIPGRAKKISVGNPAIADILILRSNKIYVLGKQFGTTNV 87

Query: 100 ILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQR 159
           I+     + +  LD+ +  D+  L+  L  F+ +  I V    + +VL G V +      
Sbjct: 88  IIWDSKDRLITVLDVEVTHDLNALKSKLYEFMPNEKISVYTSQNKLVLSGEVSSADKIAT 147

Query: 160 AVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
           AVE++ TF           ++  +++NL+ + G  QV L+VT+AEV+R ++++   +  +
Sbjct: 148 AVEIANTF-----------TADGEIINLMAVGGSHQVMLEVTVAEVQRSLVREFDSKF-V 195

Query: 220 TGSSSGPSKSFAADFGGKFVSEGG------DFSV--------KGVLDRFSFETVLHALER 265
               SG      A+ G    S  G      D +V         G+   F     L A   
Sbjct: 196 FARQSGNWTWGGANGGASVPSNVGILDPILDAAVSNPLNIDDNGLFASFLSSNTLFAAAF 255

Query: 266 ATA-----IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
             A      + LAEPTLTAISG+ A F SGG+      +      ++   ++GV L F P
Sbjct: 256 DIAKTNGLAKVLAEPTLTAISGEEAEFISGGEFPIPVPNDEN--ITIEFKEFGVALKFLP 313

Query: 321 TVLSPGRIGLRIQTEVSE----PVIGVNAGD------MPSYRVRKADTTVELPSGGTIVL 370
           TV+S   I L +  EVSE      + +  G       +PS   R A TT+EL +G TI +
Sbjct: 314 TVMSADSINLALNIEVSEISNQNAVSITPGGTNSQFFVPSLSKRGAKTTIELGNGQTIGI 373

Query: 371 AGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           AGLL ++I  + + +P L  +PI+G LFR+  F + ETE+ I  TP L KPV  +D++ P
Sbjct: 374 AGLLNENITDVVDKLPGLGDLPIIGQLFRSQSFRKGETELVILVTPRLAKPVRKQDITLP 433

Query: 431 DDHYSVEDDAKAFFFNRVNKI 451
            D++   +D + +   R++++
Sbjct: 434 TDNFVEPNDWEYYLLGRMSEL 454


>gi|254255254|ref|ZP_04948570.1| Flp pilus assembly protein secretin CpaC [Burkholderia dolosa
           AUO158]
 gi|124900991|gb|EAY71741.1| Flp pilus assembly protein secretin CpaC [Burkholderia dolosa
           AUO158]
          Length = 682

 Score =  182 bits (463), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 123/407 (30%), Positives = 219/407 (53%), Gaps = 19/407 (4%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +S+ L K +++ +P  V++  + +P  A   + SP+T+Y+ G +VG  N+I+ G  G   
Sbjct: 100 VSVPLGKSLLVPMPEPVRNRTIGNPAVAQATMVSPQTLYILGMSVGTTNMIVQGKSGACR 159

Query: 110 LNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +D+ +  D A L+ +L + + +  ++ V   + T+VL G V + Q +Q+AV ++  + 
Sbjct: 160 V-IDVAVGADAAGLQASLMQLMPNERDVHVSTAAGTIVLSGSVSSSQAAQQAVAIARAY- 217

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK 228
             S  +         V+N+L++    QV L+V +AEV + ++ Q+G   +I G     S 
Sbjct: 218 GDSAGDGNGGGKPGSVLNMLSVTSPQQVMLEVKVAEVSKTLINQLGSAFNIQGGFGSWSG 277

Query: 229 SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
           +  ++     V+ G  F+     +   F   + A      ++ LAEP L  ISGQ A+F 
Sbjct: 278 ALVSNLLAG-VASGAVFNKA---NNRPFSVAVDAQNTDNLVKILAEPNLVTISGQEATFL 333

Query: 289 SGGQ---HLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE-PVIGVN 344
           +GG+    + ++  + T   ++   ++GV L FTPTVL+ GRI L++  EVSE    GV 
Sbjct: 334 AGGKIFIPVPQSSGTGTTTITLQEEEFGVALKFTPTVLANGRISLKVAPEVSELSQTGVT 393

Query: 345 --------AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
                   A  +P    R+A TTV++  G T  + GL+KD+     + IP + ++P+LGA
Sbjct: 394 LSATNVSGASILPLITTRRASTTVQMSDGETFAIGGLIKDNASGALKAIPGVGEVPVLGA 453

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           LFR++ F ++ TE+    TP LVKP++  D++ P D +S  ++A  +
Sbjct: 454 LFRSTSFQQDRTELIFVITPHLVKPLSTADVALPTDSFSKPNEADVY 500


>gi|167574003|ref|ZP_02366877.1| type II/III secretion system protein [Burkholderia oklahomensis
           C6786]
          Length = 548

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 127/423 (30%), Positives = 217/423 (51%), Gaps = 32/423 (7%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ 
Sbjct: 91  EMREATSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGLSVGTTNMIVQ 150

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFI-ADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ +LR+ + A+ +IRV   +DT+VL G    + D+Q A 
Sbjct: 151 GRSGACQI-IDVAVGADAGGLQTSLRQLMPAERDIRVSTAADTIVLAG---NVSDAQAAQ 206

Query: 162 ELSETFLSQSGRNQYANSSSKK-------VMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
           +      + S R      +          V+N+L +    QV L+V +AEV + ++ Q+G
Sbjct: 207 QAVAIAKAYSDRTNVGPGAGAGAGGPRGGVLNMLTVTSPQQVLLEVKVAEVSKTLINQMG 266

Query: 215 FQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAE 274
              +I G       S+        ++  G+       ++  F+  L A      ++ LAE
Sbjct: 267 SAINIQGGFG----SWTGMLVSSLLAGVGNGIAASKSNKLPFKAALDAQNTDQPVKILAE 322

Query: 275 PTLTAISGQSASFTSGGQ---HLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           P L  ISGQ A+F +GG+    + ++  + T   ++   ++GV L FTPTVLS GRI L+
Sbjct: 323 PRLVTISGQEATFLAGGKIFIPVPQSSGTGTTTITLQEEEFGVGLKFTPTVLSNGRISLK 382

Query: 332 IQTEVSE-----------PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQ 380
           +  EVSE            V GV+   +P    R+A TTV++  G T  + GL+KD+ Q 
Sbjct: 383 VAPEVSELSPTGVTLSATNVSGVSI--LPLITTRRASTTVQMGDGETFAIGGLIKDNAQG 440

Query: 381 LKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDA 440
               +P + +IP+LGALFR++ F ++ TE+    TP LVKP+   D+  P D ++  ++ 
Sbjct: 441 TLRALPGIGEIPVLGALFRSTSFQQDRTELVFIITPHLVKPLETADVPLPTDSFTKPNEV 500

Query: 441 KAF 443
             +
Sbjct: 501 DVY 503


>gi|332188377|ref|ZP_08390102.1| bacterial type II and III secretion system family protein
           [Sphingomonas sp. S17]
 gi|332011606|gb|EGI53686.1| bacterial type II and III secretion system family protein
           [Sphingomonas sp. S17]
          Length = 511

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 138/451 (30%), Positives = 224/451 (49%), Gaps = 44/451 (9%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + I   +  ++ +P  + D+ V+D T ADV V SP  +Y+FGK  G+  +      G  +
Sbjct: 52  LEINTGRARLITLPRPMTDLFVADDTIADVQVRSPTQLYIFGKKPGETTISATARGGAVV 111

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
               + I  ++  +   LR  + ++ I    ++  ++L G V    D   A  L + ++ 
Sbjct: 112 YATTVRIGNNLDSIGRMLRLAMPEAQIASTPMNGLILLTGTVAAPDDVAEAERLVQAYVG 171

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG------------FQH 217
           +            KV++ L  A   QV L+V IAEV R+ +K IG            F  
Sbjct: 172 KD----------TKVISRLKTATPLQVNLQVRIAEVNRNFVKSIGVNLLNRDRNSSGFVF 221

Query: 218 SITGSSSGP------SKSFAADFGGKF-VSEGGDFSVKGVLDRFSFETVLHAL---ERAT 267
            I GS   P      + +     G ++  ++G   +  G+  R     +L A+   E   
Sbjct: 222 GI-GSGRNPGTITDLTNAAGTTIGTQYGFNQGPLRTTLGLGGRVLGMDLLGAMDLGETLG 280

Query: 268 AIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGR 327
            + TLA P LTA+SG++A+F +GG+ +   +S+  GA SV    YGV L +TPTVLS GR
Sbjct: 281 QVSTLANPNLTALSGETATFLAGGE-IPIPLSTGLGAVSVEYKQYGVSLSYTPTVLSDGR 339

Query: 328 IGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKE 383
           I LR++ EVS+      + ++   +P+   R+A+TT+EL SG ++++ GLL +      E
Sbjct: 340 ISLRVRPEVSQITSVGAVTISGTTIPALTTRRAETTLELGSGQSMMIGGLLSNSRDNSIE 399

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV-AMRDLSRPDDHYSVEDDAKA 442
             P L  +P++GALFR++ F R ETE+ I  TP+LVKPV +  D++ P D     +DA+ 
Sbjct: 400 KTPWLGDLPLIGALFRSNAFKRNETELVIIITPYLVKPVNSPSDIALPTDGQRSPNDAER 459

Query: 443 FFFNRVNKIYG-----PKEASEVEGQNYKGA 468
               R+          P  A+ V+G+   GA
Sbjct: 460 VLLGRMAAGSSEPRPVPTMATPVQGRPVTGA 490


>gi|167924333|ref|ZP_02511424.1| Putative phospholipid-binding domain family protein [Burkholderia
           pseudomallei BCC215]
          Length = 438

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 124/409 (30%), Positives = 217/409 (53%), Gaps = 20/409 (4%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ G  G   
Sbjct: 7   VSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQGKSGACR 66

Query: 110 LNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV +++ + 
Sbjct: 67  I-IDVAVGADAGGLQASLRQLMPRERDIRVSTAADTIVLAGNVSSAQAAQQAVAIAKAYS 125

Query: 169 SQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGP 226
           +++      +    +  V+N+L +    QV L+V +AEV + ++ Q+G   +I G     
Sbjct: 126 NRTNAGAAGSGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGSAVNIQGGFG-- 183

Query: 227 SKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSAS 286
             S+        ++  G        ++      + A      ++ LAEP L  ISGQ A+
Sbjct: 184 --SWTGALVTSLLTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEPRLVTISGQEAT 241

Query: 287 FTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEVSE----- 338
           F +GG+       SS   T+  T    ++GV L FTPTVLS GRI L++  EVSE     
Sbjct: 242 FLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKVAPEVSELSPTG 301

Query: 339 -PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPIL 394
             +   N G+   +P    R+A TTV++  G T  + GL+KD+ Q   + +P + ++P+L
Sbjct: 302 VTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLKALPGIGELPVL 361

Query: 395 GALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           GALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +
Sbjct: 362 GALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVY 410


>gi|167566934|ref|ZP_02359850.1| outer membrane protein [Burkholderia oklahomensis EO147]
          Length = 550

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 127/423 (30%), Positives = 217/423 (51%), Gaps = 32/423 (7%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ 
Sbjct: 93  EMREATSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGLSVGTTNMIVQ 152

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFI-ADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ +LR+ + A+ +IRV   +DT+VL G    + D+Q A 
Sbjct: 153 GRSGACQI-IDVAVGADAGGLQTSLRQLMPAERDIRVSTAADTIVLAG---NVSDAQAAQ 208

Query: 162 ELSETFLSQSGRNQYANSSSKK-------VMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
           +      + S R      +          V+N+L +    QV L+V +AEV + ++ Q+G
Sbjct: 209 QAVAIAKAYSDRTNVGPGAGAGAGGPRGGVLNMLTVTSPQQVLLEVKVAEVSKTLINQMG 268

Query: 215 FQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAE 274
              +I G       S+        ++  G+       ++  F+  L A      ++ LAE
Sbjct: 269 SAINIQGGFG----SWTGMLVSSLLAGVGNGIAASKSNKLPFKAALDAQNTDQPVKILAE 324

Query: 275 PTLTAISGQSASFTSGGQ---HLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           P L  ISGQ A+F +GG+    + ++  + T   ++   ++GV L FTPTVLS GRI L+
Sbjct: 325 PRLVTISGQEATFLAGGKIFIPVPQSSGTGTTTITLQEEEFGVGLKFTPTVLSNGRISLK 384

Query: 332 IQTEVSE-----------PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQ 380
           +  EVSE            V GV+   +P    R+A TTV++  G T  + GL+KD+ Q 
Sbjct: 385 VAPEVSELSPTGVTLSATNVSGVSI--LPLITTRRASTTVQMGDGETFAIGGLIKDNAQG 442

Query: 381 LKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDA 440
               +P + +IP+LGALFR++ F ++ TE+    TP LVKP+   D+  P D ++  ++ 
Sbjct: 443 TLRALPGIGEIPVLGALFRSTSFQQDRTELVFIITPHLVKPLETADVPLPTDSFTKPNEV 502

Query: 441 KAF 443
             +
Sbjct: 503 DVY 505


>gi|294139870|ref|YP_003555848.1| Flp pilus assembly protein CpaC [Shewanella violacea DSS12]
 gi|293326339|dbj|BAJ01070.1| Flp pilus assembly protein CpaC [Shewanella violacea DSS12]
          Length = 442

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 138/418 (33%), Positives = 207/418 (49%), Gaps = 58/418 (13%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++ LNK  ++Q+P   + + +S  T AD    +   + +FGK  G  ++ ++  D   +
Sbjct: 3   LAVTLNKAELVQLPKTAKSIFISSNTIADYQALTNTKIMVFGKRAGTTSLYVLDADENVI 62

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            +  + +  ++  L   +R    D+ +  E ++  + L G V T   +++ V LSE ++S
Sbjct: 63  YSASVKVSHNVTELNGLIRSEFPDALVSAESIAGKLFLKGRVPTPTMAEKIVRLSEGYVS 122

Query: 170 Q----SGRNQYANSSSK------------------------KVMNLLNIAGEDQVTLKVT 201
           Q     G+ Q   SS +                        +++N L I    QV L+V 
Sbjct: 123 QPQSSKGKQQGGKSSGQAKGSKQQGQNGGGQESQSGTGSKGELINQLEITMSTQVNLRVR 182

Query: 202 IAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG-GKFV-SEGGDFSVKGVLDRFSFETV 259
           IAEV R++  ++G +    G            FG GKF  S+G  FS   V+        
Sbjct: 183 IAEVSRNVSNKLGIKWGSQG------------FGTGKFAFSDGLGFSKLSVM-------- 222

Query: 260 LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFT 319
           + AL     I  LAEP LTAISG+ ASF  GG+     +   T   S+    +GV L F 
Sbjct: 223 VDALATNGMITVLAEPNLTAISGEKASFLVGGEVPIPLIYGDT--VSIEYKPFGVRLDFK 280

Query: 320 PTVLSPGRIGLRIQTEVSEPVIGVNA--GD--MPSYRVRKADTTVELPSGGTIVLAGLLK 375
           PTVLSP RI L+I+ EVS      N   GD   P +  RKA TT+EL SG +  L GLL+
Sbjct: 281 PTVLSPNRISLQIEPEVSTISQSTNVVMGDSSFPVFMTRKASTTIELASGQSFALGGLLQ 340

Query: 376 D-DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDD 432
             DI+Q+++ +P +  IPILGALFR++ F REETE+ I AT +LV+P     L  P D
Sbjct: 341 STDIEQMQK-MPWIGDIPILGALFRSNEFKREETELIIIATVYLVEPTRGDSLPLPTD 397


>gi|126445563|ref|YP_001064076.1| type II/III secretion system protein [Burkholderia pseudomallei
           668]
 gi|126225054|gb|ABN88559.1| type II/III secretion system protein [Burkholderia pseudomallei
           668]
          Length = 690

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 125/420 (29%), Positives = 219/420 (52%), Gaps = 24/420 (5%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   +S+ L K +++ +   V++  + +P  A   + SPRT+YL G +VG  N+I+ 
Sbjct: 95  EMRESTSVSVPLGKSLLVPLDEPVRNRTIGNPAVAQATMVSPRTLYLVGMSVGTTNMIVQ 154

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ +LR+ +  + +IRV   +DT+VL G V + Q +Q+AV
Sbjct: 155 GKSGACRI-IDVAVGADAGGLQASLRQLMPREHDIRVSTAADTIVLAGNVSSAQAAQQAV 213

Query: 162 ELSETFLSQSGRNQYANSSSKK------VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
            +++ + +++      +           V+N+L +    QV L+V +AEV + ++ Q+G 
Sbjct: 214 AIAKAYSNRTNAGAAGSGGGNGGGARADVLNMLTVTSPQQVMLEVKVAEVSKTLINQMGS 273

Query: 216 QHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEP 275
             +I G       S+        ++  G        ++      + A      ++ LAEP
Sbjct: 274 AVNIQGGFG----SWTGALVTSLLTGVGSGIAASKSNKLPLNGSIDAQNTDQPVKILAEP 329

Query: 276 TLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRI 332
            L  ISGQ A+F +GG+       SS   T+  T    ++GV L FTPTVLS GRI L++
Sbjct: 330 RLVTISGQEATFLAGGKIFIPVPQSSGIGTNTITLQEEEFGVGLKFTPTVLSNGRISLKV 389

Query: 333 QTEVSE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKE 383
             EVSE       +   N G+   +P    R+A TTV++  G T  + GL+KD+ Q   +
Sbjct: 390 APEVSELSPTGVTLSAANVGNVSILPLITTRRASTTVQMGDGETFAIGGLIKDNAQGTLK 449

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
            +P + ++P+LGALFR++ F ++ TE+    TP LV+P+   D+  P D ++  ++A  +
Sbjct: 450 ALPGIGELPVLGALFRSTSFQQDRTELVFIITPHLVQPLETADVPLPTDSFTKPNEADVY 509


>gi|172065273|ref|YP_001815985.1| type II and III secretion system protein [Burkholderia ambifaria
           MC40-6]
 gi|171997515|gb|ACB68432.1| type II and III secretion system protein [Burkholderia ambifaria
           MC40-6]
          Length = 656

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 125/422 (29%), Positives = 217/422 (51%), Gaps = 19/422 (4%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +S+ L K +++ +P  V++  + +P  A   + SP+T+Y+ G +VG  N+I+ G  G   
Sbjct: 100 VSVPLGKSLLVPMPEPVRNRTIGNPAVAQATMVSPQTLYILGLSVGTTNMIVQGRSGACR 159

Query: 110 LNLDILIERDIAHLEMTLRRFI-ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +D+ +  D   L+ +L++ +  + +I V   + T+VL G V   Q +Q+AV+++  + 
Sbjct: 160 V-IDVAVGADAGGLQSSLQQLMPGERDIHVSTAAGTIVLAGTVSNSQAAQQAVQIAHAY- 217

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK 228
           S S  +         V+N+L +    QV L+V +AEV + ++ Q+G   +I G     S 
Sbjct: 218 SDSAGDGGGAGKGAGVLNMLAVTSPQQVMLEVKVAEVSKTLINQMGSAFNIQGGFGSWSG 277

Query: 229 SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
           +  ++      S G    +    +   F     A      ++ LAEP L  ISGQ A+F 
Sbjct: 278 ALVSNLLAGVASAG----IFNKANNKPFSVAADAQNTDNLVKILAEPNLVTISGQEATFL 333

Query: 289 SGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEVSE------P 339
           +GG+       SS   TS  T    ++GV L FTPTVL+ GRI L++  EVSE       
Sbjct: 334 AGGKIFIPIPQSSGNGTSSITLQEEEFGVALKFTPTVLANGRISLKVAPEVSELSQTGVT 393

Query: 340 VIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
           +   N G    +P    R+A TTV++  G +  + GL+KD+     + IP + ++P+LGA
Sbjct: 394 LSATNIGGTSILPLITTRRASTTVQMSDGESFAIGGLIKDNATGALKAIPGVGEVPVLGA 453

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKE 456
           LFR++ F ++ TE+    TP LV+P+   D+  P D +S  ++   +    +    G ++
Sbjct: 454 LFRSTSFQQDRTELIFLITPHLVRPLQTADVPLPTDSFSKPNEVDVYATGNMEGRKGVRK 513

Query: 457 AS 458
           A+
Sbjct: 514 AT 515


>gi|163733542|ref|ZP_02140985.1| type II/III secretion system protein, putative [Roseobacter
           litoralis Och 149]
 gi|161393330|gb|EDQ17656.1| type II/III secretion system protein, putative [Roseobacter
           litoralis Och 149]
          Length = 440

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 128/441 (29%), Positives = 220/441 (49%), Gaps = 34/441 (7%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           + +++  N+ ++++  +   ++ +++P  AD+   S R++Y+ GK  G   + L+   G+
Sbjct: 20  ETLNVSQNRAVVVESEIPFAELSIANPGIADISSLSDRSIYVLGKVPGITTLTLLDAAGQ 79

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
            + N+++ +  D+   +  LR+ +    I V   +D +VL G V + Q   +A+EL+   
Sbjct: 80  LITNVEVRVAPDLTEFKERLRQILPGEAIEVRTANDGIVLSGQVSSSQRLSKALELA--- 136

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
                    A  +  +V NL+ + G  QV LKV  AE+ R + KQ+     I G+ +   
Sbjct: 137 ---------ARYAPDRVSNLMTVGGVQQVMLKVRFAEMSRGVSKQLQSSLRIGGTEAQAG 187

Query: 228 K--------SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
                    + AAD      ++G  F   G L     + +L ALE   A+RTLAEP L +
Sbjct: 188 IGRGIGGIPNLAAD-----TAQGAVFFDFG-LGSTQVQLLLEALETKGAVRTLAEPNLVS 241

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS-- 337
           +SGQ A+F +GG+  Y     S    SV    +G+ L+F P V+    I L++    S  
Sbjct: 242 LSGQEANFLAGGE--YPVPVQSEDGISVDYKPFGIELNFVPRVVDGDLINLQLSAATSSI 299

Query: 338 EPVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPIL 394
           +P  G++ GD   + ++  R+A TTVE+  G +  +AGLL+D+       +P LS +PIL
Sbjct: 300 DPSNGISVGDSFTVDAFIRREASTTVEMRDGESFAIAGLLEDNFNDNISQVPWLSDVPIL 359

Query: 395 GALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR-VNKIYG 453
           GALFR++ + R +TE+ I  T  LV P     L+ P D      +   F   R +  +  
Sbjct: 360 GALFRSTDYMRNQTELVIIITAHLVTPTRGEALALPTDRIRPPSEKDLFLNGRTIQTLNA 419

Query: 454 PKEASEVEGQNYKGAIGFIYK 474
              A EV  Q++ G+ G++ +
Sbjct: 420 RGAAGEVAKQDFGGSYGYVME 440


>gi|251789646|ref|YP_003004367.1| type II and III secretion system protein [Dickeya zeae Ech1591]
 gi|247538267|gb|ACT06888.1| type II and III secretion system protein [Dickeya zeae Ech1591]
          Length = 474

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 131/418 (31%), Positives = 213/418 (50%), Gaps = 32/418 (7%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           +I    +I + +N+  +LQ+      VL++DP  A   + SP  +++F K VG   +  +
Sbjct: 38  QIEATSEIRLNINQGRMLQLDHIPDSVLIADPAIASFELPSPGNVFVFAKGVGNTTLYAM 97

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEM-VSDTVVLHGMVRTIQDSQRAV 161
             DG+ +  + +++E D+  L+  LRR   D+ I++E  V + V++ G V T QD+++ +
Sbjct: 98  DVDGQVVSAIHLVVEHDLDALKERLRREFPDAQIQLEASVPNGVIVRGSVETPQDAKKVI 157

Query: 162 ELSETFLSQSGRNQY--------------ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRR 207
           +  + ++  S  ++               ++S+S  V+N L +    Q+ ++V + EV R
Sbjct: 158 DSVQAWVGASASSRGSAGGGGGGGSAMPASSSTSPNVVNQLKVRTPSQINIRVRVVEVSR 217

Query: 208 DILKQIGFQ--------HSITGSSSGPSKSFAADFGGKFVSEGGDFSV--KGVLDRFSFE 257
            +  ++GF          +  G  SG   +F +     F  E G  S+         S  
Sbjct: 218 KLTHELGFNWDSSLNRGRNTIGFGSGALSNFFSATSNTFSREAGSASLGYNYTGSDGSLG 277

Query: 258 TVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLH 317
           T+L AL        LAEP LTA+SG++A+F +GG+     V  +  + S+    YGV+L 
Sbjct: 278 TLLSALNSQGMASVLAEPNLTAMSGETAAFAAGGE--VPIVLITGNSVSIDYKSYGVILR 335

Query: 318 FTPTVLSPGRIGLRIQTEVSEPV----IGVNAGD-MPSYRVRKADTTVELPSGGTIVLAG 372
            TPT+LS  RI L I  EVSE      + +  G  +P+  VR+ADTTVEL SG +  LAG
Sbjct: 336 MTPTLLSANRISLHIAPEVSELTSVGSVQLEGGSTIPALTVRRADTTVELASGQSFALAG 395

Query: 373 LLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           +L+    Q   G+P LS IP+LG  F     + EETE+ I AT ++V PV+   L  P
Sbjct: 396 MLRSSNSQTVAGVPGLSGIPLLGRAFERESTSSEETELVIIATAYVVAPVSAGTLQTP 453


>gi|303248302|ref|ZP_07334564.1| type II and III secretion system protein [Desulfovibrio
           fructosovorans JJ]
 gi|302490327|gb|EFL50239.1| type II and III secretion system protein [Desulfovibrio
           fructosovorans JJ]
          Length = 528

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 135/470 (28%), Positives = 229/470 (48%), Gaps = 72/470 (15%)

Query: 34  AAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKN 93
           AA   +  V +    ++S+ + K +ILQ   DV  V V+ P  AD V+ SPR +Y+ G+ 
Sbjct: 28  AAPGRMGTVAVRTAPRLSLTIGKSVILQSDADVSRVSVAQPEIADFVLLSPRQIYVTGRA 87

Query: 94  VGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFI-ADSNIRVEMVSDTVVLHGMVR 152
            G  N+ L     K     D+ +  DI+ L+  L   +  +S I V    D++ L G VR
Sbjct: 88  PGITNLTLWDKGDKVRAVYDLDVAPDISRLKKMLHDVMPGESGIEVMSSQDSIALSGTVR 147

Query: 153 TIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQ 212
              + ++A+ L+E +            + KKV+NLL++ G  QV L+V +AE+ + ++ +
Sbjct: 148 DSANMKKALALAEVY------------APKKVLNLLSVGGVQQVMLEVRVAEMSKSLVNR 195

Query: 213 IG----------FQHSITGS----SSGPSKSFAADFGGKFVS---EGGD----------- 244
           +G          F +++ GS    +SG   ++      ++++     GD           
Sbjct: 196 MGINLNAVGDGNFAYTLIGSLSSVASGMFDTYYPQNAYQYITMTANSGDGNSSFDSTPIQ 255

Query: 245 ----------------FSVKGVLDRF----------SFETVLHALERATAIRTLAEPTLT 278
                           F+    + R+          +   V+  L++   ++ LAEP L 
Sbjct: 256 LAYREFNQPSSKATMSFNQGTAVARWNTNFGGAGNTAMTAVVDMLKQNGLVKILAEPNLV 315

Query: 279 AISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE 338
            ++GQSA F +GGQ +   VSS  G TS+    +GV L+FTPTV++  RI L++  EVS 
Sbjct: 316 CLNGQSADFLAGGQ-IPVPVSSGLGTTSIEWKKFGVQLNFTPTVVAGDRINLKVNPEVSN 374

Query: 339 ----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPIL 394
                 I +    +P+   R+  TT+EL +G T  +AG+L +  +   +  P+L  IP+L
Sbjct: 375 LDYTRAITLLGSTVPAINTRQTSTTIELKNGQTFAIAGMLNEQSRDSMDKYPVLGDIPVL 434

Query: 395 GALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF 444
           GALF++S++ +++TE+ I  T  LVKP+  + +S P D     DD + F 
Sbjct: 435 GALFKSSQYQKDQTELVILITAHLVKPLDKKAISLPTDSAHEPDDLEFFL 484


>gi|253687068|ref|YP_003016258.1| type II and III secretion system protein [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251753646|gb|ACT11722.1| type II and III secretion system protein [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 478

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 130/417 (31%), Positives = 220/417 (52%), Gaps = 29/417 (6%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           ++ + +N+  +LQ+      VLV+DP  A   + SP  ++++ K+VG   +  +  +G  
Sbjct: 55  EVHLTVNQGRLLQLADTPDSVLVADPNIASFELPSPGNLFVYAKSVGVTTLYAMDENGNV 114

Query: 109 MLNLDILIERDIAHLEMTLRRFIADSNIRVEM-VSDTVVLHGMVRTIQDSQRAVELSETF 167
           +  + ++ E D+  L   ++R    ++I++E  +   V++ G V T QD++R ++  + +
Sbjct: 115 INAIRLVSEHDLKALGERMKREFPGADIQLEASIPSGVIVRGSVDTPQDAKRVIDSIQAY 174

Query: 168 LSQSGRNQY-----------ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ 216
           +S S   Q            ++ SS KV+N L I    Q+ ++V + EV R +  ++GF 
Sbjct: 175 ISASSGGQGGGGGGGEKLPGSSESSGKVINQLKIKTPSQINIQVRVVEVSRKLTSELGFN 234

Query: 217 HSITGSSSGPSKSFAADFGGK---FVSEGGDFSV---KGVLD--RFSFETVLHALERATA 268
            + + S+   S + +A  G +   F +  G FS     G L+  R     +L A+ +   
Sbjct: 235 WAASLSTG--SGNMSAGSGSRLNLFNATTGRFSNPTDSGFLNFGRSRLSGLLTAMNQQGM 292

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRI 328
              LAEP LTA+SG++A+F +GG+     V  +  + S+    YGV+L  TPT+LS  RI
Sbjct: 293 ATVLAEPNLTAMSGETAAFAAGGE--VPIVLITNNSVSIDYKSYGVILRMTPTLLSANRI 350

Query: 329 GLRIQTEVSEPV----IGVNAGD-MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKE 383
            L I  EVSE      + +  G  +P+  VR+ADTTVEL SG +  LAG+L+    Q   
Sbjct: 351 SLHIAPEVSELTDVGSVQLEGGSRIPALTVRRADTTVELASGQSFALAGMLRSAGSQTIN 410

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDA 440
           G+P LS +P+ G LF +   ++EETE+ I AT ++V+PV   DL  P     + D +
Sbjct: 411 GVPGLSSVPMFGRLFESEATSQEETELVIIATAYVVEPVNAGDLQTPGQGVKMLDSS 467


>gi|115361033|ref|YP_778170.1| type II and III secretion system protein [Burkholderia ambifaria
           AMMD]
 gi|115286361|gb|ABI91836.1| type II and III secretion system protein [Burkholderia ambifaria
           AMMD]
          Length = 657

 Score =  181 bits (459), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 122/399 (30%), Positives = 210/399 (52%), Gaps = 18/399 (4%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++ L K +++ +P  V++  + +P  A   + SP+T+Y+ G +VG  N+I+ G  G   
Sbjct: 100 VTVPLGKSLLVPMPEPVRNRTIGNPAVAQATMVSPQTLYILGLSVGTTNMIVQGRSGACR 159

Query: 110 LNLDILIERDIAHLEMTLRRFI-ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +D+ +  D   L+ +L++ +  + +I V   + T+VL G V   Q +Q+AV+++  + 
Sbjct: 160 V-IDVAVGADAGGLQSSLQQLMPGERDIHVSTAAGTIVLAGTVSNSQAAQQAVQIAHAYS 218

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK 228
             +G           V+N+L +    QV L+V +AEV + ++ Q+G   +I G     S 
Sbjct: 219 DSAGEGAGGAGKGAGVLNMLAVTSPQQVMLEVKVAEVSKTLINQMGTAFNIQGGFGSWSG 278

Query: 229 SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
           +  ++      S G    +    +   F     A      ++ LAEP L  ISGQ A+F 
Sbjct: 279 ALVSNLLAGVASAG----IFNKANNKPFSVAADAQNTDNLVKILAEPNLVTISGQEATFL 334

Query: 289 SGGQHLYKTV-SSSTGATSVTTHD--YGVVLHFTPTVLSPGRIGLRIQTEVSE------P 339
           +GG+       SS TG +S+T  +  +GV L FTPTVL+ GRI L++  EVSE       
Sbjct: 335 AGGKIFIPVPQSSGTGTSSITLQEEEFGVALKFTPTVLANGRISLKVAPEVSELSQTGVT 394

Query: 340 VIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
           +   N G    +P    R+A TTV++  G +  + GL+KD+     + IP + ++P+LGA
Sbjct: 395 LSATNIGGTSILPLITTRRASTTVQMSDGESFAIGGLIKDNASGSLKAIPGVGEVPVLGA 454

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYS 435
           LFR++ F ++ TE+    TP LV+P+   D+  P D +S
Sbjct: 455 LFRSTSFQQDRTELIFLITPHLVRPLQTADVPLPTDSFS 493


>gi|152994347|ref|YP_001339182.1| type II and III secretion system protein [Marinomonas sp. MWYL1]
 gi|150835271|gb|ABR69247.1| type II and III secretion system protein [Marinomonas sp. MWYL1]
          Length = 463

 Score =  181 bits (459), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 127/443 (28%), Positives = 222/443 (50%), Gaps = 20/443 (4%)

Query: 11  MMSIFLFSSNPSVAKLPPIK---EANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQ 67
           +  +FL S     A L P+    E+ + +   +  ++     +++ +N+  +L +P +  
Sbjct: 13  LFGVFLLSGVSRAAYLEPMNNTSESQSVIGTSAYQQVEVSGNVNLVVNRGKLLTLPQNAA 72

Query: 68  DVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTL 127
            VL+++P  A   + SP  +++F K  G  ++  +  + + +L L +    D+  L   +
Sbjct: 73  KVLIANPDIASFQMPSPDNVFVFAKKSGSTSLYALDDENQVILALTLNAGYDLNSLTKQV 132

Query: 128 RRFIADSNIRVEMVSDT-VVLHGMVRTIQDSQRAVELSETFLSQSGRNQY-ANSSSKKVM 185
            + +  SN++V   ++  +++ G V+T Q ++R ++  E F+         A S + +++
Sbjct: 133 AQEVPGSNVQVGPATENGLIVRGSVQTPQQAKRVIDSVEAFVGGDATGSAGAGSQTLRIV 192

Query: 186 NLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDF 245
           N L +    Q+ + V I EV R++   +GF       +    K FA +    F +  G F
Sbjct: 193 NQLKVELSSQINISVRIVEVSRNLSSSLGFSWDALFDNG---KYFARNSASLFDATTGAF 249

Query: 246 SVKGVLDRF------SFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVS 299
           +  GV +        +   VL AL        LAEP LTA+SG++A F  GG+     ++
Sbjct: 250 TGSGVTNAVFGGASGNLGGVLSALSNDGLASILAEPNLTAMSGETAGFAVGGEVPIVIIT 309

Query: 300 SSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS----EPVIGVNAGDMPSYRVRK 355
           ++    ++    YGV++  TPT+LSP RI L I  EVS    E  + +    +P+++VR+
Sbjct: 310 NNN--VTIEYKQYGVIMRMTPTLLSPNRISLHIAPEVSDLTEEGAVELQGLTVPAFKVRR 367

Query: 356 ADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAAT 415
           ADTTVEL SG +  LAG+L+  + Q   G+P L  IP LG LF +    +EETE+ I AT
Sbjct: 368 ADTTVELASGQSFALAGMLRSSVSQTVTGVPGLRSIPGLGRLFESETNQKEETELVIIAT 427

Query: 416 PFLVKPVAMRDLSRPDDHYSVED 438
            ++V P +  DL  P    S  D
Sbjct: 428 AYVVAPTSSGDLQTPAKGISTID 450


>gi|28899193|ref|NP_798798.1| putative pilus assembly transmembrane protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|153836824|ref|ZP_01989491.1| Flp pilus assembly protein [Vibrio parahaemolyticus AQ3810]
 gi|260361569|ref|ZP_05774596.1| Flp pilus assembly protein [Vibrio parahaemolyticus K5030]
 gi|260876726|ref|ZP_05889081.1| Flp pilus assembly protein [Vibrio parahaemolyticus AN-5034]
 gi|260898195|ref|ZP_05906691.1| Flp pilus assembly protein [Vibrio parahaemolyticus Peru-466]
 gi|260900397|ref|ZP_05908792.1| Flp pilus assembly protein [Vibrio parahaemolyticus AQ4037]
 gi|28807417|dbj|BAC60682.1| putative pilus assembly transmembrane protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149749970|gb|EDM60715.1| Flp pilus assembly protein [Vibrio parahaemolyticus AQ3810]
 gi|308089085|gb|EFO38780.1| Flp pilus assembly protein [Vibrio parahaemolyticus Peru-466]
 gi|308091468|gb|EFO41163.1| Flp pilus assembly protein [Vibrio parahaemolyticus AN-5034]
 gi|308109123|gb|EFO46663.1| Flp pilus assembly protein [Vibrio parahaemolyticus AQ4037]
 gi|308114031|gb|EFO51571.1| Flp pilus assembly protein [Vibrio parahaemolyticus K5030]
 gi|328474270|gb|EGF45075.1| pilus assembly protein CpaC [Vibrio parahaemolyticus 10329]
          Length = 487

 Score =  181 bits (458), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 129/428 (30%), Positives = 211/428 (49%), Gaps = 26/428 (6%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
           G+ +S+  ++   L +    + V + DP   D+VV     ++L GK +G  NV +    G
Sbjct: 26  GRVVSVAHHQSTQLVISGKAKKVTLGDPEVLDIVVLRSNELFLIGKKLGTTNVSVWDSRG 85

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           + +   ++ +  D+  L+  L +F+ D +I V    + VVL G+V + Q+   AV+++ET
Sbjct: 86  RLIEQFNVEVTHDLNTLKSKLFQFLPDESIEVHSAQEKVVLRGLVSSQQNMDIAVKIAET 145

Query: 167 FL---SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS 223
           F    +    +  A      V+NLL+I G  QVTL+VT+AEV+R ++++           
Sbjct: 146 FALGDAADEEDDNAKDDESSVINLLSIGGAQQVTLEVTVAEVQRSLVRRFDSNFHFF-QK 204

Query: 224 SGPSKSFAADFGGKFVSEGGDFSVK-----GVLDRF-----SFETVLHALERATAIRTLA 273
           SG     A   GG   + G   +V      G L  F      F   L   ++    + LA
Sbjct: 205 SGDFTWGATTAGGGIDNIGPILNVPTVEDFGFLGSFIDSNTLFTFALDVAKQNGVAKVLA 264

Query: 274 EPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQ 333
           EP+LTA+SG  A F +GG+  +     +    ++   +YGV L F P +LS  RI L++ 
Sbjct: 265 EPSLTALSGTQAEFVAGGE--FPIPVPNEDGITIDYKEYGVQLDFVPFILSDKRINLKLN 322

Query: 334 TEVSE----PVIGVNAGD------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKE 383
             VSE     V+  N  +      +P    R A TT+EL  G TI +AGLL ++ + + +
Sbjct: 323 VNVSEISNSGVLTFNPNEVNATFFIPPITKRSAGTTIELADGQTIGIAGLLSENARNVAD 382

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           GIP  S +P+LG LF++  F   ETE+ I  TP L  P+  R ++ P D +   +D + +
Sbjct: 383 GIPGASDLPVLGRLFKSEEFTSGETELVILVTPRLATPIDRRRVTLPTDGFVAPNDVEFY 442

Query: 444 FFNRVNKI 451
              +  K+
Sbjct: 443 LLGKGAKL 450


>gi|85373131|ref|YP_457193.1| type II secretion system protein [Erythrobacter litoralis HTCC2594]
 gi|84786214|gb|ABC62396.1| type II secretion system protein [Erythrobacter litoralis HTCC2594]
          Length = 574

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 146/475 (30%), Positives = 231/475 (48%), Gaps = 74/475 (15%)

Query: 22  SVAKLP----PIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKA 77
           S+A LP    P + A+A  I    V+  +   +SIG  ++I   VP  + DV +++   A
Sbjct: 39  SLAALPVAAGPAQVAHAQSI----VKPSQDVVLSIGRGELI--SVPGAMADVFIANDAVA 92

Query: 78  DVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIR 137
           DV + S R +Y+FGK+ G+  +      G  +   ++ +  +I  L+  L   + ++ I 
Sbjct: 93  DVQIKSQRQLYVFGKSGGETTIYASNSAGDVIWAANVRVANNIDSLDQMLALAMPEAKIA 152

Query: 138 VE-MVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQV 196
              M ++TV+L G V   +D+  A  L   FL   G N         V++ L +A   QV
Sbjct: 153 TATMGTNTVLLTGTVAAPEDAAEAERLVTAFLGD-GAN---------VISRLKMATPLQV 202

Query: 197 TLKVTIAEVRRDILKQIGFQHSITGSSSG----------------------PSKSFAADF 234
            L+V IAEV R ++++IG   +   ++ G                      P    +A F
Sbjct: 203 NLQVRIAEVSRSLVREIGSNLTTRDTTDGFLFGVNRGRNFGSITDIDTSGFPQLDASAQF 262

Query: 235 G--------------GKFVSEGGDFSVK------------GVLDRFSFETVLHALERATA 268
           G              G+FV  G +F V             G L      +     ER   
Sbjct: 263 GLPPGSLSLPFNPATGQFVVGGANFPVASNNPGQTALNFAGRLFGLDIASAFDVGERLGL 322

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRI 328
           I TL+ P LTA+SG++A+F +GG+     +S   G TS+   ++GV L ++PTVL+ GRI
Sbjct: 323 ITTLSNPNLTALSGETATFLAGGEFPIP-ISQGLGTTSIEYRNFGVSLAYSPTVLANGRI 381

Query: 329 GLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
            +R++ EVSE      I +N   +P+   R+A+TTVEL SG + ++AGL+ +  Q   + 
Sbjct: 382 SIRVRPEVSELSSQGAITLNGFQIPALTTRRAETTVELGSGQSFMIAGLMSNSSQNTVDK 441

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDD 439
            P L  +PI+G LFR++ F + ETE+ I  TP+LVKPV   D+  P D Y   ++
Sbjct: 442 APGLGDVPIIGNLFRSTSFRKGETELVIVVTPYLVKPVDGTDIKLPTDGYQTPNE 496


>gi|50119734|ref|YP_048901.1| hypothetical protein ECA0789 [Pectobacterium atrosepticum SCRI1043]
 gi|49610260|emb|CAG73703.1| putative membrane protein [Pectobacterium atrosepticum SCRI1043]
          Length = 478

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 129/423 (30%), Positives = 222/423 (52%), Gaps = 29/423 (6%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+ +   + + +++  +LQ+      VLV+DP  A   + SP  ++++ K+VG   +  +
Sbjct: 49  EVAETNVVHLTVHQGRLLQLDALPDSVLVADPNIASFELPSPGNLFVYAKSVGTTTLYAM 108

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEM-VSDTVVLHGMVRTIQDSQRAV 161
             +G  +  + ++ E D+  L   ++R    ++I++E  +   V++ G V T QD++R +
Sbjct: 109 DENGNVINAIRLVSEHDLKALGERMKREFPGADIQLEASIPSGVIVRGSVDTPQDAKRVI 168

Query: 162 ELSETFLSQSGRNQY-----------ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDIL 210
           +  + ++S S   Q            ++ SS KV+N L I    Q+ ++V + EV R + 
Sbjct: 169 DSIQAYISASAGGQGGGGGGGEKLPGSSESSGKVINQLKIKTPSQINIQVRVVEVSRKLT 228

Query: 211 KQIGFQHSITGSSSGPSKSFAADFGGK---FVSEGGDFSV---KGVLD--RFSFETVLHA 262
            ++GF  + + S+   S + +A  G +   F +  G F+     G L+  R     +L A
Sbjct: 229 SELGFNWAASLSTG--SGNMSAGSGSRLNLFNATTGRFANPTDSGFLNFGRSRLSGLLTA 286

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTV 322
           + +      LAEP LTA+SG++A+F +GG+     V  +  + S+    YGV+L  TPT+
Sbjct: 287 MNQQGMATVLAEPNLTAMSGETAAFAAGGE--VPIVLITNNSVSIDYKSYGVILRMTPTL 344

Query: 323 LSPGRIGLRIQTEVSEPV----IGVNAGD-MPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           LS  RI L I  EVSE      + +  G  +P+  VR+ADTTVEL SG +  LAG+L+  
Sbjct: 345 LSANRISLHIAPEVSELTDVGSVQLEGGSRIPALTVRRADTTVELASGQSFALAGMLRSA 404

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
             Q   G+P LS +P+ G LF +   ++EETE+ I AT ++V+PV   DL  P     + 
Sbjct: 405 GSQTINGVPGLSSVPMFGRLFESESTSQEETELVIIATAYVVEPVNAGDLQTPGQGVKML 464

Query: 438 DDA 440
           D +
Sbjct: 465 DSS 467


>gi|87199534|ref|YP_496791.1| type II and III secretion system protein [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87135215|gb|ABD25957.1| type II and III secretion system protein [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 517

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 135/443 (30%), Positives = 209/443 (47%), Gaps = 72/443 (16%)

Query: 60  LQVPVDVQDVLVSDPTKA----------DVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           L+VPV+   V+ +D T A          DV+  + R++Y+ GK +G  ++ L    G+ +
Sbjct: 41  LEVPVNKSQVVSTDRTIAKALVGNDDIADVLPVTTRSIYVLGKKMGTTSLTLYDATGRVL 100

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
             +D+ +  D+  L   L+ F+ +  I   + +D +VL G+V       RAV+L+ T+  
Sbjct: 101 SIMDVAVGPDVEGLRSQLKTFVPNDKIDARLSNDAIVLSGLVNDPGAIDRAVQLARTY-- 158

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKS 229
                     +  KV+NL+++    QV L+V  AEV R      GF   ++G +S  +  
Sbjct: 159 ----------AGDKVVNLISLGSSQQVMLEVKFAEVNR----TAGFDVGVSGFASKGTFE 204

Query: 230 FAADFGGKFVSEGGDFSVKG---------------------------------VLDRFSF 256
            A   G + V  G D +V G                                  +D    
Sbjct: 205 SAIGKGAQLV-PGADVTVSGNSGGVSTSTTIPGASILKLSSITGSFGIFRKSFSIDGLGI 263

Query: 257 ETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTG--------ATSVT 308
           + VL+ALE     +TLA+PTL A+SG+ ASF +GG+     V S T         A +V 
Sbjct: 264 DAVLNALETKGMAKTLAQPTLLALSGERASFLAGGEFPVPVVQSGTTGTGNGNGGAITVE 323

Query: 309 THDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGVNAGDM--PSYRVRKADTTVELPS 364
              +GV L FTPTVL    I L ++ EVS  +P   +  G +  P  R R+A TT+EL  
Sbjct: 324 FKPFGVSLGFTPTVLGDKTINLLVEPEVSAIDPTASLTVGSITIPGLRTRRASTTLELRD 383

Query: 365 GGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAM 424
           G +  +AGLL+ D +   + +PLL  +PI+G+LFR+S F++ ETE+ I  TP LV P+  
Sbjct: 384 GESFAIAGLLQKDFKTSVQQLPLLGSLPIIGSLFRSSAFSKGETELLIVVTPRLVSPIKP 443

Query: 425 RDLSRPDDHYSVEDDAKAFFFNR 447
             +  P D  +    A   F   
Sbjct: 444 EQVRLPTDAVTDPSAASTIFLGE 466


>gi|110679396|ref|YP_682403.1| type II/III secretion system protein, putative [Roseobacter
           denitrificans OCh 114]
 gi|109455512|gb|ABG31717.1| type II/III secretion system protein, putative [Roseobacter
           denitrificans OCh 114]
          Length = 463

 Score =  180 bits (456), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 128/439 (29%), Positives = 219/439 (49%), Gaps = 34/439 (7%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           + +++  N+ ++++  +   ++ +++P  AD+   S R++Y+ GK  G   + L+   G+
Sbjct: 43  ETLNVSQNRAVVVESEIPFAELSIANPGIADISSLSDRSIYVLGKVPGITTLTLLDAAGQ 102

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
            + N+++ +  D+   +  LR+ +    I V   +D +VL G V + Q   +A+EL+   
Sbjct: 103 LITNVEVRVAPDLTEFKERLRQILPGEAIEVRTANDGIVLSGQVSSSQRLSKALELA--- 159

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
                    A  +  +V NL+ + G  QV LKV  AE+ R + KQ+     I GS +   
Sbjct: 160 ---------ARYAPDRVSNLMTVGGVQQVMLKVRFAEMSRGVSKQLQSSLRIGGSDAQAG 210

Query: 228 K--------SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
                    + AAD      ++G  F   G L     + +L ALE   A+RTLAEP L +
Sbjct: 211 IGRGIGGIPNLAAD-----SAQGAVFFDFG-LGSTQVQLLLEALETKGAVRTLAEPNLVS 264

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS-- 337
           +SGQ A+F +GG+  Y     S    SV    +G+ L+F P V+    I L++    S  
Sbjct: 265 LSGQEANFLAGGE--YPVPVQSEDGISVDFKPFGIELNFVPRVVDGDLINLQLSAATSSI 322

Query: 338 EPVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPIL 394
           +P  G++ GD   + ++  R+A TTVE+  G +  +AGLL+D+       +P +S +PIL
Sbjct: 323 DPSNGISVGDGFTVDAFIRREASTTVEMRDGESFAIAGLLEDNFNDNITQVPWISDVPIL 382

Query: 395 GALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR-VNKIYG 453
           GALFR++ + R +TE+ I  T  LV P     L+ P D      +   F   R +  +  
Sbjct: 383 GALFRSTDYMRNQTELVIIITAHLVTPTRGEALALPTDRIRPPSEKDLFLNGRTIETLNA 442

Query: 454 PKEASEVEGQNYKGAIGFI 472
              A EV  Q++ G+ G++
Sbjct: 443 RGSAGEVAKQDFSGSYGYV 461


>gi|319941902|ref|ZP_08016223.1| hypothetical protein HMPREF9464_01442 [Sutterella wadsworthensis
           3_1_45B]
 gi|319804555|gb|EFW01425.1| hypothetical protein HMPREF9464_01442 [Sutterella wadsworthensis
           3_1_45B]
          Length = 485

 Score =  180 bits (456), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 123/406 (30%), Positives = 206/406 (50%), Gaps = 35/406 (8%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +S+ L +   L     +  V V+ P+ A   V   R + +FG   G+ +++++G DG+ +
Sbjct: 1   MSVSLYQGKALSFNEQIGAVFVAQPSIASYQVVGNRKVVVFGSYPGKTSLMVLGTDGRTL 60

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL- 168
            N  + +  D++ +EM L+       +++  ++D V + G V T Q++   V   +  L 
Sbjct: 61  YNGLVEVAYDVSSMEMALKSSFPKLKLQLVALNDGVAVRGKVETAQEAANVVAFLDAMLQ 120

Query: 169 ----------------SQSGRNQYANSSSK---------KVMNLLNIAGEDQVTLKVTIA 203
                            Q G+ + + +++          K++N L +   +QVT++V  A
Sbjct: 121 VNPQQAQMAAADVSAAGQEGQQEKSGAATGTGTLGARIGKIINQLTVTTPNQVTVRVRFA 180

Query: 204 EVRRDILKQIGFQH--SITGSSSGPSKSFAAD--FGGKFVSEGGDFSVKGVLDRFSFETV 259
           EV R +  Q+GF+   S +GS  G +   A +        S G  F    +  RF+F ++
Sbjct: 181 EVNRKLSDQLGFKWKGSYSGSRGGITFGSADNPIISNPNNSLGHLFDPATMAARFTFGSL 240

Query: 260 LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFT 319
             A+     +  LAEP LT +SG++ASF +GGQ  +++ S   G   +   DYGV+L  T
Sbjct: 241 FDAMASEELVSILAEPNLTVVSGETASFLAGGQIPFQS-SDGDGGFDIEFKDYGVLLSIT 299

Query: 320 PTVLSPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLK 375
           PT+LS  RI LR++ EVSE      I       P + VR+A++T+EL SG +  +AGLLK
Sbjct: 300 PTILSGNRISLRLRPEVSERSDSNGIQFMGSTQPGFIVRRAESTIELASGQSFAIAGLLK 359

Query: 376 DDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
           +D       IP ++ +PI+GAL R+  F R ETE+ I AT ++  P
Sbjct: 360 NDFSNTVNKIPGIADLPIIGALARSKAFERGETELVIVATAYISTP 405


>gi|283852073|ref|ZP_06369347.1| type II and III secretion system protein [Desulfovibrio sp.
           FW1012B]
 gi|283572463|gb|EFC20449.1| type II and III secretion system protein [Desulfovibrio sp.
           FW1012B]
          Length = 527

 Score =  179 bits (455), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 133/460 (28%), Positives = 211/460 (45%), Gaps = 82/460 (17%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           K+S+ + K +ILQ   DV  V V+ P  AD V+ SPR +Y+ G+  G  N+ L     K 
Sbjct: 43  KLSLTIGKSVILQSDADVSRVSVAQPEIADFVLLSPRQVYVTGRAPGVTNLTLWDKGDKI 102

Query: 109 MLNLDILIERDIAHLEMTLRRFI-ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
               D+ +  DI  L+  L   +  +  I V    D + L G VR  ++ ++A+ L+E +
Sbjct: 103 RAVYDLDVAPDITRLKKMLHDVLPGEPGIEVRASQDAIALAGTVRDAENMKKALTLAEVY 162

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
                       + KKV+NL+ + G  QV L+V +AE+ + +L ++G   +  G  +   
Sbjct: 163 ------------APKKVVNLMAVGGVQQVMLEVRVAEMSKSVLNRMGINLNAIGDGN--- 207

Query: 228 KSFAADFGGKFVSEGGDF---------------SVKGVLDRFSFET-------------- 258
             FA    G   S  G                 + KG     SF++              
Sbjct: 208 --FAYTLIGGLTSVAGSMFNMDATQNVYQYITMTAKGADGNTSFDSSPIQLSYREFNQPS 265

Query: 259 ------------------------------VLHALERATAIRTLAEPTLTAISGQSASFT 288
                                         VL  L+    ++ LAEP L  ++GQ+A F 
Sbjct: 266 NRATATMNQGTAVARWNTNWGGAGNTAMTAVLDVLKENGLVKILAEPNLVCLNGQTADFL 325

Query: 289 SGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVN 344
           +GGQ +   V S  G TS+   D+GV L FTPT++   RI L++  EVS+      I + 
Sbjct: 326 AGGQ-IPVPVPSGLGTTSIEWKDFGVGLKFTPTIVGGDRINLQVHPEVSDLDYAHAIQLQ 384

Query: 345 AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFN 404
              +P+   R+  TTVEL +G T  +AG+LK++ +   +  P++  IPILG LF++S+F 
Sbjct: 385 GSTIPAINTRRTSTTVELKNGQTFAVAGMLKEEARSTFDKYPVVGDIPILGNLFKSSQFQ 444

Query: 405 REETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF 444
           +++TE+ I  T  L KP+  + +S P D     DD + F 
Sbjct: 445 KDQTELVILITAHLAKPLDKKAVSLPTDSAHEPDDLEFFL 484


>gi|73542329|ref|YP_296849.1| type II and III secretion system protein:transport-associated
           [Ralstonia eutropha JMP134]
 gi|72119742|gb|AAZ62005.1| type II and III secretion system protein:Transport-associated
           [Ralstonia eutropha JMP134]
          Length = 633

 Score =  179 bits (454), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 124/417 (29%), Positives = 218/417 (52%), Gaps = 34/417 (8%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + +G +++I LQ PV  ++  + +P      + S +T+Y+ G+ VG  N+I+ G  G   
Sbjct: 96  VPVGKSQLITLQEPV--KNRTLGNPNVVQATMVSAQTLYVLGRTVGTTNMIVQGRSGSCS 153

Query: 110 LNLDILIERDIAHLEMTLRRFI-ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +++++  D   L+ +L + +  +  IRV   +D +VL G V   Q + +A+++++ + 
Sbjct: 154 I-INVVVNADAGGLQTSLSQLLPGEPGIRVMTAADNLVLTGSVTNAQSALQAMDIAQAYA 212

Query: 169 SQSG-RNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
           + +             V+N+L++    QV L+V +AEV + +L Q+G   ++ G      
Sbjct: 213 NAAQVGAGGDAGKKGGVLNMLSVDTPQQVMLEVKVAEVSKTLLNQLGSSVNLQGG----- 267

Query: 228 KSFAADFGGKFVS-----EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISG 282
             F +  GG   S      G  F  K     F+F   + A +  + ++ LAEP L  ISG
Sbjct: 268 --FGSWTGGLVTSLLTGASGAIFGSKANNKPFNF--AIDAQKNDSLVKILAEPNLVTISG 323

Query: 283 QSASFTSGGQHLYKTVSSST---GATSVTTHD--YGVVLHFTPTVLSPGRIGLRIQTEVS 337
           Q ASF +GG+ +Y  V+ +    GA +VT  +  +GV L FTPTVL+ GRI L++  EVS
Sbjct: 324 QEASFLAGGK-IYIPVAQANVLNGAGTVTLQEEEFGVGLKFTPTVLANGRIHLKVAPEVS 382

Query: 338 E--PVIGVNAGD-------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
           E  P     +G        +P    R+A TTV++  G +  + GLL+D  +   + +P  
Sbjct: 383 ELSPTGATVSGGTLAGQSVLPLITTRRASTTVQMRDGESFAIGGLLQDSARGSLKALPGA 442

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
            ++P+LG LFR++++ ++ TE+    TP LVKP+A  +   P D ++  D    +F 
Sbjct: 443 GEVPVLGTLFRSTQYQQDLTELVFIITPRLVKPMATNNYPLPTDSFTTPDPFSLYFM 499


>gi|110632971|ref|YP_673179.1| type II and III secretion system protein [Mesorhizobium sp. BNC1]
 gi|110283955|gb|ABG62014.1| type II and III secretion system protein [Chelativorans sp. BNC1]
          Length = 464

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 122/410 (29%), Positives = 206/410 (50%), Gaps = 17/410 (4%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
           V + K   I +   K + +++     ++++ DP  A +   +  + Y+ G+ +G   + L
Sbjct: 43  VSVAKDSAIRVARGKPLTVEIAEAFDEIVIGDPEIATINPLTDHSFYVLGQGLGTTGIAL 102

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
                + +   D+ +  D   L  T+R+ +  SNI+V   +  +VL G       +++A 
Sbjct: 103 YDESKRLIGTFDVEVTLDTKMLAGTIRQSVPGSNIKVTSANGRIVLSGSAPDAVAAEKAS 162

Query: 162 ELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG 221
           +++  F           +  + V+N ++I    QV L V   E+ R + K++G + S   
Sbjct: 163 QIAARF-----------AGDEDVINTIDITSSQQVQLNVRFVEINRAVGKELGTKISAAY 211

Query: 222 SSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
            +SG   SF +D      +  GD     V D FS +  + ALE     R LAEP L A S
Sbjct: 212 VTSGGGISFNSDPRASSNTPAGDLIGGLVSDGFSIDVAIEALEDRGVARRLAEPNLIARS 271

Query: 282 GQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EP 339
           G++ASF +GG+     VS   GA +V+   +GV L+FTPTVLS G I L I+ EVS  + 
Sbjct: 272 GETASFLAGGEFPIP-VSEENGAVTVSYKKFGVGLNFTPTVLSDGLIALDIEPEVSSIDT 330

Query: 340 VIGVNAGD--MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGAL 397
                 G+  +P + VR+A T+++L SG + ++AGLL+   +   + +P L ++P+LGAL
Sbjct: 331 TSSYRVGNIAIPGFTVRRARTSIDLRSGQSFMMAGLLQSQNEINTQRVPGLGQLPVLGAL 390

Query: 398 FRNSRFNREETEIFIAATPFLVKPVAMRD-LSRPDDHYSVEDDAKAFFFN 446
           F +  + R ET++ I  TP LV P+   + ++ P D      D + F  N
Sbjct: 391 FSSKAYQRRETDLVIIVTPHLVSPIPPGNKVATPADRTKPARDGEVFLGN 440


>gi|237678812|emb|CAQ57539.1| RhcC2 protein [Bradyrhizobium elkanii]
          Length = 484

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 127/416 (30%), Positives = 201/416 (48%), Gaps = 27/416 (6%)

Query: 69  VLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLR 128
           + V+DPT AD    S  T+++FGK  G+ ++  +  +G+ +  L +++ + I  L  TLR
Sbjct: 86  IFVADPTIADYQAPSNTTIFVFGKKSGRTSLFALNENGEALAELRVVVTQPIEDLRATLR 145

Query: 129 RFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLL 188
             + D  I V       +L G     +  + A +++E FL           +   V+N +
Sbjct: 146 AEVGDYPIHVSYTPRGAILSGTAPNAEVVETAKKVTEQFLG----------AGSLVVNKI 195

Query: 189 NIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVK 248
            +AG  QV L V +AEV R  +K +    +    +S P+ +F     GK    G      
Sbjct: 196 QVAGSLQVNLSVRVAEVSRSAVKDLNIHFT----ASSPNGAFL--ISGKDGGSGAAGGGG 249

Query: 249 GVLDRFS-----FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTG 303
            +   FS        VL AL        LAEP LTA+SG+SASF +GG+     +  +  
Sbjct: 250 TIGIGFSAGNTNLSAVLDALASEHLASILAEPNLTAMSGESASFLAGGEFPIPVMQDNR- 308

Query: 304 ATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTT 359
             SV    +GV L F PTVL+  +I +R++ EVSE      + +N  ++P+   R+A T 
Sbjct: 309 QVSVQFRQFGVSLEFVPTVLNNNQINVRVKPEVSELSSEGQVKINGMEVPALSTRRASTV 368

Query: 360 VELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLV 419
           VEL SG +  + GL++ +        P L  +PILGALFR+S F + ETE+ I  TP++V
Sbjct: 369 VELASGQSFAIGGLIRRNFNNDIGEFPWLGDVPILGALFRSSSFQKRETELVIIVTPYIV 428

Query: 420 KPVAMRD-LSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           +P +    +S P D  +   DA     N + +    ++A         G+ GFI +
Sbjct: 429 RPGSNPSRMSAPSDRIAPPSDAGRILTNTLARPPKDRDAPRTSAPGLTGSAGFIIE 484


>gi|148557761|ref|YP_001265343.1| type II and III secretion system protein [Sphingomonas wittichii
           RW1]
 gi|148502951|gb|ABQ71205.1| type II and III secretion system protein [Sphingomonas wittichii
           RW1]
          Length = 526

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 138/447 (30%), Positives = 214/447 (47%), Gaps = 68/447 (15%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +SIG  ++I L  P+   D+ V+D   ADV V S   +YLFGK  G+  V      G  +
Sbjct: 51  LSIGSGQMIALSAPIS--DLFVADDKIADVQVRSTTQLYLFGKGAGETAVYATDKAGNVV 108

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            +  + +  +I  ++  L+  + ++ I    ++  V+L G V +  D + A +L E F+ 
Sbjct: 109 WSSIVRVGSNITSVDTMLKLAMPEAAITATTMNGIVLLTGTVASPSDVEEAQKLVEQFVG 168

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSG---- 225
           +            +V+N L  A   QV+L V IAEV R+  K IG       ++ G    
Sbjct: 169 KE----------TQVVNRLKSAVPLQVSLHVKIAEVSREFAKSIGINLLNRDTTGGFLFG 218

Query: 226 -----------------------------PSKSFAADFG---GKFVSEG----------- 242
                                        P+ S +  F    G+F++ G           
Sbjct: 219 VAQGRNFGSIGNLDTSAFPKLDASSLYGLPAGSLSLPFNPATGQFIAGGTAYTFDKLGKG 278

Query: 243 -GDFSVKGVLDRFSFETVLHALERATA---IRTLAEPTLTAISGQSASFTSGGQHLYKTV 298
            G  +  G+  +F    +  A++ A A   + TLA+P LTAISG++ASF +GG+ +   +
Sbjct: 279 AGSGTSFGLAGKFLGMDLAAAIDLAEADGLVTTLAQPNLTAISGETASFLAGGE-IPIPL 337

Query: 299 SSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVNAGDMPSYRVR 354
           +   GA SV    YGV L FTPTVL  GRI +R++ EVS+      + +N   +P    R
Sbjct: 338 AQGLGAVSVEFKQYGVSLSFTPTVLGDGRISIRVRPEVSQLTDAGSVRLNGFTIPGITTR 397

Query: 355 KADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAA 414
           +A+TTVEL SG   ++ GLL +      +  P L  +PILGALFR++ F R ETE+ I  
Sbjct: 398 RAETTVELGSGQAFMIGGLLSNAQNSNVDKAPFLGDLPILGALFRSNGFKRNETELMIVV 457

Query: 415 TPFLVKPVAMRDLSRPDDHYSVEDDAK 441
           TP+LVKPV+ + ++ P        D +
Sbjct: 458 TPYLVKPVSPQQIALPTAGLRAATDGE 484


>gi|227326302|ref|ZP_03830326.1| hypothetical protein PcarcW_02904 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 479

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 128/418 (30%), Positives = 218/418 (52%), Gaps = 30/418 (7%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           ++ + +N+  +L +      VLV+DP  A   + SP  ++++ K+VG   +  +  +G  
Sbjct: 55  EVRLTVNQGRLLHLNALPDSVLVADPNIASFELPSPGNLFVYAKSVGTTTLYAMDENGNV 114

Query: 109 MLNLDILIERDIAHLEMTLRRFIADSNIRVEM-VSDTVVLHGMVRTIQDSQRAVELSETF 167
           +  + ++ E D+  L   ++R    ++I++E  +   V++ G V T QD++R ++  + +
Sbjct: 115 INAIRLVSEHDLKALGERMKREFPGADIQLEASIPSGVIVRGSVDTPQDAKRVIDSIQAY 174

Query: 168 LSQSG------------RNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
           +S S             R   ++ SS KV+N L I    Q+ ++V + EV R +  ++GF
Sbjct: 175 ISASSGGGGQGGGGGGERLPGSSESSGKVINQLKIKTPSQINIQVRVVEVSRKLTSELGF 234

Query: 216 QHSITGSSSGPSKSFAADFGGK---FVSEGGDFSV---KGVLD--RFSFETVLHALERAT 267
             + + S+   S +  A  G +   F +  G F+     G L+  R     +L A+ +  
Sbjct: 235 NWAASLSTG--SGNMTAGSGSRLNLFNATTGRFANPTDAGFLNFGRSRLSGLLTAMNQQG 292

Query: 268 AIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGR 327
               LAEP LTA+SG++A+F +GG+     V  +  + S+    YGV+L  TPT+LS  R
Sbjct: 293 MATVLAEPNLTAMSGETAAFAAGGE--VPIVLITNNSVSIDYKSYGVILRMTPTLLSANR 350

Query: 328 IGLRIQTEVSEPV----IGVNAGD-MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLK 382
           I L I  EVSE      + +  G  +P+  VR+ADTTVEL SG +  LAG+L+    Q  
Sbjct: 351 ISLHIAPEVSELTDVGSVQLEGGSRIPALTVRRADTTVELASGQSFALAGMLRSAGSQTI 410

Query: 383 EGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDA 440
            G+P LS +P+ G LF +   ++EETE+ I AT ++V+PV   DL  P     + D +
Sbjct: 411 NGVPGLSSVPMFGRLFESESTSQEETELVIIATAYVVEPVNAGDLQTPGQGVKMLDSS 468


>gi|78357403|ref|YP_388852.1| type II/III secretion system protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78219808|gb|ABB39157.1| type II/III secretion system protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 482

 Score =  178 bits (452), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 128/424 (30%), Positives = 208/424 (49%), Gaps = 50/424 (11%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + +   K ++L+    V+ V V+ P  A V+V SP  +Y+ G   G   + L    G   
Sbjct: 39  VQLAAGKSVVLETASPVRRVSVAAPEVAQVLVLSPTQVYVTGVKPGGTTLTLWNAAGAVS 98

Query: 110 LNLDILIERDIAHLEMTLRRFI-ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
              DI +  DIA L+  L + + ++ +I V  V +++ L G V +      A++++  + 
Sbjct: 99  HVFDIQVSPDIARLKEMLHKLLPSEKDIMVMTVGESITLAGTVSSPAHIATAMDMARMY- 157

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS---- 224
                      +  KV NL+ + G  Q+ L+V +AE+RR +++++G   +    +S    
Sbjct: 158 -----------APDKVTNLMKVGGMHQIMLEVKVAEMRRSVMQRLGIDLAAAWGNSFAFT 206

Query: 225 ---------------GPSKSFAA---DFGGKFVSEGGDFSVKGVLDRFSFETVLHALERA 266
                          G  ++ A    +  G F +  G  ++ G LD          L+  
Sbjct: 207 MLNQLFTLDNQDGTIGVGRTAAVLSPNNTGVFQAPVGGMTLTGFLD---------VLKEN 257

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
             ++ LAEPTL   SG+ ASF +GG+ +   V    G  ++   +YGV L FTPTVLSP 
Sbjct: 258 GLVKVLAEPTLVCRSGEHASFLAGGE-IPIPVPQGLGTVAIEFKEYGVTLDFTPTVLSPR 316

Query: 327 RIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLK 382
           +I L+++ EVSE     VI +N   +P    R+A TTVEL  G +  +AGLL+D++++  
Sbjct: 317 QISLKVEPEVSELDYANVIQINGFSIPGISSRRASTTVELGDGQSFAIAGLLRDEVRETI 376

Query: 383 EGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
           +  P L  IP+LG LFR+S + + ETE+ I  TP L KP+ M   + P D +  E     
Sbjct: 377 KKYPGLGDIPVLGTLFRSSSWQKNETELVIIITPRLAKPLDMTAQTLPTDGFR-EPTEYE 435

Query: 443 FFFN 446
           FF  
Sbjct: 436 FFIQ 439


>gi|300692331|ref|YP_003753326.1| pilus assembly secretion protein [Ralstonia solanacearum PSI07]
 gi|299079391|emb|CBJ52062.1| pilus assembly secretion protein [Ralstonia solanacearum PSI07]
          Length = 644

 Score =  178 bits (452), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 123/421 (29%), Positives = 218/421 (51%), Gaps = 41/421 (9%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           ++++ + K  ++Q+P  V++  V +P     ++ SP+T+YL G+ VG  N+I+ G  G  
Sbjct: 126 EVTVPVGKSTMVQLPEPVRNRTVGNPNVVQAMLVSPQTLYLLGQEVGTTNMIVQGRSGSC 185

Query: 109 MLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
            + +D+ +  D   L  TL   + D+  +RV   +D++VL G V     +Q+ V+++  F
Sbjct: 186 SV-IDVAVGADPGGLLATLHELVPDAKGVRVSAAADSLVLSGSVSDSVQAQKVVDIANAF 244

Query: 168 LSQS---------GRNQYANSS-------------SKKVMNLLNIAGEDQVTLKVTIAEV 205
           +++          G  Q ANS+             S +++N++ +    QV L+V +AEV
Sbjct: 245 VTRQTRGPSQHDQGGGQGANSATQGAITAPGAQPRSPRIINMMAVEAPQQVMLEVKVAEV 304

Query: 206 RRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
            + ++ Q+G   ++  +S+  S SF A     F+S   D       +    +  L A   
Sbjct: 305 SKTLIDQMGAAFNL--NSAFGSWSFGAI--ANFLSSSQDLVSFSKANNLPLKFALDAQRG 360

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATS---VTTHDYGVVLHFTPTV 322
              ++ LAEP+L AISGQ ASF +GG+       S TG  +   +    +GV L FTPTV
Sbjct: 361 DGLVKVLAEPSLMAISGQEASFLAGGKVFIPVPQSFTGGVTTIVLQEETFGVGLRFTPTV 420

Query: 323 LSPGRIGLRIQTEVSE--PV-IGVNAGD------MPSYRVRKADTTVELPSGGTIVLAGL 373
           +  GRI L++  EVSE  P  + V A +      +P    R+A TT+++  G +  + GL
Sbjct: 421 MENGRINLKVAPEVSELSPTGVAVTAANTNGTTILPLITTRRASTTLQVRDGQSFAIGGL 480

Query: 374 LKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDH 433
           +K ++    + +P + ++P++G+L R++ F R++TE+    TP LVKP+  +    P D 
Sbjct: 481 IKSNVTGSLKALPGIGELPVIGSLARSTSFQRDQTELLFVVTPRLVKPLPAQ-YPMPTDS 539

Query: 434 Y 434
           +
Sbjct: 540 F 540


>gi|220918104|ref|YP_002493408.1| type II and III secretion system protein [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|219955958|gb|ACL66342.1| type II and III secretion system protein [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 477

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 135/464 (29%), Positives = 229/464 (49%), Gaps = 68/464 (14%)

Query: 10  TMMSIFLFSSNPSVAKLPPIKEANAAVINIS-DVEIGKGKKISI--GLNKVIILQVPVDV 66
           T++++ LF++      LPP++ A  A+  +  D  +G G ++++  G N+++I+    ++
Sbjct: 5   TLLALALFAT-----PLPPVELAAGALPPLRIDRSVGAGSELALEAGQNRLLIISE--EI 57

Query: 67  QDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMT 126
             V V+DP+ AD+ V +   + L  K+ G  ++ L     + ++ + +++ R++  L   
Sbjct: 58  GRVAVADPSVADLKVVTTNQLLLTAKSSGTTDLTLWNRSNEPLV-IALVVTRNLEPLRKQ 116

Query: 127 LRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMN 186
           ++       + +    + V+L G V  ++  +R VE+             A   +K+V N
Sbjct: 117 VKDLFPGEKVTITGAGELVILSGEVSDVRIPERLVEV-------------AKLHAKQVAN 163

Query: 187 LLNIAGEDQVTLKVTIAEVRRDILKQIG---FQHSI----------------------TG 221
           L+ ++G  QV L+V  AEV R  L+QIG   F  S                       TG
Sbjct: 164 LVKVSGNQQVQLEVRFAEVSRSGLRQIGVNLFHQSSNGEVVTGMTGRGIIPTDLGVPGTG 223

Query: 222 SSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
           ++  P   F   F   F        V  +   F F  +L  LE+    +TLAEPTL  +S
Sbjct: 224 TAGAPPPIFRPQFNNGF-----SMFVSSLSGDFPFSAMLSLLEQNGLSKTLAEPTLVTLS 278

Query: 282 GQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--- 338
           GQ A F +GG+ L   +  S G T V    +G++L FTPTV++   I L ++ EVS+   
Sbjct: 279 GQQARFVAGGE-LPIPLGGSFGQTQVEWKKFGILLDFTPTVIAGDTIHLDLKAEVSDIDQ 337

Query: 339 -PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGAL 397
              I +    +P    R+++TT+ L  G +  +AGLL D ++   E +PLL  IPILGAL
Sbjct: 338 SLAITIGGTTIPGLTSRQSETTIRLGDGQSFAIAGLLSDRVRSQIERVPLLGSIPILGAL 397

Query: 398 FRNSRFNREETEIFIAATPFLVKPVA---------MRDLSRPDD 432
           FR++++ REE+E+ +  T  L +PVA          R+L+ P D
Sbjct: 398 FRSTQYKREESELLVVVTARLARPVAPHQLPPLPTERELNHPGD 441


>gi|328953626|ref|YP_004370960.1| type II and III secretion system protein [Desulfobacca acetoxidans
           DSM 11109]
 gi|328453950|gb|AEB09779.1| type II and III secretion system protein [Desulfobacca acetoxidans
           DSM 11109]
          Length = 503

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 142/472 (30%), Positives = 216/472 (45%), Gaps = 48/472 (10%)

Query: 8   FFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQ 67
           F   M + L S+  +V   P +  A A +  + D ++ +  ++ +G +KV  L+    + 
Sbjct: 20  FLAAMVLILGSA--AVYSPPSVLAAQALLERVKDEDLEQVIRLRVGRSKV--LRTSFTIS 75

Query: 68  DVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTL 127
            + V+DP  AD+++ S R +Y+ G   G  N+ L G   +   +  + +E D++ L+  L
Sbjct: 76  RISVADPEVADIIMISEREVYINGNAPGVTNISLWGK--RSFSSAKVTVEADVSLLKEKL 133

Query: 128 RRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNL 187
            + +    I VE   DTVVL G V      + A+ L+  F         +     KV+NL
Sbjct: 134 FKVLPKEKIAVEAAEDTVVLSGEVSGPVAQETAISLATAF---------SGGKKDKVVNL 184

Query: 188 LNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG------------ 235
           L+I G  QV + V +AE+ R + K++G   + +  +     +                  
Sbjct: 185 LHIGGVQQVMVAVRVAEINRSVGKEMGINFAYSNKAGNFGATLLNSLSILKNIDRNLDSV 244

Query: 236 ---GKFVSEGGDFSVK-----------GVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
              G  V+ G   S +           G+   F +      L++    R LAEP L   S
Sbjct: 245 TAPGVLVNPGVTTSSQQFSSSVNAVFGGLYGSFFWTAFFDVLKKNGLGRILAEPNLVTTS 304

Query: 282 GQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--- 338
           GQ ASF +GG+     V S  G TS+    +GV L FTPTVL   +I LRI  EVSE   
Sbjct: 305 GQEASFLAGGEFPIP-VPSGLGTTSIDYKKFGVGLVFTPTVLDNDKIALRINPEVSELDF 363

Query: 339 ---PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILG 395
                + VN   +P  +VR+  T VE+  G T+ +AGLL D  + +    PLL  +PILG
Sbjct: 364 SSQTTVVVNNFIVPGLKVRRTTTQVEMKDGQTLAIAGLLSDQHRNVVNKYPLLGDLPILG 423

Query: 396 ALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR 447
            LFR+S F + ETE+ I  TP LVK         P D Y    D + +   R
Sbjct: 424 VLFRSSSFQKSETELVILVTPHLVKSQPPGPHRLPTDKYIEPTDLEFYLLGR 475


>gi|153006805|ref|YP_001381130.1| type II and III secretion system protein [Anaeromyxobacter sp.
           Fw109-5]
 gi|152030378|gb|ABS28146.1| type II and III secretion system protein [Anaeromyxobacter sp.
           Fw109-5]
          Length = 490

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 141/473 (29%), Positives = 234/473 (49%), Gaps = 61/473 (12%)

Query: 11  MMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISI--GLNKVIILQVPVDVQD 68
           ++   L ++ P+VA+    ++A A      D E+G  +++S+  G N+++I+     +  
Sbjct: 9   LLVTLLVAAGPAVAQ----EQAQATPALRIDREMGAAREMSLEAGQNRLLIISE--QIAR 62

Query: 69  VLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLR 128
           + V++P  AD+ V +P  + L  K VG  ++ L   D  Q L + + + R++  L   ++
Sbjct: 63  IAVANPDVADLKVVTPTQVLLTAKGVGTTDLTLWNRD-NQPLVIALQVGRNLEALRTQVK 121

Query: 129 RFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLL 188
           +     N+++    D VVL G V  ++  +R  E+             A   ++KV NL+
Sbjct: 122 QLFPGENVKITASGDLVVLSGEVTDVRLPERVAEV-------------ARLHAEKVANLI 168

Query: 189 NIAGEDQVTLKVTIAEVRRDILKQIG---FQHSITGSSSGPSKSFAADFGGKFVSEGGDF 245
            ++G  QV L+V  AEV R  L+++G   F  S    + G   S      G+F++   + 
Sbjct: 169 QVSGVQQVQLQVRFAEVARGGLRELGVNLFHKSDDFRTVGGLFS-NRTLPGEFLNTNQNP 227

Query: 246 SVKGV-----------------------------LDRFSFETVLHALERATAIRTLAEPT 276
           S+ G                              +D F F  +L  LE+    ++LAEPT
Sbjct: 228 SIPGTGPRGLAGNGFPPDVPAPAFQNAFSVFLSRMDDFPFSVMLSLLEQNNLAKSLAEPT 287

Query: 277 LTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           L A+SGQ A F +GG+ L   ++SS G TSV    +G+ L FTPTV+    I L ++TEV
Sbjct: 288 LVALSGQGARFLAGGE-LPIPLASSFGQTSVEWKRFGIQLEFTPTVIGDA-IHLTMKTEV 345

Query: 337 SE--PVIGVN-AG-DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           S+  P + V  AG  +P    R+++T++ L  G +  +AGL+ D I+     +P +  IP
Sbjct: 346 SDIDPSLAVTIAGTSVPGLTSRQSETSIRLADGQSFAIAGLVSDRIRSQVAKVPFIGSIP 405

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           ILGALFR+  F R+E+E+ +  T  LVKPVA  +L      Y + D     F+
Sbjct: 406 ILGALFRSQAFQRDESELIVVVTAHLVKPVAPHELPPLPTEYEMNDPGDLPFY 458


>gi|218887827|ref|YP_002437148.1| type II and III secretion system protein [Desulfovibrio vulgaris
           str. 'Miyazaki F']
 gi|218758781|gb|ACL09680.1| type II and III secretion system protein [Desulfovibrio vulgaris
           str. 'Miyazaki F']
          Length = 493

 Score =  177 bits (448), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 126/414 (30%), Positives = 206/414 (49%), Gaps = 53/414 (12%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + + + K ++++       V +SD   A VVV SP+ +Y+ GK  G A + L    G   
Sbjct: 47  VPLAVGKSMVVRTAQPAARVSMSDEAIAGVVVLSPQQVYVTGKKAGGATLTLWNGAGAIT 106

Query: 110 LNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
              DI +  D+A L+  L R + D  +I V  V +++ L G VR+      A+++++ + 
Sbjct: 107 QVYDIQVTPDLAQLKEMLHRVLPDEKDIMVMAVGESITLAGTVRSAAGMTTALDVAKMY- 165

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF------------- 215
                      +  KV NL+ + G  QV L+V +AE+R+ +L+++G              
Sbjct: 166 -----------APDKVTNLMQVGGVHQVLLEVKVAEMRKSVLERLGIDLTYAWNNDFAFG 214

Query: 216 ----------QHSITGSSSGPSKSFAA-DFGGKFVSEGGDFSVKGVLDRFSFETVLHALE 264
                     Q  + G   GP+ +  + +  G F +  G  S+ G LD          L+
Sbjct: 215 MLNQLFTLDSQKGVVGV--GPTGAVVSPNVTGMFRATSGRASLMGFLD---------VLK 263

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLS 324
           +   ++ LAEPTL   SG++A F +GG+ +   V    G  ++    YGV L FTPTV+S
Sbjct: 264 QNGLVKVLAEPTLICRSGENADFLAGGE-IPIPVPQGLGTVAIEFKKYGVTLGFTPTVVS 322

Query: 325 PGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQ 380
              I +R+  EVSE     VI +N   +P+   R+A TTVEL  G +  +AGLL+D++++
Sbjct: 323 DKLISMRVSPEVSELDYSNVIEINGFTIPAISTRRAATTVELADGQSFAVAGLLRDEVRE 382

Query: 381 LKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHY 434
             +  P+L  +P+LG LFR+S + + ETE+ I  TP L KP+       P D +
Sbjct: 383 NIKKYPVLGDVPLLGTLFRSSNWQKNETELVIIVTPRLAKPLDGATAKLPTDGF 436


>gi|296156489|ref|ZP_06839327.1| type II and III secretion system protein [Burkholderia sp. Ch1-1]
 gi|295893088|gb|EFG72868.1| type II and III secretion system protein [Burkholderia sp. Ch1-1]
          Length = 599

 Score =  177 bits (448), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 126/435 (28%), Positives = 219/435 (50%), Gaps = 47/435 (10%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           ++I + K  ++ V   V+   V +P+    ++ SP+T+YL G +VG  N+I+ G  G   
Sbjct: 119 VTIPVGKSAMVDVREPVKSRTVGNPSIVQAMLVSPQTLYLLGSDVGTTNMIVQGRSGSCT 178

Query: 110 LNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +D+ +  D   L+ TL   +  ++ I+V+  +DT+VL G V     + R +EL+  F+
Sbjct: 179 I-IDVSVGADPGGLQQTLAALMPEETGIQVKAAADTLVLTGTVSDAVKADRVLELARAFV 237

Query: 169 S------QSG--------------------RNQYANSSSKKVMNLLNIAGEDQVTLKVTI 202
           +      Q G                          +  ++++N++++A   QV L+V +
Sbjct: 238 ARPTTALQGGAPMGSGPLPVGAAPRAMGMPAPSLGGAGGERIINMMHVAAPQQVMLEVKV 297

Query: 203 AEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHA 262
           AEV + ++ Q+G   +I G     S    AD    ++S G         +    +  + A
Sbjct: 298 AEVSKTLIDQLGVAANINGGIGSWSFGLLAD----YLSGGLSALTASKANNSPLKAAIDA 353

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVT----THDYGVVLHF 318
            +    ++ LAEP L AISGQ ASF +GG+ +Y  V  S G+   T       YGV L F
Sbjct: 354 QKTDQLVKILAEPNLMAISGQEASFLAGGK-VYIPVPQSNGSGGTTIVLQEEQYGVGLTF 412

Query: 319 TPTVLSPGRIGLRIQTEVSE---PVIGVNAGD------MPSYRVRKADTTVELPSGGTIV 369
           TPTVL  GRI L++  EVSE     + V+AG+      +P    R+A TT+++  G +  
Sbjct: 413 TPTVLEGGRINLKVSPEVSELSSTGVVVSAGNSNTTSILPLITTRRASTTLQVFDGQSFA 472

Query: 370 LAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSR 429
           + GLLK ++    +G+P  +++P+LGALFR++ + +++TE+    TP L KP+  +    
Sbjct: 473 IGGLLKSNVTGSIKGLPGAAELPVLGALFRSTSYEQDKTELVFVVTPRLAKPLP-QHYPL 531

Query: 430 PDDHYSVEDDAKAFF 444
           P D++    +A  + 
Sbjct: 532 PTDNFGDASEANVYL 546


>gi|149912019|ref|ZP_01900613.1| putative membrane protein [Moritella sp. PE36]
 gi|149804918|gb|EDM64952.1| putative membrane protein [Moritella sp. PE36]
          Length = 473

 Score =  176 bits (447), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 127/420 (30%), Positives = 209/420 (49%), Gaps = 48/420 (11%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
           + + + + LNK  ++++P   + + ++  + AD    +   + +FGK  G  ++ ++   
Sbjct: 24  QAQTLDVVLNKARLIELPKTAKSIFIASSSIADYQTLTNTKIMVFGKKTGSTSLYVLDAK 83

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
              + +  + +  ++  L   + +   D+    E  +  + L G V T   +++ V LSE
Sbjct: 84  ENVIYSATVKVSHNVTELNELIHKEFPDAIFNAESTAGKLFLKGQVPTPSMAEKIVRLSE 143

Query: 166 TFLS-----------QSGRNQ---------YANSSSKKVMNLLNIAGEDQVTLKVTIAEV 205
            ++S           QSG  Q          +N  + +++N L +   +QV L++ IAEV
Sbjct: 144 GYVSTLASTESSDSQQSGNAQSSTQPTQPAASNVDNDELINQLQVTMPNQVNLRIRIAEV 203

Query: 206 RRDILKQIGFQHSITGSSSGPSKSFAADFGGKF----VSEGGDFSVKGVLDRFSFETVLH 261
            R +  ++G +    G  +G + +F  ++GGK      +   D SV           ++ 
Sbjct: 204 SRKVSNKLGIKWGSQGFGTG-TFAFLDNYGGKLGGVNPASWADLSV-----------IVD 251

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPT 321
           AL     +  LAEP LTA+SG+ ASF  GG+     V S T   +V    +GV L F PT
Sbjct: 252 ALATNGMMSVLAEPNLTAMSGEEASFLVGGEIPIPLVYSDTA--TVEYKTFGVRLDFKPT 309

Query: 322 VLSPGRIGLRIQTEVSEPVIGVN--------AGDMPSYRVRKADTTVELPSGGTIVLAGL 373
           VLS  RI L++ TEVS      N        +   P++  R+A TT+EL SG +  L GL
Sbjct: 310 VLSANRISLKVATEVSTVSSETNVQIGGTQGSSSFPTFVTRRASTTIELASGQSFALGGL 369

Query: 374 LKD-DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDD 432
           L+  DI+QL++ +PLL  IP+LGALFR++ F REETE+ I AT +LV+P     L  P D
Sbjct: 370 LQSKDIEQLQK-MPLLGDIPVLGALFRSNEFQREETELIIIATAYLVQPTRADILPLPTD 428


>gi|292491519|ref|YP_003526958.1| type II and III secretion system protein [Nitrosococcus halophilus
           Nc4]
 gi|291580114|gb|ADE14571.1| type II and III secretion system protein [Nitrosococcus halophilus
           Nc4]
          Length = 565

 Score =  176 bits (446), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 141/519 (27%), Positives = 237/519 (45%), Gaps = 91/519 (17%)

Query: 8   FFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQ 67
           FF++ S+ L  ++P    L P +  N  +I  SD+E        + L K  ++++    +
Sbjct: 31  FFSLTSLALAQTSP----LTPRQSEN--LIIQSDIE----GDFQVPLYKSGVIELEERAK 80

Query: 68  DVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTL 127
            + V +P  AD+++   R +Y+ GK +G  NV++   + +   + +I +  D+  L+  L
Sbjct: 81  RISVGNPGIADILMLHSRQLYVVGKALGTTNVVVWDKNERVFASFNIEVVHDLDTLKRKL 140

Query: 128 RRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQ----------------- 170
            R +    I V    + ++L G V ++   + A +L++ FL +                 
Sbjct: 141 HRLLPGEVIEVHSAQERIILSGQVSSVVKMKAAEDLAQGFLPECISAESNVLVRDTTQGT 200

Query: 171 -------------SGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH 217
                        SG NQ        V+NL+ + G  QV L++ +AE+ R +LK+     
Sbjct: 201 PIIIQQGDGGRGASGANQEG-CKKGSVVNLMQVGGAHQVMLEIKVAEIARTVLKRFDSNF 259

Query: 218 SITGSSSGPSKSFAADFGG-----KFVSEGGDFSVKGVLD-------------------- 252
           ++  S   P K F A+ GG          G +  + G L+                    
Sbjct: 260 NVF-SFDSPWK-FGANSGGASFPNALTPSGNEVPILGSLNGEDSPIGPVVDLFQPNTPGI 317

Query: 253 ------------RFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
                       +F  E VL A  +    + LAEPTLT ++GQ A F SGG+       S
Sbjct: 318 QDKGVFLSYLSSKFFLEAVLEASRQKGLAKVLAEPTLTTLTGQEAQFVSGGEFPIPVPQS 377

Query: 301 S-TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE-----PV-IGVNAGD----MP 349
             TG  ++   ++GV+++F P VL  GRI L++   VSE     PV +GV   +    +P
Sbjct: 378 GITGNVTIEFKEFGVIVNFLPLVLDSGRINLKLNVAVSELSQDVPVTLGVQGTENTFVIP 437

Query: 350 SYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETE 409
           S   R A  TVEL  G TI +AGL+ D++++L   +P L  +PILGALFR+  F   +TE
Sbjct: 438 SLTKRSAKATVELADGQTIGIAGLINDNLRELVTKLPGLGDVPILGALFRSQEFMSGQTE 497

Query: 410 IFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV 448
           + +  TP L +P++ + +  P D +    D + +   R+
Sbjct: 498 LVMFVTPHLARPISPQQVKLPTDSFVPPTDLEFYLMGRM 536


>gi|254510970|ref|ZP_05123037.1| bacterial type II/III secretion system protein [Rhodobacteraceae
           bacterium KLH11]
 gi|221534681|gb|EEE37669.1| bacterial type II/III secretion system protein [Rhodobacteraceae
           bacterium KLH11]
          Length = 476

 Score =  176 bits (446), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 128/463 (27%), Positives = 218/463 (47%), Gaps = 34/463 (7%)

Query: 28  PIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTM 87
           PI +A A   N+  V+ G  + + + +N+ I+++      D+ +++   AD+   S RT+
Sbjct: 28  PIGDA-AWAQNLRVVKKGTAESLDVPVNRAIVVESEQPFADISIANAGIADISTLSDRTI 86

Query: 88  YLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVL 147
           Y+ G+  G   + +    G  + N+ + +  D+   +  LR+ + +  I V   +D +VL
Sbjct: 87  YVLGRAPGITTLTMFDGAGNLITNVRVRVSPDVTEFKERLRQILPNEQIEVRTANDGIVL 146

Query: 148 HGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRR 207
            G V +     RA+EL+E +            + ++V NLLN+ G  QV LKV  AE+ R
Sbjct: 147 SGTVSSSARLARALELAERY------------APERVSNLLNVGGVQQVMLKVRFAEMNR 194

Query: 208 DILKQIG-----------FQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGV-LDRFS 255
            + K +               +   +    + + A +    FV       + G       
Sbjct: 195 SVAKNLSASLGFGGGDATGGFNSLNNQGALNNALANNI--PFVQTNSGAVLFGFGAGSTQ 252

Query: 256 FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVV 315
              +L ALE    +R+LAEP L+A+SGQ A F +GG+ +   V    G  ++    +GV 
Sbjct: 253 VRLLLEALETKGLVRSLAEPNLSALSGQEAEFLAGGE-VPIPVPQGDGVVAIEYRQFGVQ 311

Query: 316 LHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLA 371
           L F P V+    I L +   VS         +N   +PS+  R+  TT+EL  G +  +A
Sbjct: 312 LLFVPRVVDGNLINLELGASVSSIDQSSDFTINGDSVPSFITRQTRTTIELRDGESFAIA 371

Query: 372 GLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           GL++DD   L   +P L  +P+LGALFR++++ RE++E+ I  T  LV P     L+ P 
Sbjct: 372 GLIQDDFTDLNTQVPWLGDVPVLGALFRSAQYQREQSELIIIITAHLVSPTRGEALALPT 431

Query: 432 DHYSVEDDAKAFFFNRVNKI--YGPKEASEVEGQNYKGAIGFI 472
           D      +   F   +V +    G   ASEV  Q++  + G++
Sbjct: 432 DRVKPPSEFDLFVNGKVARTERAGNGAASEVAKQDFGTSYGYV 474


>gi|254229332|ref|ZP_04922749.1| putative phospholipid-binding domain family [Vibrio sp. Ex25]
 gi|262393417|ref|YP_003285271.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio sp. Ex25]
 gi|151938140|gb|EDN56981.1| putative phospholipid-binding domain family [Vibrio sp. Ex25]
 gi|262337011|gb|ACY50806.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio sp. Ex25]
          Length = 487

 Score =  176 bits (446), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 128/452 (28%), Positives = 216/452 (47%), Gaps = 62/452 (13%)

Query: 37  INISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQ 96
           ++++   +  GK +++  ++   L +    + V + DP   D++V     ++L GK +G 
Sbjct: 16  LSVNAATVQSGKVVTVAHHQSTQLMISGQAKKVTLGDPEVLDILVLRSNELFLIGKKLGT 75

Query: 97  ANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQD 156
            NV +    G+ +   ++ +  D+  L+  L +F+ D NI V    + VVL G+V + Q+
Sbjct: 76  TNVSVWDRRGRLIEQFNVEVTHDLNTLKSKLYQFLPDENIEVHSAQEKVVLRGLVSSQQN 135

Query: 157 SQRAVELSETF-LSQSGRNQYANSSSKKVM--NLLNIAGEDQVTLKVTIAEVRRDILKQI 213
              AV+++ETF L ++   +  +S     M  NLL+I G  QVTL+VT+AEV+R ++++ 
Sbjct: 136 MDTAVKIAETFALGEAADEEDDSSKDDDSMVINLLSIGGAQQVTLEVTVAEVQRTLVRR- 194

Query: 214 GFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVK-----------------------GV 250
                           F ++F   F    GDF+                         G 
Sbjct: 195 ----------------FDSNF--HFFQRSGDFTWGGTTAGGGIDGIGPILNVPTVEDFGF 236

Query: 251 LDRF-----SFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGAT 305
           L  F      F   L   ++    + LAEP+LTA+SG  A F +GG+  +     +    
Sbjct: 237 LGSFIDSNTLFTFALDVAKQNGVAKVLAEPSLTALSGTQAEFVAGGE--FPIPVPNEDGI 294

Query: 306 SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGD------MPSYRVRK 355
           ++   +YGV L F P +LS  RI L++   VSE     V+  N  +      +P    R 
Sbjct: 295 TIDYKEYGVQLDFVPFILSDKRINLKLNVNVSEISNSGVLTFNPNEVNATFFIPPITKRS 354

Query: 356 ADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAAT 415
           A TT+EL  G TI +AGLL ++ + + +GIP  S +P+LG LF++  F   ETE+ I  T
Sbjct: 355 AGTTIELADGQTIGIAGLLSENARNVADGIPGASDLPVLGRLFKSEEFTSGETELVILVT 414

Query: 416 PFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR 447
           P L  P+  R ++ P D +   +D + +   +
Sbjct: 415 PRLATPIDRRRITLPTDGFVAPNDVEFYLLGK 446


>gi|332162954|ref|YP_004299531.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|325667184|gb|ADZ43828.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
          Length = 410

 Score =  176 bits (445), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 117/389 (30%), Positives = 199/389 (51%), Gaps = 31/389 (7%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           +++   ++  V VS    AD  +    ++ ++ K  G A  IL   +   +    IL++ 
Sbjct: 1   MIKTQEEIDTVFVSAAAIADYELVGKNSIIVYAKQEGTAEFILFNQNHHPIKKSAILVDN 60

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQ-------RAVELSETFLSQS 171
            I      +R    +S+I +  + D+ +L G V T +  +        A+   +T  S S
Sbjct: 61  TITAAHKRIRLEYPESDIEINKIGDSYILTGTVETEEAKETIASIIGEAIGSEKTIASNS 120

Query: 172 -----GRNQYANSSS-KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSG 225
                G NQY NS    +V+N + + G +QV +K+TIAEV +D  + IG   S  G+ SG
Sbjct: 121 KKDSDGNNQYFNSPEYSRVVNKIKLPGSNQVNVKLTIAEVSKDFSENIGMDWSTIGNFSG 180

Query: 226 PSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSA 285
             + F  +   KF ++G                ++HA+   +  R LAEP L+ +SG+SA
Sbjct: 181 SFQFFKLNGSNKFNAKG-------------ISALVHAINDDSIARVLAEPNLSVLSGESA 227

Query: 286 SFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGV 343
           SF  GG+     V+++  +T +T   +G+ L+    V +  RI +++  EVS  + V  +
Sbjct: 228 SFLVGGE--LPLVNTTANSTVITYKQFGIKLNIGAKVNAKKRIRIKLDEEVSSVDKVFNI 285

Query: 344 NAGD-MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
           + GD  PS+R RKA TT+EL  G + +L GL+    ++  + IP +  IPILGA FRN+ 
Sbjct: 286 DGGDAYPSFRTRKAATTLELGDGESFILGGLISSSEREALKKIPFIGDIPILGAFFRNAE 345

Query: 403 FNREETEIFIAATPFLVKPVAMRDLSRPD 431
             + +TE+ + AT  LV+PV+ +++  P+
Sbjct: 346 TRKNQTELVVVATVNLVRPVSEKEVELPN 374


>gi|269966892|ref|ZP_06180965.1| Flp pilus assembly protein [Vibrio alginolyticus 40B]
 gi|269828559|gb|EEZ82820.1| Flp pilus assembly protein [Vibrio alginolyticus 40B]
          Length = 487

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 128/442 (28%), Positives = 212/442 (47%), Gaps = 62/442 (14%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
           GK +++  ++   L +    + V + DP   D++V     ++L GK +G  NV +    G
Sbjct: 26  GKVVTVAHHQSTQLMISGQAKKVTLGDPEVLDILVLRSNELFLIGKKLGTTNVSVWDRRG 85

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           + +   ++ +  D+  L+  L +F+ D NI V    + VVL G+V + Q+   AV+++ET
Sbjct: 86  RLIEQFNVEVTHDLNTLKSKLYQFLPDENIEVHSAQEKVVLRGLVSSQQNMDTAVKIAET 145

Query: 167 F-LSQSGRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS 223
           F L ++   +  +S   +  V+NLL+I G  QVTL+VT+AEV+R ++++           
Sbjct: 146 FALGEAADEEDDSSKDDESMVINLLSIGGAQQVTLEVTVAEVQRTLVRR----------- 194

Query: 224 SGPSKSFAADFGGKFVSEGGDFSVK-----------------------GVLDRF-----S 255
                 F ++F   F    GDF+                         G L  F      
Sbjct: 195 ------FDSNF--HFFQRSGDFTWGGTTAGGGIDGIGPILNVPTVEDFGFLGSFIDSNTL 246

Query: 256 FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVV 315
           F   L   ++    + LAEP+LTA+SG  A F +GG+  +     +    ++   +YGV 
Sbjct: 247 FTFALDVAKQNGVAKVLAEPSLTALSGTQAEFVAGGE--FPIPVPNEDGITIDYKEYGVQ 304

Query: 316 LHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGD------MPSYRVRKADTTVELPSG 365
           L F P +LS  RI L++   VSE     V+  N  +      +P    R A TT+EL  G
Sbjct: 305 LDFVPFILSDKRINLKLNVNVSEISNSGVLTFNPNEVNATFFIPPITKRSAGTTIELADG 364

Query: 366 GTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMR 425
            TI +AGLL ++ + +  GIP  S +P+LG LF++  F   ETE+ I  TP L  P+  R
Sbjct: 365 QTIGIAGLLSENARNVANGIPGASDLPVLGRLFKSEEFTSGETELVILVTPRLATPIDRR 424

Query: 426 DLSRPDDHYSVEDDAKAFFFNR 447
            ++ P D +   +D + +   +
Sbjct: 425 RITLPTDGFVAPNDVEFYLLGK 446


>gi|167584957|ref|ZP_02377345.1| type II and III secretion system protein [Burkholderia ubonensis
           Bu]
          Length = 536

 Score =  175 bits (443), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 123/408 (30%), Positives = 213/408 (52%), Gaps = 19/408 (4%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +S+ L K +++ +P  V++  + +P  A   + SP+T+Y+ G +VG  N+I+ G  G   
Sbjct: 89  VSVPLGKSMLVPMPEPVRNRTIGNPAVAQATMVSPQTLYILGLSVGTTNMIVQGKSGACR 148

Query: 110 LNLDILIERDIAHLEMTLRRFI-ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +D+ +  D   L+ +L + +  + +I V   +DT+VL G V + Q +Q+A  +++ + 
Sbjct: 149 I-IDVAVGADAGGLQASLGQLMPGERDIHVSTAADTIVLAGNVSSAQAAQQAAAIAKAYA 207

Query: 169 SQSGRNQYANSSSK-KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
           +  G     ++     V+N+L +    QV L+V +AEV + ++ Q+G   +I G     S
Sbjct: 208 NAGGGGANGDNKGGGTVLNMLTVTAPQQVMLEVKVAEVSKTLINQLGSAFNIQGGFGSWS 267

Query: 228 KSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASF 287
            +  ++      S  G  + K   +   F   + A      ++ LAEP L  ISGQ A+F
Sbjct: 268 GALVSNLLAGVAS--GIVANKA--NNRPFSVAVDAQNTDNLVKILAEPNLVTISGQEATF 323

Query: 288 TSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEVSE-PVIGV 343
            +GG+       S+TG  +  T    ++GV L F PTVLS GRI L++  EVSE    GV
Sbjct: 324 LAGGKIFIPVPQSNTGGGTTITLQEEEFGVALRFLPTVLSNGRISLKVAPEVSELSQTGV 383

Query: 344 --------NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILG 395
                    A  +P    R+A TTV++  G +  + GL+KD+     + +P + +IP+LG
Sbjct: 384 TLTATNVAGASILPLITTRRASTTVQMADGESFAIGGLIKDNATGSLKAVPGIGEIPVLG 443

Query: 396 ALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
           AL R++ F ++ TE+    TP LVKP+   D+  P D ++  ++   F
Sbjct: 444 ALARSTSFQQDRTELIFIITPHLVKPLQTADVPLPTDSFTRTNEVDVF 491


>gi|294140774|ref|YP_003556752.1| Flp pilus assembly protein CpaC [Shewanella violacea DSS12]
 gi|293327243|dbj|BAJ01974.1| Flp pilus assembly protein CpaC [Shewanella violacea DSS12]
          Length = 484

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 124/416 (29%), Positives = 210/416 (50%), Gaps = 20/416 (4%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           IL +   V  V V +P   D+ +     +Y+ GK +G  N+++   + + +  +DI I  
Sbjct: 49  ILNLKQTVHRVSVGNPNIGDIKLLPNNELYVLGKKLGSTNIMIWDENERLVDVIDIEITH 108

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           D+  L++ L  F+    + V+     +++ G    +Q    AVEL++ +   +  ++  N
Sbjct: 109 DLNGLKLRLHEFLPGEKLGVQTSQGHLLISGQASNLQKMNTAVELAKAYADAASVSK-VN 167

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKF 238
           S+   V+N++ + G+ QV L+V IAEV+R++ +Q   +  I G  S  S   A       
Sbjct: 168 ST---VLNMMTVGGDHQVMLEVVIAEVQREVARQFDSKFFIFGQGSKLSGGTAGGGATFD 224

Query: 239 VSEGGDFSVKGVLDRFSFETVL--HALERATA---IRTLAEPTLTAISGQSASFTSGGQH 293
           +      S +G   R+  + +L   AL+ A      + LAEP +TA+SGQSA F SGG+ 
Sbjct: 225 LDPAAAISNRGFFARYINDNLLMNFALDVAKQNGLAKVLAEPNVTALSGQSAEFLSGGEF 284

Query: 294 LYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGD-- 347
               V  + G+T++   D+GV + F PTVL  G+I L +   VSE      + ++ G   
Sbjct: 285 PIP-VPGTNGSTTIQYRDFGVGVRFVPTVLDSGQINLNLNVIVSEVSNANSVSLSGGGSN 343

Query: 348 ----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRF 403
               +PS   R   TTVEL  G TI ++GL+ D +++  + +P L  IPILG LF +  F
Sbjct: 344 ATLIVPSIVKRTTSTTVELADGQTIAISGLINDTLRENIDKLPGLGDIPILGQLFTSKSF 403

Query: 404 NREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASE 459
              ++E+ I  TP LV+P   + +S P D + +  D + +   +++      E SE
Sbjct: 404 KSGQSELIILVTPRLVRPFNRKHISLPTDDFVLPSDMEFYLLGKMSHKKQDSERSE 459


>gi|227114876|ref|ZP_03828532.1| hypothetical protein PcarbP_18025 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 479

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 126/408 (30%), Positives = 212/408 (51%), Gaps = 30/408 (7%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           +LQ+      VLV+DP  A   + SP  ++++ K+VG   +  +  +G  +  + ++ E 
Sbjct: 65  LLQLNELPDSVLVADPNIASFELPSPGNLFVYAKSVGTTTLYAMDENGNVINAIRLVSEH 124

Query: 119 DIAHLEMTLRRFIADSNIRVE-MVSDTVVLHGMVRTIQDSQRAVELSETFLSQS------ 171
           D+  L   ++R    ++I++E  +   V++ G V T QD++R ++  +T++  S      
Sbjct: 125 DLKALGERMKREFPGADIQLEPSIPSGVIVRGSVDTPQDAKRVIDSIQTYIKSSVGGGQG 184

Query: 172 ------GRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSG 225
                  R   ++ +S  V+N L I    Q+ ++V + EV R +  ++GF  + + S+  
Sbjct: 185 GGGGGGERLPGSSETSGNVVNQLKIKTPSQINIQVRVVEVSRKLTSELGFNWAASLSTG- 243

Query: 226 PSKSFAADFGGK---FVSEGGDFSV---KGVLD--RFSFETVLHALERATAIRTLAEPTL 277
            S +  A  G +   F +  G F+     G L+  R     +L A+ +      LAEP L
Sbjct: 244 -SGNMTAGSGSRLNLFNATTGRFANPTDAGFLNFGRSRLSGLLTAMNQQGMATVLAEPNL 302

Query: 278 TAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS 337
           TA+SG++A+F +GG+     V  +  + S+    YGV+L  TPT+LS  RI L I  EVS
Sbjct: 303 TAMSGETAAFAAGGE--VPIVLITNNSVSIDYKSYGVILRMTPTLLSANRISLHIAPEVS 360

Query: 338 EPV----IGVNAGD-MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIP 392
           E      + +  G  +P+  VR+ADTTVEL SG +  LAG+L+    Q   G+P LS +P
Sbjct: 361 ELTDVGSVQLEGGSRIPALTVRRADTTVELASGQSFALAGMLRSAGSQTINGVPGLSSVP 420

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDA 440
           + G LF +   ++EETE+ I AT ++V+PV   DL  P     + D +
Sbjct: 421 MFGRLFESEATSQEETELVIIATAYVVEPVNAGDLQTPGQGVKMLDSS 468


>gi|85707702|ref|ZP_01038768.1| type II secretion system protein [Erythrobacter sp. NAP1]
 gi|85689236|gb|EAQ29239.1| type II secretion system protein [Erythrobacter sp. NAP1]
          Length = 576

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 137/456 (30%), Positives = 218/456 (47%), Gaps = 69/456 (15%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           ISIG  +++  QVP  + DV V++   ADV + S R +Y+FG++ G+  +      G+ +
Sbjct: 70  ISIGRGELV--QVPGTMTDVFVANENVADVQIKSQRQLYVFGRSGGETTIYASDARGEVI 127

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVE-MVSDTVVLHGMVRTIQDSQRAVELSETFL 168
            + ++ +  +I  ++  L   + ++ + V  M ++TV+L G V   +D+  A  L   FL
Sbjct: 128 FSANVRVGSNIGSIDQMLALAMPEAQVNVATMGTNTVLLTGTVAAPEDAAEAERLVTAFL 187

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI--------------- 213
            +             V+  L  A   QV L+V  AEV R +++ +               
Sbjct: 188 GEQ----------ANVITRLKTATPLQVNLQVKFAEVSRSLVRAVSGNLTTFDASTGGFR 237

Query: 214 -------------------------GFQHSITGSSSGPSKSFA-ADFGGK---FVSEGGD 244
                                    G Q+ + G    P+      D  G    F   G D
Sbjct: 238 GAVGTGRTLGAGEFDFRNGPLGVGSGVQNPVVGPFIDPTTGLPILDANGNPLTFTGPGID 297

Query: 245 FSVKGV----LDRFSFETVLHAL---ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKT 297
               G     L R      L AL   ER   I T+++P LTA+SG++A+F +GG+     
Sbjct: 298 SGTAGTTIAGLGRLFGLDALGALDLSERLGLITTISQPNLTALSGETATFLAGGEFPIP- 356

Query: 298 VSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRV 353
           +S   G  ++   ++GV L +TPTVLS GRI +R++ EVSE      + +N   +P+  +
Sbjct: 357 ISQGLGNVAIEYRNFGVSLAYTPTVLSNGRISIRVRPEVSELSSQGAVTLNGFQVPALTI 416

Query: 354 RKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIA 413
           R+ +TTVEL SG + ++AGLL ++ Q   +  P L  +PILG LFR+  F R ETE+ I 
Sbjct: 417 RRTETTVELGSGQSFMIAGLLSNNAQNALDKAPGLGDVPILGNLFRSRDFRRGETELVIV 476

Query: 414 ATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVN 449
            TP+LVKPV   D++ P D Y   ++ + F   R N
Sbjct: 477 VTPYLVKPVNASDIALPTDGYHSANELEQFIGFRDN 512


>gi|207728106|ref|YP_002256500.1| pilus assembly protein, secretin cpac [Ralstonia solanacearum
           MolK2]
 gi|206591351|emb|CAQ56963.1| pilus assembly protein, secretin cpac [Ralstonia solanacearum
           MolK2]
          Length = 626

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 121/433 (27%), Positives = 220/433 (50%), Gaps = 44/433 (10%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           ++++ + K  ++Q+P  V++  V +P     ++ SP+T+YL G+ VG  N+I+ G  G  
Sbjct: 99  EVTVPVGKSTMVQLPEPVRNRTVGNPHIVQAMLVSPQTLYLLGQEVGTTNMIVQGRSGSC 158

Query: 109 MLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
            + +D+ +  D   L+ TLR  +  + N++V   +D++VL G V     +Q+ ++++  F
Sbjct: 159 SV-IDVSVGADPGGLQSTLRTLMPGAKNVQVSAAADSLVLGGSVSDSVQAQKVLDIANAF 217

Query: 168 LSQSGRNQY----------------------ANSSSKKVMNLLNIAGEDQVTLKVTIAEV 205
           + +  R                         A   S +++N++ +    QV L+V +AEV
Sbjct: 218 VMRQTRGPAQGDQGGAAQGGGAMQGLGATPGAPPRSPRIINMMAVEAPQQVMLEVKVAEV 277

Query: 206 RRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
            + ++ Q+G   ++ G+    S +F A     F+S   D       +    +  L A + 
Sbjct: 278 SKTLIDQMGSALNVNGAFG--SWTFGAL--ANFLSGSNDIVNFSKNNHLPLKFALDAQKG 333

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT-----HDYGVVLHFTP 320
              ++ LAEP+L AISGQ ASF +GG+ ++  VS       V T       +GV L FTP
Sbjct: 334 DGLVKVLAEPSLMAISGQEASFLAGGK-VFIPVSQGAATNGVATIILQEETFGVGLRFTP 392

Query: 321 TVLSPGRIGLRIQTEVSE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLA 371
           TV+  GRI L++  EVSE       V   N+ +   +P    R+A TT+++  G +  + 
Sbjct: 393 TVMENGRINLKVSPEVSELSPTGVAVTAPNSNNTSILPLITTRRASTTLQVHDGQSFAIG 452

Query: 372 GLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           GL+K+++    + IP + ++P++GAL R++ F +++TE+    TP LVKP+  +    P 
Sbjct: 453 GLIKNNVTGSLKAIPGIGELPVIGALARSTSFQQDQTELVFVVTPHLVKPLPAQ-YPLPT 511

Query: 432 DHYSVEDDAKAFF 444
           D +   + A+ F 
Sbjct: 512 DSFGRANPAEIFL 524


>gi|318604223|emb|CBY25721.1| type II/IV secretion system secretin RcpA/CpaC,associated with Flp
           pilus assembly [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 410

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 116/389 (29%), Positives = 198/389 (50%), Gaps = 31/389 (7%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           +++   ++  V VS    AD  +    ++ ++ K  G A  IL   +   +    IL++ 
Sbjct: 1   MIKTQEEIDTVFVSAAAIADYELVGKNSIIVYAKQEGTAEFILFNQNHHPIKKSAILVDN 60

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQ-------RAVELSETFLSQS 171
            I      +R    +S+I +  + D+ +L G V T +  +        A+   +T  S S
Sbjct: 61  TITAAHKRIRLEYPESDIEINKIGDSYILTGTVETEEAKETIASIIGEAIGSEKTIASNS 120

Query: 172 -----GRNQYANSSS-KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSG 225
                G NQY NS    +V+N + + G +QV +K+TIAEV +D  + IG   S  G+ SG
Sbjct: 121 KKDSDGNNQYFNSPEYSRVVNKIKLPGSNQVNVKLTIAEVSKDFSENIGMDWSTIGNFSG 180

Query: 226 PSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSA 285
             + F  +   KF ++G                ++HA+   +  R LAEP L+ +SG+SA
Sbjct: 181 SFQFFKLNGSNKFNAKG-------------ISALVHAINDGSIARVLAEPNLSVLSGESA 227

Query: 286 SFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGV 343
           SF  GG+     V+++  +T +T   +G+ L+    V +  RI +++  EVS  + V  +
Sbjct: 228 SFLVGGE--LPLVNTTANSTVITYKQFGIKLNIGAKVNAKKRIRIKLDEEVSSVDKVFNI 285

Query: 344 NAGD-MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
           + GD  PS+R RKA TT+EL  G + +L GL+    ++  + IP +  IPILGA F N+ 
Sbjct: 286 DGGDAYPSFRTRKAATTLELGDGESFILGGLISSSEREALKKIPFIGDIPILGAFFSNAE 345

Query: 403 FNREETEIFIAATPFLVKPVAMRDLSRPD 431
             + +TE+ + AT  LV+PV+ +++  P+
Sbjct: 346 TRKNQTELVVVATVNLVRPVSEKEVELPN 374


>gi|260463894|ref|ZP_05812090.1| type II and III secretion system protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259030269|gb|EEW31549.1| type II and III secretion system protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 481

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 134/420 (31%), Positives = 211/420 (50%), Gaps = 40/420 (9%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           K++ G  K II         +++ DP  A+V   + ++ Y+ G N+G   + L   D KQ
Sbjct: 55  KVAKGKPKTIITSAAF--YQIVIGDPEIANVNPLTDKSFYVLGNNLGTTGIALF-DDKKQ 111

Query: 109 ML-NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
           ++  +DI +  D   L  T+R  + D+ I+V   +  VVL G       +++A +++  F
Sbjct: 112 LVGTVDIEVTLDTDELANTIRASVPDAKIKVGSANGRVVLSGEADDAVAAEKANKIATRF 171

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
                      S +++V+N +NI+   QV L V   E+ R   + +G ++         S
Sbjct: 172 -----------SGNEEVINSVNISSSQQVQLNVRFVEINRQAGQDLGAKY---------S 211

Query: 228 KSFAADFGGKFVS-EGGDFSVKG---VLDRF-----SFETVLHALERATAIRTLAEPTLT 278
            +FA  FGG+ VS E G     G   ++ R      S +  + ALE     R LAEP L 
Sbjct: 212 ANFAYGFGGRDVSLEPGTVPAAGTGEIIGRLLSNGVSIDIAIKALEERGLARRLAEPNLI 271

Query: 279 AISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS- 337
           A SG++ASF +GG+     VS   G  SV+   YGV L F PTVL  G + L I  EVS 
Sbjct: 272 ARSGETASFLAGGEFPIP-VSEENGKISVSYKKYGVSLDFKPTVLKDGLVSLDIAPEVSS 330

Query: 338 -EPVIGVNAGDM--PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPIL 394
            +     N G++  P + VR+A T+V+L +G + ++AGLL+         IP L K+P+L
Sbjct: 331 IDASASYNIGNISVPGFIVRRARTSVDLKNGQSFMIAGLLQSQNDITTSRIPGLGKMPVL 390

Query: 395 GALFRNSRFNREETEIFIAATPFLVKPV-AMRDLSRPDDHYSVEDDAKAFFFNRVNKIYG 453
           GALF +  + R ET++ I  TP+LVKPV   + ++ P +      +A  +F N   ++ G
Sbjct: 391 GALFSSKSYQRRETDLVIIVTPYLVKPVDPSKKMAEPTNGTQPASNAD-YFLNNTEEVKG 449


>gi|207744158|ref|YP_002260550.1| pilus assembly protein, secretin cpac [Ralstonia solanacearum
           IPO1609]
 gi|206595562|emb|CAQ62489.1| pilus assembly protein, secretin cpac [Ralstonia solanacearum
           IPO1609]
          Length = 626

 Score =  174 bits (440), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 121/433 (27%), Positives = 219/433 (50%), Gaps = 44/433 (10%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           ++++ + K  ++Q+P  V++  V +P     ++ SP+T+YL G+ VG  N+I+ G  G  
Sbjct: 99  EVTVPVGKSTMVQLPEPVRNRTVGNPHIVQAMLVSPQTLYLLGQEVGTTNMIVQGRSGSC 158

Query: 109 MLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
            + +D+ +  D   L+ TLR  +  + N++V   +D++VL G V     +Q+ ++++  F
Sbjct: 159 SV-IDVSVGADPGGLQSTLRTLMPGAKNVQVSAAADSLVLGGSVSDSVQAQKVLDIANAF 217

Query: 168 LSQSGRNQY----------------------ANSSSKKVMNLLNIAGEDQVTLKVTIAEV 205
           +    R                         A   S +++N++ +    QV L+V +AEV
Sbjct: 218 VMHQTRGPAQGDQGGAAQGGGAMQGLGATPGAPPRSPRIINMMAVEAPQQVMLEVKVAEV 277

Query: 206 RRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
            + ++ Q+G   ++ G+    S +F A     F+S   D       +    +  L A + 
Sbjct: 278 SKTLIDQMGSALNVNGAFG--SWTFGAL--ANFLSGSNDIVNFSKNNHLPLKFALDAQKG 333

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT-----HDYGVVLHFTP 320
              ++ LAEP+L AISGQ ASF +GG+ ++  VS       V T       +GV L FTP
Sbjct: 334 DGLVKVLAEPSLMAISGQEASFLAGGK-VFIPVSQGAATNGVATIILQEETFGVGLRFTP 392

Query: 321 TVLSPGRIGLRIQTEVSE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLA 371
           TV+  GRI L++  EVSE       V   N+ +   +P    R+A TT+++  G +  + 
Sbjct: 393 TVMENGRINLKVSPEVSELSPTGVAVTAPNSNNTSILPLITTRRASTTLQVHDGQSFAIG 452

Query: 372 GLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           GL+K+++    + IP + ++P++GAL R++ F +++TE+    TP LVKP+  +    P 
Sbjct: 453 GLIKNNVTGSLKAIPGIGELPVIGALARSTSFQQDQTELVFVVTPHLVKPLPAQ-YPLPT 511

Query: 432 DHYSVEDDAKAFF 444
           D +   + A+ F 
Sbjct: 512 DSFGRANPAEIFL 524


>gi|299067807|emb|CBJ39018.1| pilus assembly secretion protein [Ralstonia solanacearum CMR15]
          Length = 635

 Score =  174 bits (440), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 131/442 (29%), Positives = 231/442 (52%), Gaps = 54/442 (12%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           ++++ + K  ++Q+   V+   V +P     ++ SP+T+YL G++VG  N+I+ G  G  
Sbjct: 97  EVTVPVGKSTMVQLSEPVRSRTVGNPNIVQAMLVSPQTLYLLGQDVGTTNMIVQGRSGSC 156

Query: 109 MLNLDILIERDIAHLEMTLRRFIAD-SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
            + +D+ +  D   L+ TL   + + S +RV   +D++VL G V     +Q+ ++++  F
Sbjct: 157 SV-IDVSVGADPGGLQATLHALMPEASRVRVSAAADSLVLGGTVSDSVQAQKIMDIANAF 215

Query: 168 L-------SQSGR--------------NQYANSSS----------KKVMNLLNIAGEDQV 196
           +       +QSG+                 A +SS           +++N++++    QV
Sbjct: 216 VMRETRGPAQSGQAGTMGMQGMTAMSTGNAATASSGSGSGEAVRNPRIINMMSVEAPQQV 275

Query: 197 TLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGD-FSVKGVLDRFS 255
            L+V +AEV + ++ Q+G   ++ GS    S +F A     F+S   D FSV    ++  
Sbjct: 276 MLEVKVAEVSKTLINQMGAALNLNGSFG--SWTFGAL--ANFLSGAPDIFSVDKA-NKLP 330

Query: 256 FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS--TGATSVTTHD-- 311
           F+  L A +    ++ LAEP L AISGQ ASF +GG+ +Y  V  S  +G TS+   +  
Sbjct: 331 FQLKLDAQKGDGLVKVLAEPNLMAISGQEASFLAGGK-VYIPVPQSFGSGTTSILLQEET 389

Query: 312 YGVVLHFTPTVLSPGRIGLRIQTEVSE--PV-IGVNAGD------MPSYRVRKADTTVEL 362
           +GV L FTPTVL  GRI L++  EVSE  P  + V A +      +P    R+A TT+++
Sbjct: 390 FGVGLRFTPTVLENGRINLKVAPEVSELSPTGVAVTAPNVSGTSILPLITTRRASTTLQV 449

Query: 363 PSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV 422
             G +  + GL+K +I    + IP + ++P++GAL R++ F +++TE+    TP LVKP+
Sbjct: 450 HDGQSFAIGGLIKSNITGSLKAIPGVGELPVIGALARSTSFQQDQTELLFVVTPHLVKPL 509

Query: 423 AMRDLSRPDDHYSVEDDAKAFF 444
              +   P D +   +  + + 
Sbjct: 510 PA-NYPMPTDSFGPVNQGEVYL 530


>gi|309780760|ref|ZP_07675501.1| type II and III secretion system protein:Transport-associated
           [Ralstonia sp. 5_7_47FAA]
 gi|308920442|gb|EFP66098.1| type II and III secretion system protein:Transport-associated
           [Ralstonia sp. 5_7_47FAA]
          Length = 603

 Score =  174 bits (440), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 119/409 (29%), Positives = 214/409 (52%), Gaps = 41/409 (10%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           ++++ + K  ++Q+P  V+   V +P     ++ SP+T+Y+ G  VG  N+I+ G  G  
Sbjct: 97  EVTVPVGKSTMVQLPEPVRSRTVGNPNVVQAMLVSPQTLYVLGLEVGSTNMIVQGRSGSC 156

Query: 109 MLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
            + +D+ +  D   L+ TLR+ + ++ N++V   +D++VL G V     +Q+ V+++  F
Sbjct: 157 SV-VDVAVGADPGGLQSTLRKLMPEARNVQVSAAADSLVLGGSVSDSVQAQKVVDIANAF 215

Query: 168 L---------------SQSGRNQY-----ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRR 207
           +                Q G+  +     A   S +++N++ +    QV L+V +AEV +
Sbjct: 216 VMRRTRGPNEGDQNATGQGGQQLHTAGPGAPLRSPRIINMMTVEAPQQVMLEVKVAEVSK 275

Query: 208 DILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERAT 267
            ++ Q+G   +  G+    S SF A     F+S   D       +    +  L A +   
Sbjct: 276 TLIDQMGAAFNANGAFG--SWSFGAI--ANFLSGSSDIVNFSKANHLPLKFALDAQKGDG 331

Query: 268 AIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT-----HDYGVVLHFTPTV 322
            ++ LAEP+L AISGQ ASF +GG+ ++  V+    A  V T       +GV L FTPTV
Sbjct: 332 LVKVLAEPSLMAISGQEASFLAGGK-VFIPVAQGAAANGVATIVLQEETFGVGLRFTPTV 390

Query: 323 LSPGRIGLRIQTEVSE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGL 373
           +  GRI L++  EVSE       V   N+ +   +P    R+A TT+++  G +  + GL
Sbjct: 391 MENGRINLKVSPEVSELSPTGVAVTAPNSNNTSILPLITTRRASTTLQVHDGQSFAIGGL 450

Query: 374 LKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV 422
           +K++I    + +P + ++PI+G+L R++ F +++TE+    TP LVKP+
Sbjct: 451 IKNNITGSLKALPGIGELPIIGSLARSTSFQQDQTELLFVVTPRLVKPL 499


>gi|87199101|ref|YP_496358.1| type II and III secretion system protein [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87134782|gb|ABD25524.1| type II and III secretion system protein [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 539

 Score =  174 bits (440), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 134/459 (29%), Positives = 223/459 (48%), Gaps = 63/459 (13%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           + ++I + +  ++ VP  + DV V+D   ADV V S   +Y+FGK  G+  +      G 
Sbjct: 52  RTVTISIGRGELVTVPGRMADVFVADERVADVQVKSTNQLYVFGKAGGETTIYASNAKGD 111

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
            + + ++ +  ++  ++  L   + ++ I V  +++TV+L G V   +D+  A  L + F
Sbjct: 112 VVWSANVRVGNNLDSIDQMLHLAMPEARINVATMNNTVLLTGTVAAPEDAAEAERLVKAF 171

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF------------ 215
           + +             V++ L +A   QV+L V  AEV R +++ +G             
Sbjct: 172 VGEK----------TNVISRLKMATPLQVSLHVKFAEVSRSLVRTLGVNLTTIDGTGGIK 221

Query: 216 ----QHSITGS----------------------SSGPSKSFAADFGGKFV--SEGGDFSV 247
               Q S TGS                       +G + ++ +  G      S G   + 
Sbjct: 222 FGIGQGSTTGSVATNRNLPFGVGTSSTSGYILDPTGATSNYVSATGTSVAASSSGTTIAG 281

Query: 248 KGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSV 307
            G L        L A E    + TL+EP LTAISG++A F +GG++    VS   G TS+
Sbjct: 282 MGKLLGLDLLAALDAGETIGLVTTLSEPNLTAISGETAEFLAGGEYPIP-VSQGLGTTSI 340

Query: 308 TTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELP 363
               YGV L +TPTVL+ GRI +R++ E SE      + +++ ++P+  VR+A+TTVEL 
Sbjct: 341 EYKKYGVSLAYTPTVLANGRISIRVRPEASELSSTGALKLDSVEIPALTVRRAETTVELG 400

Query: 364 SGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA 423
           SG + ++AGLL++  Q     +P    IPILG+LFR++ + + ETE+ I  TP+LV PV 
Sbjct: 401 SGQSFMIAGLLQNGAQNALTKMPGAGDIPILGSLFRSTSYKKGETELVIVVTPYLVNPVN 460

Query: 424 MRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEG 462
             D+  P D +           N + ++ G  E+  V G
Sbjct: 461 ANDIKLPTDGFQSP--------NEIQRLLGHMESDGVTG 491


>gi|193782542|ref|NP_435332.2| PilQ2 pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|307319126|ref|ZP_07598556.1| type II and III secretion system protein [Sinorhizobium meliloti
           AK83]
 gi|193072997|gb|AAK64744.2| PilQ2 pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|306895233|gb|EFN25989.1| type II and III secretion system protein [Sinorhizobium meliloti
           AK83]
          Length = 466

 Score =  173 bits (439), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 128/455 (28%), Positives = 225/455 (49%), Gaps = 24/455 (5%)

Query: 4   LQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKG--KKISIGLNKVIILQ 61
           + R+  ++ + F F     VA    I  +  A  N   VEI     + I +   K + ++
Sbjct: 1   MTRSRGSLFAFFCFV----VALCTGIGVSPPASANGDSVEISSNFSRSIKVAKGKTVTIR 56

Query: 62  VPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIA 121
                 ++++ DP  A V   + R+ Y+ G  +G  +V +   +   +  +DI +  D  
Sbjct: 57  AVQRFDEIVIGDPEIATVTPLTDRSFYILGNELGSTSVTIFDAEKNPVGIIDIEVTLDTK 116

Query: 122 HLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSS 181
            L  T+R+ +  S+++V   +  +VL G       + +A +++  F           +  
Sbjct: 117 LLSSTIRQSVPGSSVKVTSANGRIVLSGSATDAVAATQAEQIASRF-----------AGD 165

Query: 182 KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSE 241
           ++V+N + I    QV L V   E+ RD+ K++G Q S   + S  S  F +       + 
Sbjct: 166 EEVINSIKITSSQQVQLNVRFVEINRDVGKELGTQISAAYAWSNGSVEFNSSPRATSNTP 225

Query: 242 GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS 301
            G      + + +S +  + ALE     R LAEP L A SG+++SF +GG+     +S  
Sbjct: 226 AGSLIGSLIGEGYSVDVAIDALEDRGMARRLAEPNLIARSGETSSFLAGGEFPIP-ISEQ 284

Query: 302 TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGVNAGDM--PSYRVRKAD 357
            G  +V+   +GV L FTPTVLS G I L I+ EVS  +       G++  P + VR+A 
Sbjct: 285 DGTITVSYKKFGVGLDFTPTVLSDGLIALDIEPEVSAIDNTASYRVGNIAIPGFSVRRAR 344

Query: 358 TTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPF 417
           T+V+L SG + ++AGLL+ +   + + +P L ++PILGALF +  + R ET++ I  TP 
Sbjct: 345 TSVDLKSGQSFMIAGLLQSENNLITQRVPGLGQLPILGALFSSKAYQRRETDLVIIVTPH 404

Query: 418 LVKPV-AMRDLSRPDDHYSVEDDAKAFFFNRVNKI 451
           LVKP+  ++ ++ P D      +A+ FF   ++++
Sbjct: 405 LVKPIDPLKKVASPSDRTKRPTEAE-FFLGNIDEV 438


>gi|241662165|ref|YP_002980525.1| type II and III secretion system protein [Ralstonia pickettii 12D]
 gi|240864192|gb|ACS61853.1| type II and III secretion system protein [Ralstonia pickettii 12D]
          Length = 603

 Score =  173 bits (439), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 119/409 (29%), Positives = 214/409 (52%), Gaps = 41/409 (10%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           ++++ + K  ++Q+P  V+   V +P     ++ SP+T+Y+ G  VG  N+I+ G  G  
Sbjct: 97  EVTVPVGKSTMVQLPEPVRSRTVGNPNVVQAMLVSPQTLYVLGLEVGSTNMIVQGRSGSC 156

Query: 109 MLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
            + +D+ +  D   L+ TLR+ + ++ N++V   +D++VL G V     +Q+ V+++  F
Sbjct: 157 SV-VDVAVGADPGGLQSTLRKLMPEARNVQVSAAADSLVLGGSVSDSVQAQKVVDIANAF 215

Query: 168 L---------------SQSGRNQY-----ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRR 207
           +                Q G+  +     A   S +++N++ +    QV L+V +AEV +
Sbjct: 216 VMRRTRGPNEGEQNATGQGGQQLHTAGPGAPLRSPRIINMMTVEAPQQVMLEVKVAEVSK 275

Query: 208 DILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERAT 267
            ++ Q+G   +  G+    S SF A     F+S   D       +    +  L A +   
Sbjct: 276 TLIDQMGAAFNANGAFG--SWSFGAI--ANFLSGSSDIVNFSKANHLPLKFALDAQKGDG 331

Query: 268 AIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT-----HDYGVVLHFTPTV 322
            ++ LAEP+L AISGQ ASF +GG+ ++  V+    A  V T       +GV L FTPTV
Sbjct: 332 LVKVLAEPSLMAISGQEASFLAGGK-VFIPVAQGAAANGVATIVLQEETFGVGLRFTPTV 390

Query: 323 LSPGRIGLRIQTEVSE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGL 373
           +  GRI L++  EVSE       V   N+ +   +P    R+A TT+++  G +  + GL
Sbjct: 391 MENGRINLKVSPEVSELSPTGVAVTAPNSNNTSILPLITTRRASTTLQVHDGQSFAIGGL 450

Query: 374 LKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV 422
           +K++I    + +P + ++PI+G+L R++ F +++TE+    TP LVKP+
Sbjct: 451 IKNNITGSLKALPGIGELPIIGSLARSTSFQQDQTELLFVVTPRLVKPL 499


>gi|89899603|ref|YP_522074.1| type II and III secretion system protein [Rhodoferax ferrireducens
           T118]
 gi|89344340|gb|ABD68543.1| type II and III secretion system protein [Rhodoferax ferrireducens
           T118]
          Length = 571

 Score =  173 bits (439), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 128/418 (30%), Positives = 207/418 (49%), Gaps = 69/418 (16%)

Query: 78  DVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNI 136
           DV++ +P  +YL GK +G  NV+++  DG      D+++  D   L+  + + +  +  I
Sbjct: 124 DVLLLAPTEVYLLGKTIGTTNVVMLDRDGT-CTAFDVVVAMDTMALQAVIGQLLPIEKEI 182

Query: 137 RVEMVSDTVVLHGMVRTIQDSQRAVELSETFL-SQSGRNQYANSSSKKVMNLLNIAGEDQ 195
           +V    D++VL GMV   +   R  +L+  ++  Q G  Q    S+++V+N+L +    Q
Sbjct: 183 KVTSAFDSIVLSGMVSDTEALTRVTDLANAYVRGQDGGGQ----SNQRVVNMLEVGAPQQ 238

Query: 196 VTLKVTIAEVRRDILKQIGF-----------------------------QHSITGSSSGP 226
           V L+V +AE+ + +L Q G                              Q S TG+S  P
Sbjct: 239 VMLEVKVAEISKSLLDQFGINFSRAYVPGDGSMMRFLSGIFGGAVGAMGQISGTGASGVP 298

Query: 227 SKSFAADFGGKFV---SEGGDFSVK--GVLDRFSFET-------------VLHALERATA 268
             S  A  GG      + GG+ +V       R ++ T              L+  +    
Sbjct: 299 FSSVDAVIGGTVPIAGASGGNVTVTYDATTGRPTYTTSYGTVPGRGVSNATLNMQKNDGL 358

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT----HDYGVVLHFTPTVLS 324
           ++ LAEPT+ AISGQ+ SF +GG+ ++  VS   G+   TT     ++GV + FTPTVL 
Sbjct: 359 VKVLAEPTIMAISGQTGSFLAGGK-IFIPVSKDNGSGGSTTTLEEKEFGVSVRFTPTVLG 417

Query: 325 PGRIGLRIQTEVSEPVI--------GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD 376
            GRI LR++ EVSE  +        G+NA  +PS+  RKA+TTV+L  G +  + GL+K+
Sbjct: 418 SGRINLRVRPEVSELNVAGVQISSGGLNA-VLPSFTSRKAETTVQLMDGQSFAIGGLIKN 476

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHY 434
           +        P L ++P++GALFR++ F  + +E+    TP LVKP+ +     P D Y
Sbjct: 477 NTTTNINAFPFLGELPVVGALFRSTEFQTDRSELVFVITPRLVKPLPV-GYRLPTDGY 533


>gi|307300715|ref|ZP_07580490.1| type II and III secretion system protein [Sinorhizobium meliloti
           BL225C]
 gi|306904249|gb|EFN34834.1| type II and III secretion system protein [Sinorhizobium meliloti
           BL225C]
          Length = 466

 Score =  173 bits (439), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 128/455 (28%), Positives = 225/455 (49%), Gaps = 24/455 (5%)

Query: 4   LQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKG--KKISIGLNKVIILQ 61
           + R+  ++ + F F     VA    I  +  A  N   VEI     + I +   K + ++
Sbjct: 1   MTRSRGSLFAFFCFV----VALCTGIGVSPPASANGDSVEISSNFSRSIKVAKGKTVTIR 56

Query: 62  VPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIA 121
                 ++++ DP  A V   + R+ Y+ G  +G  +V +   +   +  +DI +  D  
Sbjct: 57  AVQRFDEIVIGDPEIATVTPLTDRSFYILGNELGSTSVTIFDAEKNPVGIIDIEVTLDTK 116

Query: 122 HLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSS 181
            L  T+R+ +  S+++V   +  +VL G       + +A +++  F           +  
Sbjct: 117 LLSSTIRQSVPGSSVKVTSANGRIVLSGSATDAVAATQAEQIASRF-----------AGD 165

Query: 182 KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSE 241
           ++V+N + I    QV L V   E+ RD+ K++G Q S   + S  S  F +       + 
Sbjct: 166 EEVINSIKITSSQQVQLNVRFVEINRDVGKELGTQISAAYAWSNGSVEFNSSPRATSNTP 225

Query: 242 GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS 301
            G      + + +S +  + ALE     R LAEP L A SG+++SF +GG+     +S  
Sbjct: 226 AGSLIGSLIGEGYSVDVAIDALEDRGMARRLAEPNLIARSGETSSFLAGGEFPIP-ISEQ 284

Query: 302 TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGVNAGDM--PSYRVRKAD 357
            G  +V+   +GV L FTPTVLS G I L I+ EVS  +       G++  P + VR+A 
Sbjct: 285 DGTITVSYKKFGVGLDFTPTVLSDGLIALDIEPEVSAIDNTASYRVGNIAIPGFSVRRAR 344

Query: 358 TTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPF 417
           T+V+L SG + ++AGLL+ +   + + +P L ++PILGALF +  + R ET++ I  TP 
Sbjct: 345 TSVDLKSGQSFMIAGLLQSENNLITQRVPGLGQLPILGALFSSKAYQRRETDLVIIVTPH 404

Query: 418 LVKPV-AMRDLSRPDDHYSVEDDAKAFFFNRVNKI 451
           LVKP+  ++ ++ P D      +A+ FF   ++++
Sbjct: 405 LVKPIDPLKKVASPSDRTKRPTEAE-FFLGNIDEV 438


>gi|12620550|gb|AAG60826.1|AF322012_131 RhcC2 [Bradyrhizobium japonicum]
          Length = 484

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 129/429 (30%), Positives = 206/429 (48%), Gaps = 29/429 (6%)

Query: 56  KVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDIL 115
           K + L  P     + V+DP  AD    S  T+++FGK  G+ ++  +  +G+ +  L I+
Sbjct: 75  KTVHLSAPAAT--IFVADPAIADYQAPSSSTIFVFGKKSGRTSLFALNENGEALAELRIV 132

Query: 116 IERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQ 175
           + + +  L   L+  + D  I+V       +L G+       + A +++E F+       
Sbjct: 133 VTQPLEDLRAALKAEVGDYPIQVSYTPRGAILSGIAPNADVVEAARKVTEQFVG------ 186

Query: 176 YANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG 235
               +   V+N + +AG  QV L V +AEV R  +K +    +I  ++SGP+ +F A   
Sbjct: 187 ----AGAPVVNKIQVAGSLQVNLSVRVAEVSRTAVKDL----NINFTASGPNGAFLAT-- 236

Query: 236 GKFVSEGGDFSVKGVLDRFS-----FETVLHALERATAIRTLAEPTLTAISGQSASFTSG 290
           GK    G       +   FS        VL AL        LAEP LTA+SG++ASF +G
Sbjct: 237 GKPGGSGRAGGGGTIGIGFSTGNINLSAVLDALASEHLASILAEPNLTAMSGEAASFLAG 296

Query: 291 GQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAG 346
           G+     +  +    SV    +GV L F PTVLS  +I +R++ EVSE      + +N  
Sbjct: 297 GEFPIPVMQDNR-QVSVQFRQFGVSLEFVPTVLSNNQIIVRVKPEVSELSTEGEVKINGM 355

Query: 347 DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNRE 406
            +P+   R+A T VEL SG +  + GL++ +        P L  +PILGALFR+S F + 
Sbjct: 356 AVPALSTRRASTVVELASGQSFAIGGLIRRNFNTDIGEFPWLGDVPILGALFRSSSFQKR 415

Query: 407 ETEIFIAATPFLVKPVA-MRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNY 465
           ETE+ I  TP++V+P +    +S P +  +   DA     N V +    ++A        
Sbjct: 416 ETELVIVVTPYIVRPGSNPSQISIPTNRIAPPSDAGRILTNTVARPPQGRDAPRASAPGL 475

Query: 466 KGAIGFIYK 474
            G  GFI +
Sbjct: 476 TGNAGFIIE 484


>gi|17545374|ref|NP_518776.1| outer membrane channel protein [Ralstonia solanacearum GMI1000]
 gi|17427666|emb|CAD14185.1| probable pilus assembly protein, secretin cpac [Ralstonia
           solanacearum GMI1000]
          Length = 634

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 126/439 (28%), Positives = 228/439 (51%), Gaps = 50/439 (11%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           ++++ + K  ++Q+   V+   V +P     ++ SP+T+YL G++VG  N+I+ G  G  
Sbjct: 97  EVTVPVGKSTMVQLTEPVRSRTVGNPNIVQAMLVSPQTLYLLGQDVGTTNMIVQGRSGSC 156

Query: 109 MLNLDILIERDIAHLEMTLRRFIAD-SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
            + +D+ +  D   L+ TL   + + S +RV   +D++VL G V     +Q+ ++++  F
Sbjct: 157 SV-IDVSVGADPGGLQATLHALMPEASRVRVSAAADSLVLGGTVSDSVQAQKIIDIANAF 215

Query: 168 L-------SQSGR--------------NQYANSSS--------KKVMNLLNIAGEDQVTL 198
           +       +QSG+                 A +SS         +++N++++    QV L
Sbjct: 216 VMRETRGPAQSGQTGTMGMQGMTAMSTGNAATASSGSGEAVRNPRIINMMSVEAPQQVML 275

Query: 199 KVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFET 258
           +V +AEV + ++ Q+G   ++ GS    S +F A     F+S   D       ++  F+ 
Sbjct: 276 EVKVAEVSKTLINQMGAALNLNGSFG--SWTFGAL--ANFLSGAPDIFSADKANKLPFQL 331

Query: 259 VLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS--TGATSVTTHD--YGV 314
            + A +    ++ LAEP L AISGQ ASF +GG+ +Y  V  S  TG T++   +  +GV
Sbjct: 332 RVDAQKGDGLVKVLAEPNLMAISGQEASFLAGGK-VYIPVPQSFGTGTTTILLQEETFGV 390

Query: 315 VLHFTPTVLSPGRIGLRIQTEVSE--PV-IGVNAGD------MPSYRVRKADTTVELPSG 365
            L FTPTVL  GRI L++  EVSE  P  + V A +      +P    R+A TT+++  G
Sbjct: 391 GLRFTPTVLENGRINLKVAPEVSELSPTGVAVTAPNVSGTSILPLITTRRASTTLQVHDG 450

Query: 366 GTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMR 425
            +  + GL+K ++    + IP + ++P++GAL R++ F +++TE+    TP LVKP+   
Sbjct: 451 QSFAIGGLIKSNVTGSLKAIPGVGELPVIGALARSTSFQQDQTELLFVVTPHLVKPLPA- 509

Query: 426 DLSRPDDHYSVEDDAKAFF 444
           +   P D +   +  + + 
Sbjct: 510 NYPMPTDSFGPVNQGEVYL 528


>gi|300704930|ref|YP_003746533.1| pilus assembly secretion protein [Ralstonia solanacearum CFBP2957]
 gi|299072594|emb|CBJ43944.1| pilus assembly secretion protein [Ralstonia solanacearum CFBP2957]
          Length = 622

 Score =  173 bits (438), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 120/433 (27%), Positives = 220/433 (50%), Gaps = 44/433 (10%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           ++++ + K  ++Q+P  V++  V +P     ++ SP+T+YL G+ VG  N+I+ G  G  
Sbjct: 99  EVTVPVGKSTMVQLPEPVRNRTVGNPHIVQAMLVSPQTLYLLGQEVGTTNMIVQGRSGSC 158

Query: 109 MLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
            + +D+ +  D   L+ TLR  +  + N++V   +D++VL G V     +Q+ ++++  F
Sbjct: 159 SV-IDVSVGADPGGLQSTLRTLVPGAKNVQVSAAADSLVLSGSVSDSVQAQKVLDIANAF 217

Query: 168 LSQSGRNQY----------------------ANSSSKKVMNLLNIAGEDQVTLKVTIAEV 205
           + +  R                         A   S +++N++ +    QV L+V +AEV
Sbjct: 218 VMRQTRGPAQGDQGGAAQGGGAMQGLGATPGAPPRSPRIINMMAVEAPQQVMLEVKVAEV 277

Query: 206 RRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
            + ++ Q+G   ++ G+    S +F A     F+S   D       +    +  L A + 
Sbjct: 278 SKTLIDQMGSALNVNGAFG--SWTFGAL--ANFLSGSNDIVNFSKNNHLPLKFALDAQKG 333

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT-----HDYGVVLHFTP 320
              ++ LAEP+L AISGQ ASF +GG+ ++  V+       V T       +GV L FTP
Sbjct: 334 DGLVKVLAEPSLMAISGQEASFLAGGK-VFIPVAQGAATNGVATIILQEETFGVGLRFTP 392

Query: 321 TVLSPGRIGLRIQTEVSE------PVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLA 371
           TV+  GRI L++  EVSE       V   N+ +   +P    R+A TT+++  G +  + 
Sbjct: 393 TVMENGRINLKVSPEVSELSPTGVAVTAPNSNNTSILPLITTRRASTTLQVHDGQSFAIG 452

Query: 372 GLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           GL+K+++    + IP + ++P++GAL R++ F +++TE+    TP LVKP+  +    P 
Sbjct: 453 GLIKNNVTGSLKAIPGIGELPVIGALARSTSFQQDQTELVFVVTPRLVKPLPAQ-YPLPT 511

Query: 432 DHYSVEDDAKAFF 444
           D +   + A+ F 
Sbjct: 512 DSFGQANPAEIFL 524


>gi|27376953|ref|NP_768482.1| RhcC2 protein [Bradyrhizobium japonicum USDA 110]
 gi|27350095|dbj|BAC47107.1| RhcC2 protein [Bradyrhizobium japonicum USDA 110]
          Length = 430

 Score =  173 bits (438), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 129/429 (30%), Positives = 206/429 (48%), Gaps = 29/429 (6%)

Query: 56  KVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDIL 115
           K + L  P     + V+DP  AD    S  T+++FGK  G+ ++  +  +G+ +  L I+
Sbjct: 21  KTVHLSAPA--ATIFVADPAIADYQAPSSSTIFVFGKKSGRTSLFALNENGEALAELRIV 78

Query: 116 IERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQ 175
           + + +  L   L+  + D  I+V       +L G+       + A +++E F+       
Sbjct: 79  VTQPLEDLRAALKAEVGDYPIQVSYTPRGAILSGIAPNADVVEAARKVTEQFVG------ 132

Query: 176 YANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG 235
               +   V+N + +AG  QV L V +AEV R  +K +    +I  ++SGP+ +F A   
Sbjct: 133 ----AGAPVVNKIQVAGSLQVNLSVRVAEVSRTAVKDL----NINFTASGPNGAFLAT-- 182

Query: 236 GKFVSEGGDFSVKGVLDRFS-----FETVLHALERATAIRTLAEPTLTAISGQSASFTSG 290
           GK    G       +   FS        VL AL        LAEP LTA+SG++ASF +G
Sbjct: 183 GKPGGSGRAGGGGTIGIGFSTGNINLSAVLDALASEHLASILAEPNLTAMSGEAASFLAG 242

Query: 291 GQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAG 346
           G+     +  +    SV    +GV L F PTVLS  +I +R++ EVSE      + +N  
Sbjct: 243 GEFPIPVMQDNR-QVSVQFRQFGVSLEFVPTVLSNNQIIVRVKPEVSELSTEGEVKINGM 301

Query: 347 DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNRE 406
            +P+   R+A T VEL SG +  + GL++ +        P L  +PILGALFR+S F + 
Sbjct: 302 AVPALSTRRASTVVELASGQSFAIGGLIRRNFNTDIGEFPWLGDVPILGALFRSSSFQKR 361

Query: 407 ETEIFIAATPFLVKPVA-MRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNY 465
           ETE+ I  TP++V+P +    +S P +  +   DA     N V +    ++A        
Sbjct: 362 ETELVIVVTPYIVRPGSNPSQISIPTNRIAPPSDAGRILTNTVARPPQGRDAPRASAPGL 421

Query: 466 KGAIGFIYK 474
            G  GFI +
Sbjct: 422 TGNAGFIIE 430


>gi|123443821|ref|YP_001007792.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122090782|emb|CAL13664.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 453

 Score =  172 bits (437), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 121/398 (30%), Positives = 203/398 (51%), Gaps = 33/398 (8%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +S G + +I  Q  +D   V VS    AD  +    ++ ++ K  G A  IL   +   +
Sbjct: 37  LSTGESYMIKTQEEIDT--VFVSAAAIADYELVGKNSIIVYAKQEGTAEFILFNQNHHPI 94

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQ-------RAVE 162
               IL++  I      +R    +S+I +  + D+ +L G V T +  +        A+ 
Sbjct: 95  KKSAILVDNTITAAHKRIRLEYPESDIEINKIGDSYILTGTVETEEAKETIASIIGEAIG 154

Query: 163 LSETFLSQS-----GRNQYANSSS-KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ 216
             +T  S S     G +QY NS    +V+N + + G +QV +K+TIAEV +D  + IG  
Sbjct: 155 SEKTIASNSKKDSDGNSQYFNSPEYSRVVNKIKLPGSNQVNVKLTIAEVSKDFSENIGMD 214

Query: 217 HSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPT 276
            S  G+ SG  + F  +   KF ++G                ++HA+   +  R LAEP 
Sbjct: 215 WSTIGNFSGSFQFFKPNGLNKFNAKG-------------ISALVHAINDDSIARVLAEPN 261

Query: 277 LTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           L+ +SG+SASF  GG+     V+++  +T +T   +G+ L+    V +  RI +++  EV
Sbjct: 262 LSVLSGESASFLVGGE--LPLVNTTANSTVITYKQFGIKLNIGAKVNAKKRIRIKLDEEV 319

Query: 337 S--EPVIGVNAGD-MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPI 393
           S  + V  ++ GD  PS+R RKA TT+EL  G + +L GL+    ++  + IP +  IPI
Sbjct: 320 SSVDKVFNIDGGDAYPSFRTRKAATTLELGDGESFILGGLISSSEREALKKIPFIGDIPI 379

Query: 394 LGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           LGA FRN+   + +TE+ + AT  LV+PV+ +++  P+
Sbjct: 380 LGAFFRNAETRKNQTELVVVATVNLVRPVSEKEVELPN 417


>gi|13471032|ref|NP_102601.1| secretory protein [Mesorhizobium loti MAFF303099]
 gi|14021776|dbj|BAB48387.1| probable secretory protein [Mesorhizobium loti MAFF303099]
          Length = 461

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 130/415 (31%), Positives = 207/415 (49%), Gaps = 47/415 (11%)

Query: 26  LPPIKEANAAVINIS-----DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVV 80
           LP + +A+  ++ +S      +++ KGK  +I  N             +++ DP  A+V 
Sbjct: 13  LPGVAKADNDIVYVSATKNASIKVAKGKPKTIVTNAAFY--------QIVIGDPEIANVN 64

Query: 81  VHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEM 140
             + ++ Y+ G N+G   + L     + +  +DI +  D   L  T+R  + D+ I+V  
Sbjct: 65  PLTDKSFYVLGNNLGTTGIALFDEKKQLVGTVDIEVTLDTDQLASTIRASVPDAKIKVGS 124

Query: 141 VSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKV 200
            +  VVL G       +++A +++  F           S +++V+N +NI+   QV L V
Sbjct: 125 ANGRVVLSGEADDAVAAEKANKIATRF-----------SGTEEVINSVNISSSQQVQLNV 173

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS-EGGDFSVKG---VLDRF-- 254
              E+ R   + +G ++S          +FA  FGG+ VS + G     G   ++ R   
Sbjct: 174 RFVEINRQAGQDLGAKYS---------ANFAYGFGGRDVSLDPGTVPAAGTGEIIGRLLS 224

Query: 255 ---SFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHD 311
              S +  + ALE     R LAEP L A SG++ASF +GG+     VS   G  SV+   
Sbjct: 225 NGVSIDIAIKALEERGLARRLAEPNLIARSGETASFLAGGEFPIP-VSEDNGKISVSYKK 283

Query: 312 YGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGVNAG--DMPSYRVRKADTTVELPSGGT 367
           YGV L FTPTVL  G + L I  EVS  +     N G   +P + VR+A T+V+L +G +
Sbjct: 284 YGVSLDFTPTVLKDGLVSLDIAPEVSSIDASSSYNIGTISVPGFIVRRAKTSVDLKNGQS 343

Query: 368 IVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV 422
            ++AGLL+         IP L K+P+LGALF +  + R ET++ I  TP+LVKPV
Sbjct: 344 FMIAGLLQSQNDITTSRIPGLGKMPVLGALFSSKSYQRRETDLVIIVTPYLVKPV 398


>gi|218710406|ref|YP_002418027.1| Flp pilus assembly protein [Vibrio splendidus LGP32]
 gi|218323425|emb|CAV19602.1| Flp pilus assembly protein [Vibrio splendidus LGP32]
          Length = 484

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 128/446 (28%), Positives = 216/446 (48%), Gaps = 27/446 (6%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
           GK +++  +K   + +      V + DP   D+V+     ++L GK +G  N++     G
Sbjct: 25  GKTVTVPHHKSTHVVLSGKASKVSLGDPDVLDIVMLKSSELFLIGKKLGATNLMAWDSRG 84

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           + + +++I +  D+  L+  L  F+ D  I V    + ++L G V   Q    A+ ++ET
Sbjct: 85  QLIESINIEVTHDLNSLKAKLYEFLPDETIEVHSAQNRLLLSGQVSNQQQMNVAMRIAET 144

Query: 167 FLSQSGRNQYANSSSKK-----VMNLLNIAGEDQVTLKVTIAEVRRDILKQIG-----FQ 216
           + S    ++   S S++     V+NL++I G  QV L+VT+AEV+R ++++       FQ
Sbjct: 145 YSSGETADESKESGSEQAAATGVINLMSIGGAQQVMLEVTVAEVQRSLVRKFDANFHFFQ 204

Query: 217 HSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRF-----SFETVLHALERATAIRT 271
            S +  S G S   A   G   + +    +  G+L  F      F   L   ++    + 
Sbjct: 205 TSGSNISWGASSVPAGVLGATPIFDIPTSTDYGILGSFIDSNTLFTFALDVAKQNGVAKV 264

Query: 272 LAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           LAEP LTA+SG  A F +GG+     V    G T +   +YGV L F PTVLS  +I L 
Sbjct: 265 LAEPNLTALSGSKAEFLAGGEFPIP-VPDEDGIT-IEYKEYGVGLKFIPTVLSDKKINLN 322

Query: 332 IQTEVSE----PVIGVNAGD------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
           +  +VSE      + ++ G       +P    R A +T+EL  G TI +AGLL ++++ +
Sbjct: 323 LAVDVSEIANSSSLTIDPGTTNATYFIPPITRRSASSTLELADGQTIGIAGLLSENVRDV 382

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
              +P +  +PILG LF +  +   ETE+ I  TP L  P+    ++ P D +   +D +
Sbjct: 383 SNKMPGIGDVPILGQLFNSQEYVSGETELVILVTPRLASPIDRSKVTLPTDAFVDPNDLE 442

Query: 442 AFFFNRVNKIYGPKEASEVEGQNYKG 467
            +   R   I  P E+   + Q  +G
Sbjct: 443 YYLLGRSAYIAEPSESDSEQSQASQG 468


>gi|326797327|ref|YP_004315147.1| type II and III secretion system protein [Marinomonas mediterranea
           MMB-1]
 gi|326548091|gb|ADZ93311.1| type II and III secretion system protein [Marinomonas mediterranea
           MMB-1]
          Length = 464

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 124/415 (29%), Positives = 209/415 (50%), Gaps = 26/415 (6%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           E+    ++ + +N+  +L +P     VL+++P  A   + SP  +++F K  G   +  +
Sbjct: 44  EVAVSGQVKLHVNQGTLLNLPKAASKVLIANPEVASFQMPSPDNVFVFAKAPGDTTLYAL 103

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDT-VVLHGMVRTIQDSQRAV 161
             +   ++ + +    D+  L   + + +  + ++V   +D  +++ G V+T Q +++ +
Sbjct: 104 DENNDVIIAVTLTSGYDLEGLTRQVAKEVPGTEVQVGPATDKGLIVRGTVQTPQQAKQVI 163

Query: 162 ELSETFLSQS-------GRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
              E++L  S       GR   +N S  +++N L +A   QV + V I EV R +   +G
Sbjct: 164 SSVESYLGASTSANGRGGRGGQSNQS-LRIVNQLKVALSSQVNISVRIVEVSRSLTHALG 222

Query: 215 FQHSI-----TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFET--VLHALERAT 267
           F         TG     S  F A  G   V +G   S+ GVL     +   VL AL    
Sbjct: 223 FSWDTLFDNNTGFIRNGSSLFDASTG---VFDGSGISL-GVLGGTIGDVGGVLSALSNDG 278

Query: 268 AIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGR 327
               LAEP LTA+SG++A F  GG+     V  +  + ++    YGV++  TPT+LSP R
Sbjct: 279 MASILAEPNLTAMSGETAGFAVGGE--VPIVIQTNNSVTIEYKQYGVIMRMTPTLLSPNR 336

Query: 328 IGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKE 383
           I L I  EVS+      + +N   +P+++VR+A+TTVEL SG +  LAG+L+  + Q   
Sbjct: 337 ISLHIAPEVSDLSDDGSVVLNDTTIPAFKVRRANTTVELASGQSFALAGMLRSSVSQTVS 396

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVED 438
           G+P L  IP+LG +F      +EETE+ I AT ++V+P +  +L  P    S  D
Sbjct: 397 GVPGLRSIPVLGRMFETEINQKEETELVIIATAYIVEPTSANNLQSPAQGISTID 451


>gi|86147467|ref|ZP_01065779.1| Flp pilus assembly protein [Vibrio sp. MED222]
 gi|85834760|gb|EAQ52906.1| Flp pilus assembly protein [Vibrio sp. MED222]
          Length = 485

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 126/438 (28%), Positives = 213/438 (48%), Gaps = 27/438 (6%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
           GK +++  +K   + +      V + DP   D+V+     ++L GK +G  N++     G
Sbjct: 25  GKTVTVPHHKSTHVVLSGKASKVSLGDPDVLDIVILKSNEVFLIGKKLGATNLMAWDSRG 84

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           + + +++I +  D+  L+  L  F+ D  I V    + ++L G +   Q    A+ ++ET
Sbjct: 85  QLIESINIEVTHDLNSLKSKLYEFLPDETIEVHSAQNRLLLSGQISNQQKMNVAMRIAET 144

Query: 167 FLSQSGRNQYANSSSKKV-----MNLLNIAGEDQVTLKVTIAEVRRDILKQIG-----FQ 216
           + +    +    S S++V     +NL++I G  QV L+VT+AEV+R ++++       FQ
Sbjct: 145 YAAGQAADDSKESGSEQVAATGVINLMSIGGAQQVMLEVTVAEVQRSLVRKFDANFHFFQ 204

Query: 217 HSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRF-----SFETVLHALERATAIRT 271
            S +  S G S   A   G   V +    +  G+L  F      F   L   ++    + 
Sbjct: 205 TSGSNFSWGASSVPAGALGATPVFDIPTSTDYGILGSFIDSNTLFTFALDVAKQNGVAKV 264

Query: 272 LAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           LAEP LTA+SG  A F +GG+     V    G T +   +YGV L F PTVLS  +I L 
Sbjct: 265 LAEPNLTALSGSKAEFLAGGEFPIP-VPDEDGIT-IEYKEYGVGLKFIPTVLSDKKINLN 322

Query: 332 IQTEVSE----PVIGVNAGD------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
           +  +VSE      + ++ G       +P    R A +T+EL  G TI +AGLL ++++ +
Sbjct: 323 LAVDVSEIANSSSLTIDPGSTNATYFIPPITRRSASSTLELADGQTIGIAGLLSENVRDV 382

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
              +P +  +PILG LF +  +   ETE+ I  TP L KPV    ++ P D +   +D +
Sbjct: 383 SNKMPGIGDVPILGQLFNSQEYVSGETELVILVTPRLAKPVDRSKVTLPTDAFVDPNDLE 442

Query: 442 AFFFNRVNKIYGPKEASE 459
            +   R   I  P ++ +
Sbjct: 443 YYLLGRSAYIAEPSDSED 460


>gi|308050059|ref|YP_003913625.1| type II and III secretion system protein [Ferrimonas balearica DSM
           9799]
 gi|307632249|gb|ADN76551.1| type II and III secretion system protein [Ferrimonas balearica DSM
           9799]
          Length = 487

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 124/409 (30%), Positives = 201/409 (49%), Gaps = 53/409 (12%)

Query: 69  VLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNL-DILIERDIAHLEMTL 127
           V V +P  AD+++ +P+ +Y+ G+ +G  N I++  D  +++++ DI I  D+  L+  L
Sbjct: 67  VSVGNPAIADILLINPKELYILGRQLGSTN-IMVWDDQDRLVDIVDIEITHDLNGLKEKL 125

Query: 128 RRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNL 187
            RF+ D  I V      +V+ G V  +     A++L+  +   +  N   N+S+  V+NL
Sbjct: 126 HRFLPDEPIEVHSSQGQLVIGGQVSNLDRMNMALDLAHGYAVAA--NNSDNTST--VLNL 181

Query: 188 LNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDF-- 245
           +++ G  QV L+VT+ EV+R++                 +++  +DF    V EG DF  
Sbjct: 182 MSVGGGHQVMLEVTVTEVQREL-----------------ARTLDSDFA--LVFEGSDFIG 222

Query: 246 ---------SVKGVLDRFS-----FETVLHALERATAIRTLAEPTLTAISGQSASFTSGG 291
                    S KG+   +      F+  +   ++    R LAEP LT +SGQ A F SGG
Sbjct: 223 GLLGGDGLISNKGIFGSYVSGDVLFDFAIDMAKQQGLARVLAEPNLTTMSGQMAEFLSGG 282

Query: 292 QHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----------PVI 341
           +  +         T++   ++GV + F PTVL  GRI L +   VSE          P  
Sbjct: 283 E--FPIPVPDRDGTTIEYKEFGVGVKFVPTVLDSGRINLNLNVLVSELSNANAVGVIPEG 340

Query: 342 GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNS 401
              A   PS   R A++T+EL  G TI +AGLL   +++  + +P L +IP+LG LF + 
Sbjct: 341 STTALVTPSITKRSANSTIELGDGQTIAIAGLLSSTVRESMDELPGLGEIPVLGQLFSSQ 400

Query: 402 RFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNK 450
            +   ETE+ I  TP LV+PV    L  P D +    D   +   R++K
Sbjct: 401 EYRNGETELVILVTPRLVRPVDREKLVLPTDGFVDPTDLGFYLMGRLSK 449


>gi|84387245|ref|ZP_00990266.1| Flp pilus assembly protein [Vibrio splendidus 12B01]
 gi|84377892|gb|EAP94754.1| Flp pilus assembly protein [Vibrio splendidus 12B01]
          Length = 484

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 128/442 (28%), Positives = 213/442 (48%), Gaps = 27/442 (6%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
           GK +++  +K   + +      V + DP   D+V+     ++L GK +G  N++     G
Sbjct: 25  GKTVTVPHHKSTHVVLSGKAAKVSLGDPEVLDIVILKSNELFLIGKKLGATNLMAWDSRG 84

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           + + +++I +  D+  L+  L  F+ D  I V    + ++L G V   Q    A+ ++ET
Sbjct: 85  QLIESINIEVTHDLNSLKAKLYEFLPDETIEVHSAQNRLLLSGQVSNQQQMNVAMRIAET 144

Query: 167 FLSQSGRNQYANSSSKK-----VMNLLNIAGEDQVTLKVTIAEVRRDILKQIG-----FQ 216
           + S    ++   S S++     V+NL++I G  QV L+VT+AEV+R ++++       FQ
Sbjct: 145 YSSGQTADKSNESGSEQADATGVINLMSIGGAQQVMLEVTVAEVQRSLVRKFDANFHFFQ 204

Query: 217 HSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRF-----SFETVLHALERATAIRT 271
            S +  S G S   A   G   +      +  G+L  F      F   L   ++    + 
Sbjct: 205 TSGSDFSWGASSVPAGVLGATPIFNIPTSTDYGILGSFIDSNTLFTFALDVAKQNGVAKV 264

Query: 272 LAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           LAEP LTA+SG  A F +GG+     V    G T +   +YGV L F PTVLS  +I L 
Sbjct: 265 LAEPNLTALSGSKAEFLAGGEFPIP-VPDEDGIT-IEYKEYGVGLKFIPTVLSDKKINLN 322

Query: 332 IQTEVSE----PVIGVNAGD------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
           +  +VSE      + ++ G       +P    R A +T+EL  G TI +AGLL ++++ +
Sbjct: 323 LAVDVSEIANTSSLTIDPGTTNATYFIPPITRRSASSTLELADGQTIGIAGLLSENVRDI 382

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
              +P    +PILG LF +  +   ETE+ I  TP L KP+    ++ P D +   +D +
Sbjct: 383 SNKMPGFGDVPILGQLFNSQEYISGETELVILVTPRLAKPIDRSKVTLPTDAFVDPNDLE 442

Query: 442 AFFFNRVNKIYGPKEASEVEGQ 463
            +   R   I  P E+   + Q
Sbjct: 443 YYLLGRGAYIAEPSESDSEQSQ 464


>gi|157961834|ref|YP_001501868.1| type II and III secretion system protein [Shewanella pealeana ATCC
           700345]
 gi|157846834|gb|ABV87333.1| type II and III secretion system protein [Shewanella pealeana ATCC
           700345]
          Length = 478

 Score =  171 bits (433), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 123/424 (29%), Positives = 210/424 (49%), Gaps = 21/424 (4%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           I I  ++V++L+ PV    V V +P+ AD+ +     +Y+ GK +G  NV++   + +  
Sbjct: 37  IPIFKSRVLMLKGPV--HRVSVGNPSIADIKLLPNDELYILGKQLGSTNVMIWDKNEQLA 94

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
             +DI +  D+  L+  L +F+    + V+     ++L G    +Q    AVEL++ +  
Sbjct: 95  RIMDIEVTHDLNGLKTRLYQFLPTEKLGVQTSQGQLLLSGQASNLQKMNTAVELAQGYAE 154

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKS 229
            +   Q    +  KV+N++ I G+ QV L+V +AEV+R++ +Q   +  I    S  S  
Sbjct: 155 AAAGGQ----APSKVLNMMTIGGDHQVMLEVVVAEVQRNVARQFDSKFFIFNQGSNLSGG 210

Query: 230 FAADFGGKFVSEGGDFSVKGVLDRF-----SFETVLHALERATAIRTLAEPTLTAISGQS 284
                GG      G    KG+  ++          L   ++    + LAEP +TA+SGQS
Sbjct: 211 LVGGGGGFDPGSIGGIDAKGLFAQYINGDLMMNFALDIAKQNGLAKVLAEPNVTAMSGQS 270

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE------ 338
           A F SGG+     V    G T++   DYGV + F PTVL  G+I L +   VSE      
Sbjct: 271 AEFLSGGEFPIP-VPGENGNTTIEYRDYGVGVKFVPTVLDSGQINLNLNVVVSEISTANG 329

Query: 339 -PVIGVNAGDM--PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILG 395
             + G  +  +  PS   R   TTVEL  G TI ++GL+ D +++  + +P L  +P+LG
Sbjct: 330 FAISGNTSTTLVVPSLVKRSTATTVELADGQTIAISGLISDTLRENIDKLPGLGDVPVLG 389

Query: 396 ALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPK 455
            LF +  F   ++E+ I  TP LV+    +D+S P D + +  D + +   +++      
Sbjct: 390 QLFTSKSFQSGQSELVILVTPRLVRAFNRKDISLPTDGFVLPSDVEFYLLGKLSHKENSD 449

Query: 456 EASE 459
           ++S+
Sbjct: 450 DSSD 453


>gi|295690798|ref|YP_003594491.1| type II and III secretion system protein [Caulobacter segnis ATCC
           21756]
 gi|295432701|gb|ADG11873.1| type II and III secretion system protein [Caulobacter segnis ATCC
           21756]
          Length = 564

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 147/518 (28%), Positives = 231/518 (44%), Gaps = 110/518 (21%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
           +E+ KGK          I+++P DV+D+LV+ PT AD V+   R +Y+ G   G  +   
Sbjct: 72  LELAKGKSA--------IVELPADVRDLLVTSPTVADAVLRDRRRVYIVGLAEGVTDAAF 123

Query: 102 IGHDGKQMLNLDILIE------------------------RDIAHLEMTLR--------- 128
               G+++L+L I +                         RD   L  T+R         
Sbjct: 124 FDDAGRRILSLSIKVSQPVDQLADTLSRVLPDAKIEVRPIRDSVVLSGTVRSPAQSDAAA 183

Query: 129 ----RFIADSNIRVEMVS----DTVVLHGMVRTIQDS---QRAVELSETFLSQSGRNQYA 177
               +++   +  + M+S    D V+L   +  ++ +   Q  V+L+   L Q G++QY+
Sbjct: 184 RIAAQYVGGPDKVLNMLSIAGKDQVMLQVRIVEVRRNVIKQLGVDLN-AVLGQLGQSQYS 242

Query: 178 NSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAA----- 232
              S       N+ G             + D  KQ   Q    G+  G +K  A      
Sbjct: 243 FGLSPTYSVNGNLLGG-------VTGGYKLDTTKQPTLQIP-CGNGVGDAKCLAVVHGKV 294

Query: 233 --------DFGGKFVSEGGDFSV----KGVLDRFSFETVLHALERATAIRTLAEPTLTAI 280
                     G + V   GD +      G       + ++ A ER   +RTLAEP LTA+
Sbjct: 295 YHTGVIDPTTGREIVVGNGDTATISDTAGSTGVNQAKGMIQAFERVGLVRTLAEPNLTAV 354

Query: 281 SGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE-- 338
           SG++  F  GG+    T S +TG  ++    YGV L +TP V+S GRI L+I TEVSE  
Sbjct: 355 SGEAGHFLVGGEFPVPTGSDATGKIAIEFKPYGVGLGYTPVVMSGGRISLKISTEVSELS 414

Query: 339 ---------------------PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
                                P+       +P   VR+A+TTVELPSGG+ ++AGLL+  
Sbjct: 415 SLGAFTISNSTTSGNTTTTSAPLT------VPGLSVRRAETTVELPSGGSFMIAGLLQQT 468

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVE 437
            +Q  + +P ++ +PILG+LFR+  F   ETE+ I  TP++V P   RDL  P D   + 
Sbjct: 469 TKQAIDALPGMTNMPILGSLFRSRDFLNGETELVIIVTPYIVDPAKPRDLQTPADGLRMA 528

Query: 438 DDAKAFFFNRVNKIY-GPKEASEVEGQNYKGAIGFIYK 474
            D       R+N++   P  A+   G+ Y+G +G++ +
Sbjct: 529 GDMSTVLLGRLNQVVKAPPGAN--AGRAYQGPVGYVIE 564


>gi|13475294|ref|NP_106858.1| type II secretion system protein [Mesorhizobium loti MAFF303099]
 gi|14026045|dbj|BAB52644.1| type II secretion system protein [Mesorhizobium loti MAFF303099]
          Length = 432

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 125/406 (30%), Positives = 196/406 (48%), Gaps = 29/406 (7%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
            +S  L K + L  P     + V+DPT AD    S  T+++FGK  G+ ++  +   G+ 
Sbjct: 19  NLSSSLGKTVHLPAPATT--IFVADPTIADYQAASNTTIFVFGKKSGRTSLFALDDKGEA 76

Query: 109 MLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           +  L I++ + I  L   L   + DS+I+V       +L G     + +  A  ++E +L
Sbjct: 77  LAALRIVVTQPIEELRAMLMDQVGDSSIQVSYTPRGAILSGTAPNAEVADTAKRVTEQYL 136

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGS------ 222
                         +V+N + +AG  QV L V +AEV R  +K +G   S  G       
Sbjct: 137 GDGA----------QVVNNIKVAGSLQVNLSVRVAEVSRSAMKALGVNLSAFGQIDNFRV 186

Query: 223 SSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISG 282
                    +       + G  F+   V    +   VL AL +      LAEP LTA+SG
Sbjct: 187 GLLSGGGTGSGAAQGGGTAGIGFNNGAV----NIGAVLDALAKEHIASVLAEPNLTAMSG 242

Query: 283 QSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE---- 338
           ++ASF +GG+     +  +    SV    +GV L F PTVL+  RI + ++ EVSE    
Sbjct: 243 ETASFLAGGEFPIPVLQENK-QVSVEFRHFGVSLEFVPTVLNNNRINIHVKPEVSELSSQ 301

Query: 339 PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALF 398
             + +N   +P+   R+ADT VEL SG +  + GL++ ++       P L ++PILGALF
Sbjct: 302 GAVQINGISVPAVSTRRADTVVELASGQSFAIGGLIRRNVNNNVSAFPWLGEMPILGALF 361

Query: 399 RNSRFNREETEIFIAATPFLVKP-VAMRDLSRPDDHYSVE-DDAKA 442
           R+S F +EE+E+ I  TP++VKP  +   +S P D  +   DD  A
Sbjct: 362 RSSSFQKEESELIILVTPYIVKPGSSPNQMSAPTDRMAPALDDPPA 407


>gi|163751744|ref|ZP_02158962.1| Flp pilus assembly protein, secretin CpaC [Shewanella benthica
           KT99]
 gi|161328396|gb|EDP99555.1| Flp pilus assembly protein, secretin CpaC [Shewanella benthica
           KT99]
          Length = 484

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 123/435 (28%), Positives = 216/435 (49%), Gaps = 37/435 (8%)

Query: 59  ILQVPV----------DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           I+Q+P+           V  V V +P   D+ +     +Y+ GK +G  N+++   + + 
Sbjct: 39  IMQIPIFKSRIINLKHAVHRVSVGNPNIGDIKLLPNNELYVLGKKLGSTNIMIWDENERL 98

Query: 109 MLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           +  +DI I  D+  L++ L  F+    + V+     +++ G    ++    AVEL++ + 
Sbjct: 99  VDVIDIEITHDLNGLKLRLHEFLPGEKLGVQTSQGHLLISGQASNLKKMNTAVELAKAYA 158

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI-------TG 221
           + +  ++  ++    V+N++ + G+ QV L+V IAEV+R++ +Q   +  I       +G
Sbjct: 159 AAASVSKVKST----VLNMMTVGGDHQVMLEVVIAEVQREVARQFDSKFFIFNKGSKMSG 214

Query: 222 SSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
             +G   SF  D      S G  F  + + D       L   ++    + LAEPT+TA+S
Sbjct: 215 GVAGRGGSFDLDPAAAIDSRG--FFARYLNDNLMMNFALDVAKQNGLAKILAEPTVTALS 272

Query: 282 GQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--- 338
           GQSA F SGG+     V    G+T++   D+GV + F PTVL  G+I L +   VSE   
Sbjct: 273 GQSAEFLSGGEFPIP-VPGINGSTTIQYRDFGVGVRFVPTVLDSGQINLNLNVIVSEISN 331

Query: 339 -PVIGVNAGD------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKI 391
              + ++ G       +PS   R   TTVEL  G TI ++GL+ D +++  + +P L  I
Sbjct: 332 VHSVSLSGGGSNATLIVPSIVKRTTSTTVELADGQTIAISGLISDTLRENIDKLPGLGDI 391

Query: 392 PILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKI 451
           PILG LF +  F   ++E+ I  TP LV+P   + +S P D + +  D + +   +++  
Sbjct: 392 PILGQLFTSKSFKSGQSELVILVTPRLVRPFNRKHISLPTDDFVLPSDMEFYLLGKMSH- 450

Query: 452 YGPKEASEVEGQNYK 466
              K+ S+  G  Y+
Sbjct: 451 --KKQNSQRSGTPYE 463


>gi|148976307|ref|ZP_01813031.1| type II and III secretion system protein [Vibrionales bacterium
           SWAT-3]
 gi|145964401|gb|EDK29656.1| type II and III secretion system protein [Vibrionales bacterium
           SWAT-3]
          Length = 464

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 122/412 (29%), Positives = 208/412 (50%), Gaps = 47/412 (11%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + + +N+  ++++P   + + +S    AD    +   + +FGK  G A + ++    + +
Sbjct: 27  LDVTINEAKMIRLPEKAKSIFISSTHIADYQTLTNTKVMVFGKRAGSATITVLNEQERVI 86

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
               I +  +       ++    ++++  E +   + L G V +   +   V L++ +LS
Sbjct: 87  YTNKIRVTHNSREFNELVKNKFPEASVNAESLGGKLWLKGRVPSPMMAHNIVSLAKGYLS 146

Query: 170 --------QSGRNQYANSSS--------------KKVMNLLNIAGEDQVTLKVTIAEVRR 207
                   + G N   N+SS              ++++N L +   +QV ++V IAEV R
Sbjct: 147 PIVNQTEQKEGSNTNKNNSSDSALTQSQPTSSKEEELINQLVVTMPNQVNIRVKIAEVSR 206

Query: 208 DILKQIGFQHSITGSSSGPSKSFAADFGGKF--VSEGGDFSVKGVLDRFSFETVLHALER 265
           ++  ++G +    GS +G    F   +  KF  VS  G  S+  ++D         AL  
Sbjct: 207 NVSNKLGIKW---GSLAGGVGQF---YFAKFPNVSSWGKPSITTLVD---------ALAS 251

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
              +  LAEP LTA+SG+ A F  GGQ     +++ T  T +   D+GV L+FTPTVLS 
Sbjct: 252 NGMMSVLAEPNLTAMSGEDAEFLVGGQVPLPLITADT--TQIEYKDFGVKLNFTPTVLSQ 309

Query: 326 GRIGLRIQTEVSEPVIG----VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLK-DDIQQ 380
            RI L++  EVS   I     +   + PS+  R A TT+EL SG +  L GLLK +DI+Q
Sbjct: 310 NRISLKVNPEVSNVSIDGQQVIQGANFPSFTTRSASTTIELASGQSFALGGLLKSEDIEQ 369

Query: 381 LKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDD 432
           L++ +PL+++IP+LG+LFR++ F R ETE+ I  T +LV+P     +  P D
Sbjct: 370 LQK-VPLVAEIPVLGSLFRSTEFTRRETELIIIVTAYLVQPTRSDSMQLPTD 420


>gi|319783874|ref|YP_004143350.1| type II and III secretion system protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317169762|gb|ADV13300.1| type II and III secretion system protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 482

 Score =  171 bits (432), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 131/412 (31%), Positives = 202/412 (49%), Gaps = 37/412 (8%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           K++ G  K II         +++ DP  A+V   + ++ Y+ G N+G   + L     + 
Sbjct: 56  KVAKGKPKTIITSAAF--YQIVIGDPEIANVNPLTDKSFYVLGNNLGTTGIALFDEKKQL 113

Query: 109 MLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           +  +DI +  D   L  T+R  + D+ I+V   +  VVL G       +++A +++  F 
Sbjct: 114 VGTVDIEVTLDTDQLASTIRASVPDARIKVGSANGRVVLSGEADDAVAAEKANKIATRF- 172

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK 228
                     S +++V+N +NI+   QV L V   E+ R   + +G +++          
Sbjct: 173 ----------SGAEEVINSVNISSSQQVQLNVRFVEINRQAGQDLGAKYA---------A 213

Query: 229 SFAADFGGKFVS-EGGDFSVKG---VLDRF-----SFETVLHALERATAIRTLAEPTLTA 279
           +FA   GG+ VS + G     G   ++ R      S +  + ALE     R LAEP L A
Sbjct: 214 NFAYGLGGRDVSIDPGTVPTAGTGEIIGRLLSNGVSIDIAIKALEERGLARRLAEPNLIA 273

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS-- 337
            SGQ+ASF +GG+     VS   G  SV+   YGV L FTPTVL  G + L I  EVS  
Sbjct: 274 RSGQTASFLAGGEFPIP-VSEDNGKISVSYKKYGVSLDFTPTVLKDGLVSLDIAPEVSSI 332

Query: 338 EPVIGVNAG--DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILG 395
           +     N G   +P + VR+A T+V+L +G + ++AGLL+         IP L K+P+LG
Sbjct: 333 DASASYNIGTISVPGFIVRRARTSVDLKNGQSFMIAGLLQSQNDITTSRIPGLGKMPVLG 392

Query: 396 ALFRNSRFNREETEIFIAATPFLVKPV-AMRDLSRPDDHYSVEDDAKAFFFN 446
           ALF +  + R ET++ I  TP+LVKPV   + L  P D      +A  F  N
Sbjct: 393 ALFSSKSYQRRETDLVIIVTPYLVKPVDPSKKLVEPTDGTQPASNADYFLNN 444


>gi|90406750|ref|ZP_01214943.1| RhcC2 protein [Psychromonas sp. CNPT3]
 gi|90312203|gb|EAS40295.1| RhcC2 protein [Psychromonas sp. CNPT3]
          Length = 459

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 127/417 (30%), Positives = 204/417 (48%), Gaps = 48/417 (11%)

Query: 45  GKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGH 104
            + K +++ L++  +L +P   + + ++    AD    +   + +FGK VG  ++ ++  
Sbjct: 18  AQAKTLNVTLDQAKLLVLPKTAKSIFIASDRVADYQTLTNTKIMIFGKRVGSTSLYVLDA 77

Query: 105 DGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELS 164
               + +  + +  ++  L   ++    ++ +  E  +  + L G V T   +++ V L+
Sbjct: 78  RENVIYSATVKVNHNVQELNALIKHEFPNAQVHSESTAGKLFLKGQVSTPSIAEKIVRLA 137

Query: 165 ETFLS---------------------QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIA 203
           E ++S                     Q G +  +  ++++++N L I    QV L+V IA
Sbjct: 138 EGYVSSNGGKSESAGAATEGGAQDDQQGGESAQSTQNTQELINQLVITMPTQVNLRVRIA 197

Query: 204 EVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSF---ETVL 260
           EV R++  ++G +              A + G    +  G F  K  L    F     ++
Sbjct: 198 EVSRNVSNKLGIKWG------------AQNIG----TISGTFGTKNWLPNVKFPDLSIMI 241

Query: 261 HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP 320
            AL     I  LAEP LTAISG+ ASF  GG+     V   +   ++    +GV L F P
Sbjct: 242 DALASNGLISILAEPNLTAISGERASFLVGGEIPLPVVFGDSA--NIIYKPFGVRLDFKP 299

Query: 321 TVLSPGRIGLRIQTEVS--EPVIGVNAG--DMPSYRVRKADTTVELPSGGTIVLAGLLKD 376
           TVLS  RI L+I+ EVS   P   V  G   +P +  RKA TT+EL SG +  + GLL+ 
Sbjct: 300 TVLSANRIRLQIEPEVSTIAPRTNVQIGGSSLPVFITRKASTTIELASGQSFAIGGLLQS 359

Query: 377 -DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDD 432
            DI+QL++ IPLL  IPILGALFR+S F REETE+ I AT +LV+P      S P D
Sbjct: 360 KDIEQLQK-IPLLGDIPILGALFRSSEFQREETELIIIATVYLVQPTRSDKFSLPTD 415


>gi|51245387|ref|YP_065271.1| hypothetical protein DP1535 [Desulfotalea psychrophila LSv54]
 gi|50876424|emb|CAG36264.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54]
          Length = 480

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 132/445 (29%), Positives = 216/445 (48%), Gaps = 43/445 (9%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVV---VHSPRTMYLFGKNVGQANVILIG 103
           G+ + + +N++  L+    ++   + +P  A+++     SP  +++ GK++G   + L G
Sbjct: 41  GEPVQLTINRLAKLRSSEVIRRAHIVNPDIAELIYSKTQSPAWVFVSGKSIGTTQLTLWG 100

Query: 104 HDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL 163
              K +   +I++  D+  L+  +       N+ V    D + L G V      Q+ + L
Sbjct: 101 ARNKILGTFEIIVRPDVLGLKKHIHDVFPGENVSVRDSGDFLTLTGTVAGAVRLQKILAL 160

Query: 164 SETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS 223
           +E +            +  KV+NLL + G  QV L+V IAE+ + +  Q+G    + GSS
Sbjct: 161 AEAY------------APSKVINLLKVGGIQQVMLEVRIAEISKRVGNQLGINFGLDGSS 208

Query: 224 SGPSKSFAADFGGKFVSEGGDFSVKG--VLDRF--------------SFETVLHALERAT 267
            G   S      G     GG   ++   VLD                S+   + AL+   
Sbjct: 209 -GFGLSMLDGLSGL---PGGTLPIEPARVLDGLNIGSGVNAVFGKSGSYIVAIDALQEDG 264

Query: 268 AIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGR 327
            ++ LA+PTL A SGQSASF +GG+  +  V+      S+    +GV L+FTPTVL  GR
Sbjct: 265 LVKVLAKPTLIAQSGQSASFLAGGEFPFP-VAQQFDRFSIEWKPFGVGLNFTPTVLGEGR 323

Query: 328 IGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKE 383
           I L +  EVS+      I      +PS   R+  T VEL    +  +AGL+K++I++  +
Sbjct: 324 ISLLVSPEVSDLDFTNTISYAGYVVPSIETRRMSTVVELNDNQSFAIAGLMKNNIRESIK 383

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAF 443
             PLL  IPILG LFR+S++ + ETE+ +  TP LV PV   +LS P D +    +  AF
Sbjct: 384 KFPLLGDIPILGVLFRSSKYIKNETELVVVVTPHLVTPVDGDELSLPTDSFV---EPTAF 440

Query: 444 FFNRVNKIYGPKEASEVEGQNYKGA 468
               +  + G ++ + VE  +  GA
Sbjct: 441 ELLVLGMLEGKEKQTYVENASATGA 465


>gi|239814526|ref|YP_002943436.1| type II and III secretion system protein [Variovorax paradoxus
           S110]
 gi|239801103|gb|ACS18170.1| type II and III secretion system protein [Variovorax paradoxus
           S110]
          Length = 504

 Score =  169 bits (429), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 124/385 (32%), Positives = 204/385 (52%), Gaps = 39/385 (10%)

Query: 78  DVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSN-I 136
           DV + SP  ++  G+  G  NV+L   DG   +  D+++  D   L+  L   + + N I
Sbjct: 122 DVTLLSPTDLFFRGRQAGSMNVVLQSVDGTCYIK-DVIVTIDPGALQSKLAELMPEENHI 180

Query: 137 RVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQV 196
           RV     ++VL G +         + L+  +           +  KKV+NLL +    QV
Sbjct: 181 RVRSAEKSIVLTGEISDALKLDDVMSLAMAY----------GADGKKVVNLLRVTAPQQV 230

Query: 197 TLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLD--RF 254
            L+V IAEV + +L ++G +  ++ +  G   S++      F+S GG     G+L+  R 
Sbjct: 231 MLEVKIAEVSKTLLDRLGARVGLSRTGGGGRDSYS--LISSFLSGGG-----GLLEAIRI 283

Query: 255 SFETV-LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGA--TSVTTHD 311
              +V +   +    +R LAEP + AISGQ ASF SGG+       S+ G   T++T  +
Sbjct: 284 GRTSVGIDGQKDDGLVRILAEPNIMAISGQQASFLSGGKIFIPVAQSAAGGGGTNITLEE 343

Query: 312 --YGVVLHFTPTVLSPGRIGLRIQTEVSE---------PVIGVNAGDMPSYRVRKADTTV 360
             +G+ + FTPTVL+ GR+ L++ +EVS+          V GV A  +PS  VR+ADTTV
Sbjct: 344 KEFGIGVKFTPTVLNGGRVNLKMISEVSDLSQTGSPFTTVTGVTA-VLPSLTVRRADTTV 402

Query: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           +L  G + V+AGL+K ++ +  +  P L ++P++GALFR++ F  ++TE+    TP LV+
Sbjct: 403 QLNDGQSFVIAGLIKSNVTESIKRYPGLGEVPVMGALFRSTEFQNDQTELMFVITPRLVR 462

Query: 421 PVAMRDLSR-PDDHYSVEDDAKAFF 444
           P+A  +  R P D++ V   A+ + 
Sbjct: 463 PLA--EAPRVPTDNHVVPSRAEVYL 485


>gi|217978832|ref|YP_002362979.1| type II and III secretion system protein [Methylocella silvestris
           BL2]
 gi|217504208|gb|ACK51617.1| type II and III secretion system protein [Methylocella silvestris
           BL2]
          Length = 530

 Score =  169 bits (429), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 136/414 (32%), Positives = 203/414 (49%), Gaps = 39/414 (9%)

Query: 77  ADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNI 136
           ADV+  S R +Y+ GK VG  NV +   D K +  +D+ +  DI ++   +R       I
Sbjct: 95  ADVLPMSDRVIYIQGKRVGTTNVSIFDKDKKLIGVIDLEVTLDIQNIAAKVRSGTDSRGI 154

Query: 137 RVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQV 196
           RV   +D +VL G  R   D+ RAV ++++ ++ +   +  +   K V+N +++A   QV
Sbjct: 155 RVSSNNDQIVLSGEARNAVDADRAVSIAKSMVT-TADGKPPDDPGKFVINAMSVAAAQQV 213

Query: 197 TLKVTIAEVRRDILKQIGFQH-------------------SITGSSSGPS-------KSF 230
            L+V   EV R   + IG                      S  G S  P+       ++ 
Sbjct: 214 LLRVRFVEVNRIAERDIGVNWFGAANKTQTAGVNTGNGIASQVGQSLTPTPGGIPLFQTL 273

Query: 231 AADFGGKFVSEGG-DFSVKGV-LDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
           A    G   S G   F V  + L   + + ++ ALE+    R LAEP L A+SG +ASF 
Sbjct: 274 ATLVPGGLASTGSLPFGVGLIKLAGGNVDLLISALEKKGQARRLAEPDLIALSGDTASFL 333

Query: 289 SGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGLRIQTEVSE---PVIG 342
           +GG++   +V SS+G T V T   + YGV L F PTVL+ G I LR+   VSE     + 
Sbjct: 334 AGGEYPVPSVQSSSGTTPVITTQYYPYGVQLTFIPTVLANGIINLRLNPSVSELDYKNVV 393

Query: 343 VNAG-DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNS 401
           V AG  +PS   R+A TT+EL  G +  +AGLL+ D       IP L  +P+LGALF + 
Sbjct: 394 VTAGFAIPSITKREARTTIELRDGQSFAIAGLLQSDSTHDVNQIPWLGSVPVLGALFSSK 453

Query: 402 RFNREETEIFIAATPFLVKPVAM-RDLSRPDDHYSVEDDAKAFFFNR--VNKIY 452
            + + ET++ +  TP LV P A  + ++ P D     +D   F   R  V K Y
Sbjct: 454 SYQQNETDLVVIVTPHLVAPAAPGQVVATPFDKTLPANDVDFFVMGRPEVRKQY 507


>gi|167624205|ref|YP_001674499.1| type II and III secretion system protein [Shewanella halifaxensis
           HAW-EB4]
 gi|167354227|gb|ABZ76840.1| type II and III secretion system protein [Shewanella halifaxensis
           HAW-EB4]
          Length = 478

 Score =  169 bits (429), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 119/416 (28%), Positives = 207/416 (49%), Gaps = 21/416 (5%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           ++I I  ++V++L  P+    V V +P+ AD+ +     +Y+ GK +G  N+++   + +
Sbjct: 35  QRIPIFKSRVLMLNGPI--HRVSVGNPSIADIKLLPNDELYILGKQLGSTNIMIWDKNEQ 92

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
               +DI +  D+  L+  L +F+    + V+     ++L G    +Q    AVEL++ +
Sbjct: 93  LARIMDIEVTHDLNGLKTRLHQFLPTEKLGVQTSQGQLLLSGQASNLQKMNTAVELAQGY 152

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
              +      + +  KV+N++ I G+ QV L+V +AEV+R++ +Q   +  I    S  S
Sbjct: 153 AEAAA----GDRAPSKVLNMMTIGGDHQVMLEVVVAEVQRNVARQFDSKFLIFNQGSNLS 208

Query: 228 KSFAADFGGKFVSEGGDFSVKGVLDRF-----SFETVLHALERATAIRTLAEPTLTAISG 282
                  GG      G    KG+  ++          L   ++    + LAEP +TA+SG
Sbjct: 209 GGVIGGGGGFDPGSIGGVDGKGLFAQYINGDLMMNFALDVAKQNGLAKVLAEPNVTAMSG 268

Query: 283 QSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE---- 338
           QSA F SGG+     V    G T++   DYGV + F PTVL  G+I L +   VSE    
Sbjct: 269 QSAEFLSGGEFPIP-VPGENGNTTIEYRDYGVGVKFVPTVLDSGQINLNLNVVVSEISTA 327

Query: 339 ---PVIGVNAGDM--PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPI 393
               + G  +  +  PS   R   TTVEL  G TI ++GL+ D +++  + +P L  +P+
Sbjct: 328 NGFSISGNTSTSLVVPSLVKRSTATTVELADGQTIAISGLISDTLRENIDKLPGLGDVPV 387

Query: 394 LGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVN 449
           LG LF +  F   ++E+ I  TP LV+    +D+S P D + +  D + +   +++
Sbjct: 388 LGQLFTSKSFQSGQSELVILVTPRLVRAFNRKDISLPTDGFVLPSDVEFYLLGKLS 443


>gi|150377247|ref|YP_001313842.1| type II and III secretion system protein [Sinorhizobium medicae
           WSM419]
 gi|150031794|gb|ABR63909.1| type II and III secretion system protein [Sinorhizobium medicae
           WSM419]
          Length = 466

 Score =  169 bits (428), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 122/426 (28%), Positives = 213/426 (50%), Gaps = 20/426 (4%)

Query: 33  NAAVINISDVEIGKG--KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLF 90
           ++A  N   VEI     + I +   K + ++      ++++ DP  A V   + R+ Y+ 
Sbjct: 26  SSASANGDSVEISSNFSRSIRVAKGKTVTIRAVQRFDEIVIGDPEIATVTPLTDRSFYIL 85

Query: 91  GKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGM 150
           G  +G  +V +   +   +  +DI +  D   L  T+R+ +  SN++V   +  +VL G 
Sbjct: 86  GNELGSTSVTIFDAEKNPVGIIDIEVTLDTKLLSSTIRQSVPGSNVKVTSANGRIVLSGS 145

Query: 151 VRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDIL 210
                 + +A +++  F           +  ++++N + I    QV L V   E+ RD+ 
Sbjct: 146 ATDAVAATQAEQIASRF-----------AGDEEIINSVKITSSQQVQLNVRFVEINRDVG 194

Query: 211 KQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIR 270
           K++G + S   + S  S  F +       +  G      + + +S +  + ALE     R
Sbjct: 195 KELGTRISAAYAWSNGSVEFNSRPRATSNTPAGSLIGSLIGEGYSVDVAIDALEDRGMAR 254

Query: 271 TLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGL 330
            LAEP L A SG+++SF +GG+     VS   G  +V+   +GV L FTPTVLS G I L
Sbjct: 255 RLAEPNLIARSGETSSFLAGGEFPIP-VSEDDGQIAVSYKKFGVGLDFTPTVLSDGLIAL 313

Query: 331 RIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
            I+ EVS         V    +P + VR+A T+V+L SG + ++AGLL+ +   + + +P
Sbjct: 314 DIEPEVSAIDNTASYRVRNISIPGFSVRRARTSVDLKSGQSFMIAGLLQSENNLITQRVP 373

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV-AMRDLSRPDDHYSVEDDAKAFFF 445
            L ++PILGALF +  + R ET++ I  TP LVKP+  ++ ++ P D      +A+ FF 
Sbjct: 374 GLGQLPILGALFSSKAYQRRETDLVIIVTPHLVKPMDPLKKVASPSDRTKRPTEAE-FFL 432

Query: 446 NRVNKI 451
             ++++
Sbjct: 433 GNIDEV 438


>gi|56477528|ref|YP_159117.1| outer membrane channel protein [Aromatoleum aromaticum EbN1]
 gi|56313571|emb|CAI08216.1| probable outer membrane channel protein,probably involved in pilus
           assembly [Aromatoleum aromaticum EbN1]
          Length = 566

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 128/413 (30%), Positives = 204/413 (49%), Gaps = 60/413 (14%)

Query: 76  KADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIAD-S 134
           + DV++ SP  +YL GK+VG  NV+L+   G     LD+ +  D+  ++  L   + D +
Sbjct: 118 QVDVLLLSPNEIYLLGKSVGSTNVVLVDRSGG-CTALDVTVAMDVTSVQGALTALLPDET 176

Query: 135 NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGED 194
            I+V    D++VL G V       RAVE++  ++      +  N  + +V+N+L++    
Sbjct: 177 GIKVSSAYDSLVLTGTVSDATKVDRAVEIASAYVRDGDGGE--NGRNARVLNMLSVGAPQ 234

Query: 195 QVTLKVTIAEVRRDILKQIGFQHS-------------ITGSSSGPSK-------SFAADF 234
           QV L+V +AEV + ++ + G   S             ++G   G S        +  A  
Sbjct: 235 QVMLEVKVAEVSKAVMDRFGIDFSRAYAAGDGTMIRFLSGVFGGKSPVGGQVSGTVGARV 294

Query: 235 GGKFVSE-------------------GGDFSVKGVLDRFSFETVL--HALERATAIRTLA 273
           GG  V                     GGD + K  L   S  T++   A +    ++ LA
Sbjct: 295 GGGIVDSISNASGTSAITAPIGDATIGGD-ATKVPLISGSNSTLIGVDAQKSDGLVKILA 353

Query: 274 EPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPTVLSPGRIGL 330
           EPT+ AISGQ  SF +GG+ ++  VS + G T   T    ++GV + FTPTVL  GRI L
Sbjct: 354 EPTVMAISGQEGSFLAGGK-IFIPVSQNDGGTRTVTLEEKEFGVSVKFTPTVLEGGRINL 412

Query: 331 RIQTEVSE--------PVIGVNA-GDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
            ++ EVSE           GVN    +PS+  R+A TTV+L  G +  + GL+K++    
Sbjct: 413 AVRPEVSELNREGVGLTAPGVNGLAILPSFTTRRAFTTVQLRDGQSFAIGGLIKNNTTTN 472

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHY 434
            +  P L ++P++GALFR++ F  + +E+    TP LVKP+   D + P D+Y
Sbjct: 473 IKAFPFLGELPVIGALFRSTEFQTDRSELVFVITPRLVKPLP-EDYALPTDNY 524


>gi|239908021|ref|YP_002954762.1| bacterial type II and III secretion system protein family protein
           [Desulfovibrio magneticus RS-1]
 gi|239797887|dbj|BAH76876.1| bacterial type II and III secretion system protein family protein
           [Desulfovibrio magneticus RS-1]
          Length = 528

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 130/465 (27%), Positives = 227/465 (48%), Gaps = 73/465 (15%)

Query: 39  ISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQAN 98
           ++ V +    ++++ + K +ILQ   D+  V V+ P  AD V+ SPR +Y+ G+  G  N
Sbjct: 34  VAPVAVRAAPRLALTIGKSVILQSDADIARVSVAQPDVADFVLLSPRQIYVTGRAPGITN 93

Query: 99  VILIGHDGKQMLNLDILIERDIAHLEMTLRRFI-ADSNIRVEMVSDTVVLHGMVRTIQDS 157
           + L     K     D+ +  D + L+  L   +  ++ I V    D++ L G VR  +  
Sbjct: 94  LTLWDKGDKIRAVYDLDVAPDASRLKKMLHDVMPGETGIEVLASQDSIALSGTVRDAESL 153

Query: 158 QRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG--- 214
           ++A+ L+E +            + KKV+NLL+++G  QV L+V +AE+ + ++ ++G   
Sbjct: 154 KKALSLAEVY------------APKKVLNLLSVSGVQQVMLEVRVAEMSKSVVNRMGINL 201

Query: 215 -------FQHSITGS---------------------------SSGPSKSFAADFGGKF-- 238
                  F +++ G                            S G S + +A    +F  
Sbjct: 202 NAVGDGNFGYTLLGGLSTLADTVFNIDNVQNAYKYSTIKFNGSDGSSSTESATIQTRFRE 261

Query: 239 -----------VSEGGD---FSVK-GVLDRFSFETVLHALERATAIRTLAEPTLTAISGQ 283
                      +S+G     FS   G     +   VL  L++   ++ LAEP L  ++GQ
Sbjct: 262 FNQPEQSKTVGLSQGTAAMRFSTNWGGAGNTTMTAVLDLLKQNGLVKILAEPNLVCLNGQ 321

Query: 284 SASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----P 339
           SA F +GG+ +   V S  G TS+   ++GV L FTPTV     I L++  EVS+     
Sbjct: 322 SAKFLAGGE-IPVPVPSGLGTTSIEWKEFGVGLKFTPTVAGE-VISLQVNPEVSDLDYTR 379

Query: 340 VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFR 399
            I +++ ++P+   R+A T+VEL +G T  +AGLLK++ ++  +  P +  IP+LG LF+
Sbjct: 380 AIKLDSFEIPAVLTRRASTSVELKNGQTFAIAGLLKEEGRESVDKYPWIGDIPVLGNLFK 439

Query: 400 NSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF 444
           +S + ++++E+ I  T  LVKP+  +D+  P D     DD + F 
Sbjct: 440 SSSYQKDQSELVILITAHLVKPLNKKDMILPTDGVHEPDDLEFFL 484


>gi|148253058|ref|YP_001237643.1| putative pilus assembly protein CpaC [Bradyrhizobium sp. BTAi1]
 gi|146405231|gb|ABQ33737.1| putative Pilus assembly protein cpaC [Bradyrhizobium sp. BTAi1]
          Length = 496

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 131/438 (29%), Positives = 213/438 (48%), Gaps = 37/438 (8%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           ++IS+  +K   +++       LV  P  ADV+  S R +Y+ GK +G  NV L   D  
Sbjct: 40  RQISVTRDKSRTIKLDKPFASALVGAPDIADVLPMSDRIVYIQGKKIGTTNVTLFDQDKN 99

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
            +  + + +  DI ++   +R       IRV   ++ +VL G  R   D+++AV ++   
Sbjct: 100 VIGVIGLEVTIDIQNIASKIRSGTNSPGIRVSSSNNQIVLSGEARDAVDAEKAVAIARGM 159

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG---FQHSITG--- 221
            +            K V+N + +A   QV L+V   EV R   ++IG   F  + +G   
Sbjct: 160 ATPP----EGKDPEKYVINAMRVAASQQVMLRVRFIEVSRQAEREIGVNWFGANASGTRG 215

Query: 222 --------SSSGPSKSFAA--------DFGGKFVSEGGDFSVKGVLDRF-SFETVLHALE 264
                   S +GP+ + A          F G  +S      +  + ++  S + ++ ALE
Sbjct: 216 INTGTGAISQAGPTATSAGVPVFNTIGTFAGSTLSAPFGVGLFNLANKGGSVDVLITALE 275

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYGVVLHFTPT 321
           +    R LAEP L A+SG +ASF +GG++   +V SS+G T V T     +GV L F PT
Sbjct: 276 KKGLARRLAEPDLVALSGDTASFLAGGEYPVPSVQSSSGTTPVITVLYKPFGVQLTFVPT 335

Query: 322 VLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD 377
           VL+ G I LR+   VSE      + ++   +P+   R+A T +EL  G +  +AGLL+ D
Sbjct: 336 VLASGIINLRLTPSVSELDYTNAVAISGTLVPALSKREARTAIELRDGQSFAIAGLLQSD 395

Query: 378 IQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAM-RDLSRPDDHYSV 436
             +    +P L  +P+LG LFR++ + ++ET++ +  TP LV P A  + L+ P D    
Sbjct: 396 NLRDVGQLPWLGSVPVLGTLFRSTSYQQKETDLVVIVTPHLVAPAAPGQALATPFDKQLP 455

Query: 437 EDDAKAFFFNR--VNKIY 452
            +D   F   R  V K Y
Sbjct: 456 GNDVDLFLMGRPEVRKQY 473


>gi|212635453|ref|YP_002311978.1| Flp pilus assembly protein [Shewanella piezotolerans WP3]
 gi|212556937|gb|ACJ29391.1| Flp pilus assembly protein [Shewanella piezotolerans WP3]
          Length = 479

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 121/428 (28%), Positives = 206/428 (48%), Gaps = 44/428 (10%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           +KI I  ++V++L+ PV    V V +P+ AD+ +     +Y+ GK +G  N+++   D +
Sbjct: 35  QKIPIFKSRVLMLEGPV--HRVSVGNPSIADIKLLPNDELYILGKQLGSTNIMIWDKDEQ 92

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
               +DI +  D+  L+  L  F+    + V+     ++L G    +Q    AVEL++ +
Sbjct: 93  LSKIMDIEVTHDLNGLKTRLHEFLPTEKLGVQTSQGQLLLSGQASNLQKMNTAVELAQGY 152

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS--- 224
              +       ++  +V+N++ I G+ QV L+V +AEV+R++ +Q   +  I        
Sbjct: 153 AEAAA----GGTAPSRVLNMMTIGGDHQVMLEVVVAEVQRNVARQFDSKFFIFNQGDHLA 208

Query: 225 --------------GPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIR 270
                         G           ++V+  GD  +   LD           ++    +
Sbjct: 209 GGVIGGGGGGFAPGGIGGVDGKGLFAQYVN--GDLLMNFALD---------VAKQNGLAK 257

Query: 271 TLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGL 330
            LAEP +TA+SGQSA F SGG+     V    G T+V   DYGV + F PTVL  G+I L
Sbjct: 258 VLAEPNVTAMSGQSAEFLSGGEFPIP-VPGENGNTTVEYRDYGVGVKFVPTVLDSGQINL 316

Query: 331 RIQTEVSE-------PVIGVNAGDM--PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
            +   VSE        + G  +  +  PS   R   TTVEL  G TI ++GL+ D +++ 
Sbjct: 317 NLNVVVSEISTANGFTISGNTSTSLVVPSLTKRSTATTVELADGQTIAISGLISDTLREN 376

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
            + +P L  +P+LG LF +  F   ++E+ I  TP LV+P    D+S P D + +  D +
Sbjct: 377 IDKLPGLGDVPVLGQLFTSKSFQNGQSELVILVTPRLVRPFNRNDISLPTDGFVLPSDVE 436

Query: 442 AFFFNRVN 449
            +   +++
Sbjct: 437 FYLLGKLS 444


>gi|157375508|ref|YP_001474108.1| flp pilus assembly protein, secretin CpaC [Shewanella sediminis
           HAW-EB3]
 gi|157317882|gb|ABV36980.1| flp pilus assembly protein, secretin CpaC [Shewanella sediminis
           HAW-EB3]
          Length = 483

 Score =  166 bits (421), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 114/417 (27%), Positives = 206/417 (49%), Gaps = 23/417 (5%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           +L++   +  V V +P   D+ +     +Y+ GK +G  N+++   + + +  +DI I  
Sbjct: 49  VLKLKQAIHRVSVGNPNIGDIKLLPNNELYVLGKKLGSTNIMVWDKNEQLVDVIDIEITH 108

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           D+  L+  L  F+    + V+     +++ G    +Q    AVEL++ +   +  ++  +
Sbjct: 109 DLNGLKTRLHEFLPGEKLGVQTSQGQLLISGQASNLQKMNTAVELAQAYADAASVSKVKS 168

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG-----FQHSITG--SSSGPSKSFA 231
           +    V+N++ + G+ QV L+V IAEV++++ +Q       F     G   ++G   +F 
Sbjct: 169 T----VLNMMTVGGDHQVMLEVVIAEVQKEVARQFDSKFFIFNKGDKGFIGTAGAGGTFD 224

Query: 232 ADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGG 291
            D      S G  F  + +         L   ++    + LAEP +TA+SGQSA F SGG
Sbjct: 225 LDPAAAIDSRG--FFARYLDGNLMMNFALDVAKQHGLAKVLAEPNVTAMSGQSAEFLSGG 282

Query: 292 QHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGD 347
           +     V  + G+T++   D+GV + F P+VL  G+I L +   VSE      + ++ G 
Sbjct: 283 EFPIP-VPGTNGSTTIQYRDFGVGVKFVPSVLDSGQINLNLNVMVSEVSNANSVTLSGGS 341

Query: 348 -----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
                +PS   R   TTVEL  G TI ++GL+ D +++  + +P L  IPILG LF +  
Sbjct: 342 NTALVVPSIVKRTTATTVELADGQTIAISGLISDTLRENIDKLPGLGDIPILGQLFTSKS 401

Query: 403 FNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASE 459
           F   ++E+ I  TP LV+P   + +S P D + +  D + +   +++     +E  E
Sbjct: 402 FQSGQSELVILVTPRLVRPFNKKQISLPTDDFVLPSDMEFYLLGKMSHKQSEQEKHE 458


>gi|19749313|gb|AAL98683.1| Y4xJ [Sinorhizobium fredii]
          Length = 411

 Score =  166 bits (421), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 119/384 (30%), Positives = 181/384 (47%), Gaps = 44/384 (11%)

Query: 60  LQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERD 119
           + +P     + V+DP  AD    S RT+++FGK  G+ ++  +  +G+ +  L +++ + 
Sbjct: 35  VHLPAPAATIFVADPPIADYQAPSNRTIFVFGKKFGRTSLFALDENGEALAELHVVVTQP 94

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANS 179
           I  L   LR  + D  I V       +L G     +    A  ++E FL           
Sbjct: 95  IGDLRAMLRDQVGDYPIHVSYTPRGAILSGTAPNAEVVDIAKRVTEQFLGDG-------- 146

Query: 180 SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFG---G 236
               ++N + +AG  QV L V +AEV R  LK +G   S  G   G  K    + G   G
Sbjct: 147 --APIVNNIKVAGSLQVNLSVRVAEVSRSSLKALGINLSAFGQF-GNFKVGVLNRGAGLG 203

Query: 237 KFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYK 296
                GG   +    D  S   VL AL +      LAEP LTA+SG++ASF +GG+    
Sbjct: 204 SATGSGGTAEIGFDNDAVSVGAVLDALAKEHIASVLAEPNLTAMSGETASFLAGGE---- 259

Query: 297 TVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYR 352
                                F PTVL    I + ++ EVSE      + VN   +P+  
Sbjct: 260 ---------------------FVPTVLDNNLINIHVKPEVSELSLQGAVQVNGIAVPAVS 298

Query: 353 VRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFI 412
            R+ADT VEL SG + V+ GL++ ++       P L +IPILGALFR+S F +EE+E+ I
Sbjct: 299 TRRADTVVELASGQSFVIGGLIRRNVNNDISAFPWLGRIPILGALFRSSSFQKEESELVI 358

Query: 413 AATPFLVKPVAMRD-LSRPDDHYS 435
             TP++V+P +  + +S P D  +
Sbjct: 359 LVTPYIVRPGSNPNQMSAPTDRMA 382


>gi|167836689|ref|ZP_02463572.1| RhcC2 [Burkholderia thailandensis MSMB43]
          Length = 460

 Score =  166 bits (420), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 126/431 (29%), Positives = 217/431 (50%), Gaps = 33/431 (7%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           +L++P     V ++DP  ADV V +P+++++ GK  G   +  +G + + +L   I++  
Sbjct: 47  MLKLPEPAGAVFIADPDVADVHVPTPQSVFVLGKKAGTTTLFALGSNNRTILRETIVVNA 106

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           D   L+  L     + ++ +     ++++ G V +  D+   V+  + +L +        
Sbjct: 107 DTPTLQRILDARFPNLHLTLTSAPGSLMVAGHVPSPSDADAVVQTLKPYLHEK------- 159

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKF 238
              + ++N + +A   QV L+V + E+ R+I +Q+G   S  G+S          F G+ 
Sbjct: 160 ---ETLVNRMTLARPIQVHLRVRVTEIDRNITQQLGINWSAIGASG---NFVGGLFNGRT 213

Query: 239 V----------SEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPTLTAISGQSAS 286
           +          S  G FSV G     R+S + VL AL++   I  LAEP LT +SG++AS
Sbjct: 214 LFDPTSRLFNLSPTGAFSVLGGFHTSRYSVDGVLDALDQEGLITMLAEPNLTTMSGETAS 273

Query: 287 FTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PVIGV- 343
           F +GG+        +TGA ++    +GV L FTPTVL+  RI L+++ EVSE  PV  V 
Sbjct: 274 FLAGGEFPIPVSQDTTGAITIEFKPFGVSLDFTPTVLADNRISLKVRPEVSEIDPVNSVT 333

Query: 344 -NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
            N   +P+  VR+ +TTVEL SG +  + GLL+     +   +P L+++P+LG LF +  
Sbjct: 334 SNGIRVPALTVRRVETTVELSSGQSFAIGGLLQSKTSDVLAELPGLARLPVLGKLFSSKN 393

Query: 403 FNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEG 462
           +  ++TE+ +  TP++V+PV   +L    D  +       +   R   I    +    + 
Sbjct: 394 YLNDKTEVVVIVTPYVVQPVGPGELRDALDSVTQPSSDIEYVLQRAIGI----DPLSGDL 449

Query: 463 QNYKGAIGFIY 473
               GA GFIY
Sbjct: 450 PRLVGAAGFIY 460


>gi|209546483|ref|YP_002278401.1| type II and III secretion system protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209537727|gb|ACI57661.1| type II and III secretion system protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 495

 Score =  166 bits (419), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 127/428 (29%), Positives = 209/428 (48%), Gaps = 42/428 (9%)

Query: 42  VEIGKG-KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
           V +GK  +++++  N  + L       D+++      DVV  S +++++ GK +G  N+ 
Sbjct: 42  VTLGKSVQRVTLPPNATLTLNTGQAFGDLVIGSADMIDVVPLSDKSLFIRGKKIGATNIS 101

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           + G D   +  +D+ +  D + +   +R     + + V   SD + L G+VR   + QR 
Sbjct: 102 VYGDDKSLLGVIDVRVASDFSEVAAAIRSAAPSARVIVANSSDRIRLTGIVRDGVELQRV 161

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           +++++++            S + V+N L ++   QV L+V + E  R   + +G   S  
Sbjct: 162 MDIAQSY------------SDQPVLNQLRVSDSQQVMLEVRVIEASRQTGRDLGIGWSGR 209

Query: 221 GSS----SGPSKSFAADFGGKFV--------SEGGDFSVKGVLDRF------SFETVLHA 262
           G++    +  S+    D  G  V        +  G      ++ +         + V++A
Sbjct: 210 GNNGIGKATTSQGLGVDDNGSLVRTLVDPKGAATGALPFGQLIAKVLEISGGHIDVVINA 269

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQH--LYKTVSSSTGATSVTTHDYGVVLHFTP 320
           LE+   +R LA+P L A+SG +ASF +GG+   L  T + +T AT      +GV L F P
Sbjct: 270 LEQKGLVRRLAQPNLIAMSGSTASFHAGGEVPILKTTNNGTTVATETDYRPFGVRLTFKP 329

Query: 321 TVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD---- 376
            VL  G I L I+ EVSE    +N    P +  R A TTV L  G +  LAGLL+     
Sbjct: 330 VVLDDGLINLEIEPEVSELDPSINVNGNPGFISRAASTTVALRDGQSFALAGLLQSINAK 389

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV-AMRDLSRPDDHYS 435
           DIQQL    P L KIPILGALFR++ F ++E+++ I  TP +V+P     DL  P D   
Sbjct: 390 DIQQL----PGLGKIPILGALFRSTSFQKKESDLVIVVTPHIVRPARPGEDLYSPLDQTR 445

Query: 436 VEDDAKAF 443
             +D + F
Sbjct: 446 SSNDVELF 453


>gi|114799407|ref|YP_759869.1| type II/III secretion system protein [Hyphomonas neptunium ATCC
           15444]
 gi|114739581|gb|ABI77706.1| type II/III secretion system protein [Hyphomonas neptunium ATCC
           15444]
          Length = 432

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 125/390 (32%), Positives = 189/390 (48%), Gaps = 34/390 (8%)

Query: 69  VLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLR 128
           ++V+DP  A+ +  S R+ ++ GK  G   V++    G     +++ ++  +  L   L 
Sbjct: 55  IVVADPEIAEAMPTSNRSFFVRGKKPGGTTVLIYDEAGAIAELIEVEVKLGLDELRGDLG 114

Query: 129 RFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLL 188
           R +    I V  V D V L G V T   +  A++L+E  +               V N L
Sbjct: 115 RLLPGEIIDVYAVHDGVYLDGKVTTAAAADMALQLAERHVPGG------------VANGL 162

Query: 189 NIAGEDQVTLKVTIAEVRRDILKQIGFQHSI------TGSSSGPSKSFAADFGGKFVSEG 242
           ++    QV L+V   E  R  +++IGF ++I       G+  G            F + G
Sbjct: 163 SVGQSQQVMLEVRFLEASRKAVREIGFGNTIDANDVVAGTEGGTVSGLLEKTLAVFTNVG 222

Query: 243 GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST 302
           G+          + +  L ALE    IRTLAEP L A+SG +ASF +GG+     VSS  
Sbjct: 223 GE----------NIDVSLRALEEKGVIRTLAEPNLVALSGDTASFLAGGEFPIP-VSSRD 271

Query: 303 GATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGVNAG--DMPSYRVRKADT 358
              +V    +GV L FTPTVL  G + LR++ EVS  +   G+ A   D+P   VR+ADT
Sbjct: 272 NEVTVEFKKFGVSLDFTPTVLGDGLVNLRVRPEVSALDRGNGIRASNIDIPGVSVRRADT 331

Query: 359 TVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFL 418
           TVEL  G    +AGLL+++        P L  +PILG+LF + R+ R ETE+ I  TP L
Sbjct: 332 TVELHDGQAFAIAGLLQNNYTNDVRQTPWLGNVPILGSLFSSKRYQRNETELVIIVTPRL 391

Query: 419 VKPVAMRD-LSRPDDHYSVEDDAKAFFFNR 447
           V+P +  + +  P D  S   +A+ F   +
Sbjct: 392 VQPFSHPEAIVSPLDSVSEPTEAELFLLGK 421


>gi|170692564|ref|ZP_02883726.1| type II and III secretion system protein [Burkholderia graminis
           C4D1M]
 gi|170142220|gb|EDT10386.1| type II and III secretion system protein [Burkholderia graminis
           C4D1M]
          Length = 614

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 124/420 (29%), Positives = 212/420 (50%), Gaps = 33/420 (7%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + + + K  ++Q    V++  + +P  A   + SP+T+Y+ G  VG  N+I+ G  G   
Sbjct: 91  VVVPVGKSTLMQTAEPVRNRTLGNPLIAQATMVSPKTLYVVGMAVGTTNMIVQGKSGACE 150

Query: 110 LNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +++++  D   L+ +L + + D  NIRV  V+  +VL G V + Q + +A E+++ + 
Sbjct: 151 V-INVVVNADAGGLQTSLSQLMPDEPNIRVSTVAGDLVLAGRVSSAQAAAQAQEIAKAYA 209

Query: 169 SQS------GRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGS 222
             +        N   N  S  V+N++++    QV L+V +AEV + +L Q+G   +I G 
Sbjct: 210 RTTLPNPNGAANGNGNGKSATVLNMMSVDSPQQVMLEVKVAEVSKTVLNQLGAAMNIQGG 269

Query: 223 SSGPSKSFAADFGGKFVSE--GGDFSVKGV--LDRFSFETVLHALERATAIRTLAEPTLT 278
                  F + + G  +S    G  S+  V   +   F   + A      ++ LAEP L 
Sbjct: 270 -------FGS-WSGALISSLLAGVSSIVDVNKANNRPFNVAIDAQHGDNLVKILAEPNLV 321

Query: 279 AISGQSASFTSGGQHLYKTVSSSTGATS---VTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            +SGQ A+F +GG+       S+    S   +   ++GV L FTPTVL+ GRI L++  E
Sbjct: 322 TLSGQEATFLAGGKVFIPIPQSNLNGVSTIILQEEEFGVGLKFTPTVLAGGRINLKVAPE 381

Query: 336 VSE-PVIGVNAGD--------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           VSE    GV  G         +P    R+A TTV++  G T  + GL+K +     + IP
Sbjct: 382 VSELSSTGVTVGATNTNNLTVLPLITTRRASTTVQMNDGETFAIGGLIKSNAAGTLKAIP 441

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV-AMRDLSRPDDHYSVEDDAKAFFF 445
            + ++P+LGALFR++ + ++ TE+    TP LVKP+    +L  P DH    ++A  +  
Sbjct: 442 GVGEVPVLGALFRSTSYQQDRTELVFIITPHLVKPLQTASNLPLPTDHLKTPNEADVYLM 501


>gi|323700359|ref|ZP_08112271.1| type II and III secretion system protein [Desulfovibrio sp. ND132]
 gi|323460291|gb|EGB16156.1| type II and III secretion system protein [Desulfovibrio
           desulfuricans ND132]
          Length = 476

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 118/426 (27%), Positives = 207/426 (48%), Gaps = 47/426 (11%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
           V+  K   IS+ + +  ++    +V  + +   T   +VV SP  +YL    +G   + L
Sbjct: 31  VKSDKPDMISMIIGESTVITTDQNVSRITLGSDTVCSIVVISPTQIYLTANEIGSTTLTL 90

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
              D    +  DI ++ D   L+  +   +  ++N+RV    +++ L G V         
Sbjct: 91  WTGDRVSEI-YDIAVDPDTTRLKRMIYELLPQENNVRVLTSGNSITLSGQVSNATSLSSV 149

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           + L+E             ++  +V+NLL++ G  QV L+V +AE+ R + K++G   +  
Sbjct: 150 LSLAEA------------AAPGRVVNLLSVDGIQQVMLEVRVAEMSRSVTKRLGLNFAAI 197

Query: 221 GSS-------------SGPSKSFAA----DFGGKFVSEGGDFSVKGVLDRFSFETVLHAL 263
           GS+             +     F      +  G +VS  G+ ++ G++D         AL
Sbjct: 198 GSNFSIYSIINNLTSYNNEDNVFELTDNINLAGSYVS--GNTTIHGMVD---------AL 246

Query: 264 ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVL 323
           +    +R LAEP LT +SG++A F  GG+ +   + S+ G   +    +G+ L FT TV+
Sbjct: 247 KSNGLVRMLAEPNLTCVSGEAAEFLVGGE-VPIPMPSALGTVGIDYKPFGIALKFTATVM 305

Query: 324 SPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQ 379
           S GRI L++  EVSE      + V+  ++P+   R+A+T VEL  G + V+AGL+ D ++
Sbjct: 306 SSGRINLQVNPEVSELDYSKALSVSGYEIPTISTRRANTVVELGDGQSFVIAGLISDSLK 365

Query: 380 QLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDD 439
           +     P L ++P+LG+LF +  FN  +TE+ +  T  L KPV M   + P D +   DD
Sbjct: 366 ENAHKFPGLGEVPVLGSLFSSKDFNSNKTELVVLVTAHLAKPVDMATQTLPTDGFREPDD 425

Query: 440 AKAFFF 445
            + + F
Sbjct: 426 REFYLF 431


>gi|261252087|ref|ZP_05944660.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio orientalis CIP 102891]
 gi|260935478|gb|EEX91467.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio orientalis CIP 102891]
          Length = 480

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 127/431 (29%), Positives = 214/431 (49%), Gaps = 33/431 (7%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
           GK +++  +K   + +    + V + DP   D+V+     ++L GK +G  N++     G
Sbjct: 18  GKIVTVPHHKSTHVTLAGKAKRVSLGDPDVLDIVMLKSDEVFLIGKKLGSTNLMAWDSRG 77

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           + + +++I +  D+  L+  L  F+ D  I+V      ++L G V +      A+ ++ET
Sbjct: 78  QLIESINIEVTHDLNSLKAKLFEFLPDEEIKVHSAQHRLILSGQVSSQSVMNIALRVAET 137

Query: 167 FLS----QSGRNQYANS-SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI-------- 213
           + +      G++  +N  +S  V+NLL I G  QV L+VT+AEV+R ++++         
Sbjct: 138 YSAGKEADKGKSSLSNQVNSTGVINLLTIGGAQQVMLEVTVAEVQRTLVRKFDANFHFFQ 197

Query: 214 --GFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRF-----SFETVLHALERA 266
             G + S  G+S+G       +  G   +  G  S  G+L  F      F   L   ++ 
Sbjct: 198 TSGGEFSWGGTSAGGVIDDVNNVIGPIFNAPGVEST-GLLGTFIDSNTLFTFALDIAKQN 256

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
              + LAEP LTA+SG  A F +GG+     V S  G T +   +YGV L F PTVLS  
Sbjct: 257 GTAKVLAEPNLTALSGAKAEFLAGGEFPIP-VPSEDGIT-IEYKEYGVGLKFIPTVLSDK 314

Query: 327 RIGLRIQTEVSE----PVIGVNAGD------MPSYRVRKADTTVELPSGGTIVLAGLLKD 376
           +I L +  +VSE      + +N G       +P    R A +T+EL  G TI +AGLL +
Sbjct: 315 KINLNLAVDVSELATSTTLTLNPGATNGTYVIPPITRRSASSTLELADGQTIGIAGLLSE 374

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSV 436
           +++ + E +P  S IP+LG +F +  +   ETE+ I  TP L KP+  R ++ P + +  
Sbjct: 375 NVRDVVEEMPGFSDIPVLGQMFNSQEYISGETELVILVTPRLAKPIDRRRITLPTESFVE 434

Query: 437 EDDAKAFFFNR 447
            +D + +   R
Sbjct: 435 PNDFEYYLLGR 445


>gi|238789148|ref|ZP_04632936.1| Type II/III secretion system protein [Yersinia frederiksenii ATCC
           33641]
 gi|238722680|gb|EEQ14332.1| Type II/III secretion system protein [Yersinia frederiksenii ATCC
           33641]
          Length = 415

 Score =  164 bits (414), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 112/380 (29%), Positives = 192/380 (50%), Gaps = 28/380 (7%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           I+    ++  V VS    AD  +    ++ ++ KN G A   L  HD K +    +L+  
Sbjct: 21  IINTQDEINTVFVSAAAIADYELIGKNSIIVYAKNEGVAEFTLFNHDHKAITKSVVLVNN 80

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL-SETFLSQ---SGRN 174
            I  +   ++    +SNI +  +  + +L G+V + +     V +  E   S+   + R+
Sbjct: 81  IIPSVHRRIQAEYPESNIDINKIGSSYILTGLVESEEVRDTVVNIIGEAIGSKRINNDRH 140

Query: 175 QYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADF 234
              N++   ++N + ++  +QV +K+TIAEV +D  + IG   S  G S G  + F    
Sbjct: 141 PVGNTNHTNIINKIKLSQSNQVNVKLTIAEVTKDFTENIGINWSTIGESVGSFQLF---- 196

Query: 235 GGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHL 294
                     F+ KG+       T++HA+      R LAEP L+ +SG+ ASF  GG+  
Sbjct: 197 ---------KFNAKGI------STLVHAINDNAIARVLAEPNLSVLSGEDASFLVGGE-- 239

Query: 295 YKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PVIGVNAGD-MPSY 351
              V+++   ++V+  ++G+ L+    V    RI + +  EVS       +N GD  PS 
Sbjct: 240 IPIVNTTQNGSAVSYKEFGIKLNIGAKVNDKKRIRIILNEEVSSIGKTFNINGGDSYPSI 299

Query: 352 RVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIF 411
           R RKA TT+EL  G + +L GL+  + ++  + IPL+  IP+LGA FRN++  + +TE+ 
Sbjct: 300 RTRKAATTLELGDGESFILGGLISRNERESLKKIPLMGDIPLLGAFFRNAQTEQSQTELV 359

Query: 412 IAATPFLVKPVAMRDLSRPD 431
           + AT  LV PVA +++  PD
Sbjct: 360 VIATVNLVNPVAEKEVELPD 379


>gi|319940440|ref|ZP_08014785.1| type II and III secretion system protein [Sutterella wadsworthensis
           3_1_45B]
 gi|319806066|gb|EFW02815.1| type II and III secretion system protein [Sutterella wadsworthensis
           3_1_45B]
          Length = 530

 Score =  163 bits (413), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 128/464 (27%), Positives = 210/464 (45%), Gaps = 77/464 (16%)

Query: 54  LNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLD 113
           L +  +LQ+P     VLV+ P  A   + SP  ++ FG   G      +   G  +  + 
Sbjct: 80  LKEGALLQLPSAAAKVLVATPGIASYQMPSPDQVFFFGTAAGSTTFYALDEAGAVIAAVQ 139

Query: 114 ILIERDIAHLEMTLRRFIADSNIR-VEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSG 172
           + +E ++  L+  ++R +  ++I  V  +++ +++ G V+T  DS+R  +L E++L  S 
Sbjct: 140 VTVEHNLEKLKADIKRAVPSASIELVPALNNRMIVRGKVKTALDSRRVTQLVESYLVSSA 199

Query: 173 ------------------RNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
                             +   A   S  V+N L +    QV ++V + EV R +   +G
Sbjct: 200 AAGGPGQGSQQGGQDGGGQGGSAGGQSSPVINQLKVEVSQQVNIQVRVVEVSRSLTHSLG 259

Query: 215 FQ-------------------------HSITGSSSGPSKSFA----------ADFGGKFV 239
           F                          H+   S   P+ SFA           D      
Sbjct: 260 FNWGAVLNTGRGPLFLGNGTSQGLFSTHAANNSHFNPNDSFADGNANIPGLMPDSNTAGA 319

Query: 240 SEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVS 299
           + GG F+    + R S   +++A+  +     LAEP LTA+SGQ A+F SGG+     ++
Sbjct: 320 ALGGIFN----MGRMSLGVLINAMSESGFASLLAEPNLTAMSGQPAAFASGGEVPIVIIT 375

Query: 300 SSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE-----PVIGVNAGDMPSYRVR 354
            ++   ++    +GV+L  TPTVLSP RI + +  EVSE      VI      +P+ RVR
Sbjct: 376 GNS--ITIDYKSWGVILRMTPTVLSPNRIAIHVAPEVSELTSEGQVILSEGSVIPAVRVR 433

Query: 355 KADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAA 414
           +A+TTVEL SG +  LAG+L+ +  Q   G+P L  +P +G LF   +   E++E+ I  
Sbjct: 434 RAETTVELASGQSFALAGMLRSESSQTVNGVPGLRNLPFVGRLFEYEQTQVEDSELVILL 493

Query: 415 TPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEAS 458
           T  +V PV+  DL  P    +  D             Y P++AS
Sbjct: 494 TANIVDPVSSGDLRVPGRGINAVDA------------YAPRQAS 525


>gi|148976662|ref|ZP_01813349.1| Flp pilus assembly protein, secretin CpaC [Vibrionales bacterium
           SWAT-3]
 gi|145964013|gb|EDK29271.1| Flp pilus assembly protein, secretin CpaC [Vibrionales bacterium
           SWAT-3]
          Length = 456

 Score =  163 bits (413), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 120/416 (28%), Positives = 204/416 (49%), Gaps = 27/416 (6%)

Query: 69  VLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLR 128
           V + DP   D+V+     ++L GK +G  N++     G+ + +++I +  D+  L+  L 
Sbjct: 18  VSLGDPEVLDIVILKSNEVFLIGKKLGATNLMAWDARGQLIESINIEVTHDLNSLKAKLY 77

Query: 129 RFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKK----- 183
            F+ D  I V    + ++L G +   Q    A+ ++ET+ +    ++   S S++     
Sbjct: 78  EFLPDETIEVHSAQNRLLLSGQISNQQKMNVAMRIAETYAAGQAADETKESGSEQAAATG 137

Query: 184 VMNLLNIAGEDQVTLKVTIAEVRRDILKQIG-----FQHSITGSSSGPSKSFAADFGGKF 238
           V+NL++I G  QV L+VT+AEV+R ++++       FQ S +  S G +   A   G   
Sbjct: 138 VINLMSIGGAQQVMLEVTVAEVQRSLVRKFDANFHFFQTSGSNFSWGGASVPAGVLGATP 197

Query: 239 VSEGGDFSVKGVLDRF-----SFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQH 293
           + +    +  G+L  F      F   L   ++    + LAEP LTA+SG  A F +GG+ 
Sbjct: 198 IFDIPTSTDYGILGSFIDSNTLFTFALDVSKQNGVAKVLAEPNLTALSGSKAEFLAGGEF 257

Query: 294 LYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGD-- 347
               V    G T +   +YGV L F PTVLS  +I L +  +VSE      + ++ G   
Sbjct: 258 PIP-VPDDDGIT-IEYKEYGVGLKFIPTVLSDQKINLNLAVDVSEIANSSSLTIDPGTTN 315

Query: 348 ----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRF 403
               +P    R A +T+EL  G TI +AGLL ++++ +   +  +  +PILG LF +  +
Sbjct: 316 ATYFIPPITRRSASSTLELADGQTIGIAGLLSENVRDISNKMLGIGDVPILGQLFNSQEY 375

Query: 404 NREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASE 459
              ETE+ I  TP L KPV    ++ P D +   +D + +   R   I  P ++ +
Sbjct: 376 VSGETELVILVTPRLAKPVDRSKVTLPTDAFVDPNDLEYYLLGRSAYIAEPSDSED 431


>gi|288956969|ref|YP_003447310.1| pilus assembly protein [Azospirillum sp. B510]
 gi|288909277|dbj|BAI70766.1| pilus assembly protein [Azospirillum sp. B510]
          Length = 491

 Score =  162 bits (411), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 122/443 (27%), Positives = 209/443 (47%), Gaps = 38/443 (8%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + +G ++++ L  P    +V V+DP  ADV   S   +++ G+  G+  V  +    + +
Sbjct: 68  LDVGTSEMVRLSAPAT--NVYVADPEIADVQAASGTVIFVLGRKPGRTTVYALTEGDRVV 125

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
           L+ DI +   +A L   +        + V    + +++ G V T   ++  +EL   F  
Sbjct: 126 LHRDIRVIHSLAPLREQITARFPGMPVTVTSAPNRLIVTGEVPTPAIAESVMELVNGFAR 185

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKS 229
                        KV+N + + G  QVTL+V +AEV R + +++GF     G+      +
Sbjct: 186 ----------PDDKVVNQMAVTGPVQVTLRVQVAEVARSVTQELGFNWE--GAVKIGDFA 233

Query: 230 FAADFGGKFV---------SEGGDFSVKGVLD----RFSFETVLHALERATAIRTLAEPT 276
            A  FG  F+         S  G  S+ G+L     + +   ++ A++    +  LA+P 
Sbjct: 234 IAPGFGRDFLNATSGAIQRSATGASSLAGILKSSNGKANIAGIVDAMQDQGLVTLLAQPN 293

Query: 277 LTAISGQSASFTSGGQHLYKTVSSSTGATSVTTH--DYGVVLHFTPTVLSPGRIGLRIQT 334
           L A+SG+ A F +GG+      +  +G+  +      YGV L+F PTVL+P RI L ++ 
Sbjct: 294 LVAMSGKPAMFLAGGEFPIPVSAGDSGSNKIQVEFKQYGVALNFVPTVLAPDRIALTVRP 353

Query: 335 EVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSK 390
           EVSE      + VN   +P+  VR+ +T+VEL SG +  + GLL++  +   +  P L  
Sbjct: 354 EVSELTDVGAVTVNGLTIPALTVRRVETSVELGSGESFAIGGLLQNSNRSSLKKFPGLGD 413

Query: 391 IPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNK 450
           +P+LG LFR+ RF   ETE+ +  TP++V P+       P        + +     R   
Sbjct: 414 LPVLGELFRSRRFINNETELVVIVTPYVVNPIQRGPGVIPQRGTKPNREVEELLRRRQQA 473

Query: 451 IYGPKEASEVEGQNYKGAIGFIY 473
           +  P+ A      +Y G  GFIY
Sbjct: 474 LGLPEPAG-----SYYGPAGFIY 491


>gi|149909547|ref|ZP_01898201.1| general secretion pathway protein D [Moritella sp. PE36]
 gi|149807452|gb|EDM67403.1| general secretion pathway protein D [Moritella sp. PE36]
          Length = 432

 Score =  162 bits (411), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 119/386 (30%), Positives = 198/386 (51%), Gaps = 40/386 (10%)

Query: 65  DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
           ++  V ++DP  AD  V     + +FGK +G  ++I+   +G  + N  ++I + + H++
Sbjct: 30  EIASVFIADPEIADYQVIDANKVVVFGKKIGSTSIIVFDENGDTITNNKLVINKSLVHIQ 89

Query: 125 MTLRRFIADSNIRVEMVSDTVVLHGMVRTIQD------------SQRAVELSETFLSQSG 172
             ++    ++++ +  V D VVL G+V T Q+            ++++ +    + S   
Sbjct: 90  QQIQLKYPNADVTIYNVGDQVVLSGIVATEQEKDDINIIVGELLNKKSDDYIIQWESTGT 149

Query: 173 RNQYANSSSKK-----VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
             +Y     K+     ++N + +A   QV +K++IAEV    L+  G ++S  G +SG  
Sbjct: 150 DTKYEMEFMKRRHFAGIVNNIEVAAVKQVNVKLSIAEVSHSFLENFGIEYSSIGQTSGT- 208

Query: 228 KSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASF 287
                     FV+    FS   +       +V+ A+   +  + LAEP L+ ISG+SASF
Sbjct: 209 ----------FVNLVTKFSASDI------ASVITAIADDSVGQILAEPNLSVISGESASF 252

Query: 288 TSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAG- 346
             GG+     V+   G T+V   +YGV L     VL   +I L +  EVS      ++G 
Sbjct: 253 LVGGE--LPVVTVVDGTTNVLYKEYGVRLSLMAKVLRDDKIILSLSPEVSTLDNQYSSGT 310

Query: 347 -DMPSYRVRKADTTVELPSGGTIVLAGLLK-DDIQQLKEGIPLLSKIPILGALFRNSRFN 404
            ++P+ + R+A TTVEL  G + VLAGLL  +D++ +K+ IP L  IPILGALFR+S   
Sbjct: 311 YNLPALKTRRARTTVELGDGQSFVLAGLLNTEDVESIKK-IPFLGDIPILGALFRSSSTQ 369

Query: 405 REETEIFIAATPFLVKPVAMRDLSRP 430
           R +TE+ I AT  LVKP+    +  P
Sbjct: 370 RNKTELIIVATVNLVKPIHASQVQLP 395


>gi|260771478|ref|ZP_05880403.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio furnissii CIP 102972]
 gi|260613604|gb|EEX38798.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio furnissii CIP 102972]
 gi|315181060|gb|ADT87974.1| Flp pilus assembly protein, secretin CpaC [Vibrio furnissii NCTC
           11218]
          Length = 489

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 122/440 (27%), Positives = 211/440 (47%), Gaps = 34/440 (7%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
           GK +++  +K   +++      V + DP   D+V+     ++L GK +G  N++     G
Sbjct: 25  GKVVTVPHHKSTYVKLQGAASRVSLGDPEVLDIVMLKADELFLIGKRLGSTNLMAWDRRG 84

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           + + +++I +  D+  L+  L  F+ +  I V    + ++L G V + +    A+ L+ET
Sbjct: 85  QLLESINIEVTHDVNSLKAKLYEFLPNETISVHSAQNRLILSGQVSSQEKMNLALRLAET 144

Query: 167 FLSQSGRNQYANSSSKK-----VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG 221
           + S    ++  +S +K+     V+NL++I G  QV ++VT+AEV+R ++++  F  +   
Sbjct: 145 YASGDTADKATDSRNKEAEKTGVVNLMSIGGAQQVMIEVTVAEVQRSLVRR--FDSNFHF 202

Query: 222 SSSGPSKSFAADFGGKFVSE-----GGDFSV-----KGVLDRF-----SFETVLHALERA 266
                  S+ A   G ++ +     G  F+       G+L  F      F   L   +  
Sbjct: 203 FEGNGKFSWGATSAGGYIDDITGVAGPVFNAPTIDSTGLLSTFIDGDTLFTLALDVAKEN 262

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
              + LAEP LTA+SG  A F +GG+  +     +    ++   +YGV L F PTVLS  
Sbjct: 263 GVAKVLAEPNLTALSGAKAEFLAGGE--FPIPVPNRDGITIEYKEYGVGLKFIPTVLSDK 320

Query: 327 RIGLRIQTEVSEPVI---------GVNAGD-MPSYRVRKADTTVELPSGGTIVLAGLLKD 376
           +I L +  +VSE            G NA   +P    R A +T+EL  G TI +AGLL +
Sbjct: 321 KINLNLAVDVSEIASSTTLTVSPSGTNAAYYIPPITRRSAASTLELADGQTIGIAGLLSE 380

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSV 436
           +++      P +  IP+LG LF +  +   ETE+ I  TP L KP+    +  P D +  
Sbjct: 381 NVRDSVSKFPGIGDIPVLGQLFNSQEYVSGETELVILVTPRLAKPIDRSKVVLPTDAFVE 440

Query: 437 EDDAKAFFFNRVNKIYGPKE 456
             D K +   +   I GP++
Sbjct: 441 PTDLKYYLLGQGAYIAGPRD 460


>gi|86360580|ref|YP_472468.1| cpaC pilus assembly Q protein [Rhizobium etli CFN 42]
 gi|86284682|gb|ABC93741.1| cpaC pilus assembly Q protein [Rhizobium etli CFN 42]
          Length = 495

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 127/421 (30%), Positives = 206/421 (48%), Gaps = 41/421 (9%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           + +++  N+ + L       D+++      DVV  S +++++ GK  G  N+ + G D  
Sbjct: 49  QHVTLPPNETLTLNTGQPFGDLVIGSADMIDVVPLSDKSLFIRGKKTGATNISVYGDDKS 108

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
            +  +DI +  D + +   +R     + +RV   +D + L G VR   + QR +E+++++
Sbjct: 109 LLGVIDIRVASDFSEVASAIRSAAPSARVRVINSNDRIRLTGFVRDGIELQRVMEIAQSY 168

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS---- 223
                       S + V+N L ++   QV L+V + E  R   + +G   S  G++    
Sbjct: 169 ------------SDQPVLNQLRVSDSQQVMLEVRVIEASRQTGRDLGIGWSGYGNNNRIG 216

Query: 224 -SGPSKSFAADFGG--------KFVSEG----GDFSVKGV-LDRFSFETVLHALERATAI 269
            +  S+  A D G         K  + G    G    K + +     + V++ALE+   +
Sbjct: 217 KATTSQGIAVDDGSLARTLLDPKGAATGALPFGQLIAKVLEISGGHIDVVINALEQKGLV 276

Query: 270 RTLAEPTLTAISGQSASFTSGGQH--LYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGR 327
           R LA+P L A+SG +ASF +GG+   L  T + +T AT      +GV L F P VL  G 
Sbjct: 277 RRLAQPNLIAMSGSTASFHAGGEVPILKTTNNGTTVATETDYRPFGVRLTFKPVVLDDGL 336

Query: 328 IGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD----DIQQLKE 383
           I L I+ EVSE    +N    P +  R A TTV L  G +  LAGLL+     DIQQL  
Sbjct: 337 INLEIEPEVSEIDPSINVNGNPGFISRAASTTVALRDGQSFALAGLLQSINAKDIQQL-- 394

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV-AMRDLSRPDDHYSVEDDAKA 442
             P L +IP+LGALFR++ F ++E+++ I  TP +V+P     DL  P D     +D + 
Sbjct: 395 --PGLGQIPVLGALFRSTSFQKKESDLVIVVTPHIVRPARPGEDLYSPLDQTRSSNDVEL 452

Query: 443 F 443
           F
Sbjct: 453 F 453


>gi|209809170|ref|YP_002264708.1| type II/III secretion system protein [Aliivibrio salmonicida
           LFI1238]
 gi|208010732|emb|CAQ81123.1| type II/III secretion system protein [Aliivibrio salmonicida
           LFI1238]
          Length = 445

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 118/388 (30%), Positives = 198/388 (51%), Gaps = 36/388 (9%)

Query: 60  LQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERD 119
           + V  D+  V +SDP  AD  V   R + ++GK++G ++V++ G  G  + N  I++ + 
Sbjct: 40  ISVEQDISSVFLSDPKIADYQVIDKRKIVIYGKSIGSSSVLIFGEKGNTLSNKKIMVNKS 99

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQD--------------SQRAVELSE 165
           +A ++  +     D+ + +  V + VVL+G V T Q+              S++  +  +
Sbjct: 100 LATIQQYISVKYPDTAVDIFNVGEQVVLNGTVSTEQEKDEINGIVGELLEKSRKDFQFEQ 159

Query: 166 TFLSQSGRNQYANSSSKK-VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS 224
               Q    Q+      + V+N + +A   QV +K++IAEV +  L+QIG Q+   G+S 
Sbjct: 160 DMEDQDYEIQFMERHEYEGVVNNIVVATTKQVNVKISIAEVSQSFLEQIGIQY---GTS- 215

Query: 225 GPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
                  A   G FV     FS   ++      +V+ A+   +  + LAEP L+ ISG+S
Sbjct: 216 -------ASVPGVFVQPLTSFSSSDIM------SVITAIGNDSVGQILAEPNLSVISGES 262

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIG 342
           ASF  GG+     V++   +T+V   ++GV L     V    +I L +  EVS  +    
Sbjct: 263 ASFLVGGE--LPVVTTVNNSTNVVYKEFGVRLDLMAKVKKDDKITLSLVPEVSSLDTQYE 320

Query: 343 VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
            ++ ++P+ + R+A TTVEL  G + VL GLL  + ++  + +P +  IPILGALFRNS 
Sbjct: 321 NDSYNLPALKTRRARTTVELGDGQSFVLGGLLNSEDKESLQKVPFIGDIPILGALFRNSV 380

Query: 403 FNREETEIFIAATPFLVKPVAMRDLSRP 430
             R +TE+ I AT  LV+P+    +  P
Sbjct: 381 TQRNKTELIIVATVNLVQPIHPSQIQLP 408


>gi|197106459|ref|YP_002131836.1| pilus assembly protein CpaC [Phenylobacterium zucineum HLK1]
 gi|196479879|gb|ACG79407.1| pilus assembly protein CpaC [Phenylobacterium zucineum HLK1]
          Length = 484

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 122/406 (30%), Positives = 200/406 (49%), Gaps = 32/406 (7%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
           VE GKG+        +I L  P     V ++DP  ADV V SP  +Y+ GK  G  ++  
Sbjct: 39  VEAGKGR--------LIRLDRPAAT--VFIADPKIADVQVKSPTLVYVLGKAPGATSLFA 88

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           +    + + +L + +  D A L+  L+R   +S I+VE V   ++L G   +  +    +
Sbjct: 89  LDAGERMIADLAVNVGIDTARLDQALKRHAPNSQIQVESVDGALILSGKAGSAAEGADIL 148

Query: 162 ELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG------- 214
            ++  F+   G      + + +++N + +   +Q+ L V +AEV +   + +G       
Sbjct: 149 RIAAEFVPGEG-----EARAGRLINRIVVEQPNQINLHVRVAEVSKQAREVLGVNWDAMG 203

Query: 215 -FQHSITGSSSGPSKSFAADFGGKFVSE--GGDFSVKGVLD-RFSFETVLHALERATAIR 270
                + G ++G  + F      +  S   G D  V    D       ++ AL++   ++
Sbjct: 204 LLGEGMVGLATG-RQIFTNPASRETFSRLNGTDTIVGSYQDGDLDLNVLVDALKQKGLVK 262

Query: 271 TLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGL 330
            LAEP LTA+SG+ ASF +GG++            ++    +GV L F  TVL  GRI L
Sbjct: 263 VLAEPNLTAVSGEPASFLAGGEYPIPVPQRGEDLITIDYKQFGVSLSFVATVLDGGRISL 322

Query: 331 RIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
            ++ EVS+      I V    +P+   R+A+TTVEL SG +  +AGLL++   +    +P
Sbjct: 323 NVRPEVSQLSEAGAITVQGLTVPALTTRRAETTVELGSGQSFAIAGLLQNTSNETLRKLP 382

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDD 432
            L  IP+LG LFR+  F + E+E+ I  TP+LVKP A R L+ P D
Sbjct: 383 GLGDIPVLGNLFRSKEFQKNESELVIIVTPYLVKP-ASRTLATPAD 427


>gi|209515951|ref|ZP_03264812.1| type II and III secretion system protein [Burkholderia sp. H160]
 gi|209503609|gb|EEA03604.1| type II and III secretion system protein [Burkholderia sp. H160]
          Length = 431

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 109/386 (28%), Positives = 192/386 (49%), Gaps = 25/386 (6%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           +L +P     V V+DP  ADV V +P T+++ GK  G   +  +G   + +L   +++  
Sbjct: 22  MLHLPEAAVAVFVADPDVADVHVPTPETVFVLGKKAGTTTLFALGAHNRTILRETVVVSA 81

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           D   ++  L        + +     ++++ G V     +   ++    +L          
Sbjct: 82  DTPSIQRMLDARFPQFQLTLTAAPGSLMVAGRVPDAAAADAVMQSLTPYLHDK------- 134

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKF 238
              + ++N L +    QV L+V I EV R++ +Q+G   +  G S          F G+ 
Sbjct: 135 ---ETLVNRLTLTRPIQVHLRVRITEVDRNVTQQLGINWNALGQSG---NFIGGLFNGRA 188

Query: 239 ------VSEGGDFSVKGVLD--RFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSG 290
                 +S  G FS+ G     +++ + VL AL++   I  LAEP LTA+SG++ASF +G
Sbjct: 189 GSATTTLSSTGAFSILGAFQAGKWAIDGVLDALDQEGLITMLAEPNLTAMSGETASFLAG 248

Query: 291 GQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAG 346
           G+         T + ++    YGV L FTPTVL+  RI L+++ EVSE      + +++ 
Sbjct: 249 GEFPIPVPQGQTNSITIEFKPYGVSLDFTPTVLADNRISLKVRPEVSELDTTNGVTIDSI 308

Query: 347 DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNRE 406
            +P+  VR+ +TTVEL SG +  + GLL+ +   +   +P L K+P+LG LF +  +   
Sbjct: 309 KVPALTVRRVETTVELSSGQSFAIGGLLQSNTSDVLAELPGLGKLPVLGKLFSSKSYLNN 368

Query: 407 ETEIFIAATPFLVKPVAMRDLSRPDD 432
           ++E+ +  TP++V+P     L +P D
Sbjct: 369 KSEVVVIVTPYIVQPAEPGRLRQPID 394


>gi|323499921|ref|ZP_08104880.1| pilus assembly protein CpaC [Vibrio sinaloensis DSM 21326]
 gi|323315162|gb|EGA68214.1| pilus assembly protein CpaC [Vibrio sinaloensis DSM 21326]
          Length = 487

 Score =  162 bits (409), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 125/451 (27%), Positives = 217/451 (48%), Gaps = 36/451 (7%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
           GK + +  +K   + +    + V + DP   D+V+     ++L GK +G  N++     G
Sbjct: 25  GKIVKVPHHKSTHVTLAAKAKRVSLGDPEVLDIVMLKSDEVFLIGKKLGSTNLMAWDSRG 84

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           + + +++I +  D+  L+  L  F+ +  I V    + ++L G +       +A+ ++ET
Sbjct: 85  RLIESINIEVTHDLNSLKAKLYEFLPNEEIEVHSAQNRLILSGQISNQAAMNKALRVAET 144

Query: 167 FLSQSGRNQYANSSSKKV-----MNLLNIAGEDQVTLKVTIAEVRRDILKQIG-----FQ 216
           + +    ++   S S++V     +NL+ I G  QV L+VT+AEV+R ++++       F+
Sbjct: 145 YSAGQEADKENRSLSEQVQKTGVINLMTIGGAQQVMLEVTVAEVQRSLVRKFDSNFHFFE 204

Query: 217 HSITGSSSGPSKSFAAD-----FGGKFVSEGGDFSVKGVLDRF-----SFETVLHALERA 266
            +   S  G S     D      G  F + G D +  G L  F      F   L   ++ 
Sbjct: 205 SNGNFSWGGTSAGAIIDDVNGGIGPIFNAPGIDNT--GFLGTFIDGDTLFTFALDIAKQN 262

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
            + + LAEP LTA+SG  A F +GG+  +          ++   +YGV L F PTVLS  
Sbjct: 263 GSAKVLAEPNLTALSGAKAEFLAGGE--FPIPVPDDDGITIEYKEYGVGLKFIPTVLSDK 320

Query: 327 RIGLRIQTEVSE----PVIGVNAGD------MPSYRVRKADTTVELPSGGTIVLAGLLKD 376
            I L +  +VSE      + +N G       +P    R A +T+EL  G TI +AGLL +
Sbjct: 321 HINLNLAIDVSEIANSATLTLNPGGTNGTYVIPPITRRSASSTLELADGQTIGIAGLLSE 380

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSV 436
           +++ +  G+P  S IP+LG +F +  +   ETE+ I  TP L KP+    +S P D +  
Sbjct: 381 NVRDVVSGVPGFSDIPVLGQMFNSQEYISGETELVILVTPRLAKPIDRSKVSLPTDSFVE 440

Query: 437 EDDAKAFFFNRVNKIY--GPKEASEVEGQNY 465
            +D + +   R   I   G  +++E +  N+
Sbjct: 441 PNDFEYYLLGRGAYIAPTGKSKSNESQESNF 471


>gi|327189767|gb|EGE56911.1| cpaC pilus assembly Q protein [Rhizobium etli CNPAF512]
          Length = 495

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 129/428 (30%), Positives = 210/428 (49%), Gaps = 42/428 (9%)

Query: 42  VEIGKG-KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
           V +GK  + +++  N+ + L       D+++      DVV  S +++++ GK  G  N+ 
Sbjct: 42  VTLGKSVQHVTLPPNETLTLNTGQPFGDLVIGSADMIDVVPLSDKSLFVRGKKTGATNIS 101

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           + G D   +  +DI +  D + +   +R     + +RV   +D + L G+VR   + QR 
Sbjct: 102 VYGDDKSLLGVIDIRVASDFSEVSAAIRSAAPTARVRVFNSNDRIRLVGVVRDSIELQRV 161

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           +E+++++            S + V+N L ++   QV L+V I E  R   + +G   S  
Sbjct: 162 LEIAQSY------------SEQPVLNQLRVSDSQQVMLEVRIIEASRQTGRDLGIGWSGY 209

Query: 221 GSS-----SGPSKSFAADFGG--------KFVSEG----GDFSVKGV-LDRFSFETVLHA 262
           G++     +  S+    D G         K  + G    G    K + +     + V++A
Sbjct: 210 GNNNRIGKATTSQGITVDDGNLARTLLDPKGAATGMLPFGQLIAKVLEISGGHIDVVINA 269

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQH--LYKTVSSSTGATSVTTHDYGVVLHFTP 320
           LE+   +R LA+P L A+SG +ASF +GG+   L  T + +T AT      +GV L F P
Sbjct: 270 LEQKGLVRRLAQPNLIAMSGSTASFHAGGEVPILKTTNNGTTVATETDYRPFGVRLTFKP 329

Query: 321 TVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD---- 376
            VL  G I L I+ EVSE    +N    P +  R A TTV L  G +  LAGLL+     
Sbjct: 330 VVLDDGVINLEIEPEVSELDPSINVNGNPGFISRAASTTVALRDGQSFALAGLLQSINAK 389

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV-AMRDLSRPDDHYS 435
           DIQQ+    P L +IP+LGALFR++ F ++E+++ I  TP +V+P     DL  P D   
Sbjct: 390 DIQQM----PGLGQIPVLGALFRSTSFQKKESDLVIVVTPHIVRPARPGEDLYSPLDQTR 445

Query: 436 VEDDAKAF 443
             +D + F
Sbjct: 446 SSNDVELF 453


>gi|312621080|ref|YP_003993808.1| type ii/iv secretion system secretin rcpa/cpac,associated with flp
           pilus assembly [Photobacterium damselae subsp. damselae]
 gi|311872801|emb|CBX86892.1| Type II/IV secretion system secretin RcpA/CpaC,associated with Flp
           pilus assembly [Photobacterium damselae subsp. damselae]
          Length = 438

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 117/388 (30%), Positives = 188/388 (48%), Gaps = 38/388 (9%)

Query: 62  VPVD--VQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERD 119
           VPVD  +  V +SDP  AD  V     + +FGK +G  N+ +  ++G ++ N  +++ + 
Sbjct: 33  VPVDTEIDSVFISDPAIADYQVIDKNKVVIFGKKIGHTNLFIFDNEGNELANRKVIVNKS 92

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANS 179
           +  ++  +     D+NI +    + VVL G V   Q       +  T LS+   +   N 
Sbjct: 93  LREIKQYISIKFPDANIDIFNFGEQVVLSGTVSNEQVKDEINNIVGTLLSKKSNDFNFNL 152

Query: 180 SSKK---------------VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS 224
            +                 ++N + +    QV +K++IAEV    L+QIG Q++  G + 
Sbjct: 153 ETDDQDYEVQFMKQKHFTGLVNNIEVLATRQVNVKLSIAEVSHSFLEQIGVQYNSIGHAP 212

Query: 225 GPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
           G            FV+   +FS   +L      +V+ A+      + LAEP L+ ISG+S
Sbjct: 213 GV-----------FVNPLTNFSASDIL------SVITAIGNDGIGQVLAEPNLSVISGES 255

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIG 342
           ASF  GG+     V+     T+VT  ++GV L     V    +I L +  EVS  +    
Sbjct: 256 ASFLVGGE--LPVVTIVDNGTNVTYKEFGVKLELLAKVRKDDKITLSLMPEVSSLDTQYS 313

Query: 343 VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
            +  D+P+ + R+A TTVEL  G + VL GLL  + ++    +P +  IP+LGALFRNSR
Sbjct: 314 NDKYDLPALKTRRARTTVELGDGQSFVLGGLLSTEDKERLNKVPYIGDIPVLGALFRNSR 373

Query: 403 FNREETEIFIAATPFLVKPVAMRDLSRP 430
             R +TE+ I AT  LV+P+    +  P
Sbjct: 374 TERNKTELIIVATVNLVQPIHPSQVQLP 401


>gi|317154605|ref|YP_004122653.1| type II and III secretion system protein [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316944856|gb|ADU63907.1| type II and III secretion system protein [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 478

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 140/476 (29%), Positives = 225/476 (47%), Gaps = 52/476 (10%)

Query: 15  FLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDP 74
           FL +   +V+ L P+  A+  V+N     +     IS+ ++K  IL     V  V ++ P
Sbjct: 13  FLMALAVTVSGLVPLAVADVDVLNTEAPGV-----ISLVVSKSTILTADAPVSRVSLAQP 67

Query: 75  TKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNL-DILIERDIAHLEMTLRRFIA- 132
             A VVV SP  +Y+ G+ +G   + L    G Q+  + D++I  D+  L+  +   +  
Sbjct: 68  ETASVVVLSPTQIYITGRKLGTTTLTL--WSGGQVSGVYDLVITPDVTRLKRMIHEILPR 125

Query: 133 DSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAG 192
           + +++V    +++ L G V    D    + L+E              +  KV+NLL + G
Sbjct: 126 ERSVQVLSSGESITLSGSVSNTGDLTSVLSLAEA------------EAPGKVVNLLRVDG 173

Query: 193 EDQVTLKVTIAEVRRDILKQIGFQHSITGS-----SSGPSKSFAADFGGKFVS------- 240
             QV L+V +AE+ R  LK++G   + T S     S   + S  A+ G   +        
Sbjct: 174 VQQVMLQVRVAEMSRTALKRMGINLAATFSNFTVYSFLNNLSSLANTGSNVIELTDKINS 233

Query: 241 ----EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYK 296
                 G  +V G+LD         AL+     R LAEP LT +SG+SA F  GG+ +  
Sbjct: 234 VVRYNSGSTNVVGMLD---------ALKAHGLARLLAEPNLTCVSGESADFLVGGE-IPI 283

Query: 297 TVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYR 352
               + G  S+    +GV L FTPTVLS G I L +  EVSE      +     ++P+  
Sbjct: 284 PKPGALGTVSIEFKPFGVGLEFTPTVLSSGAINLHVSPEVSELDYTNALRYQGYEIPAIS 343

Query: 353 VRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFI 412
            RKA T V+L  G +  +AGL+ + +++     P+L  IP+LG LFR+S + + +TE+ I
Sbjct: 344 TRKASTVVDLADGQSFAIAGLISESLKENNHRFPVLGDIPVLGTLFRSSDYQKNKTELVI 403

Query: 413 AATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGA 468
             T  LVKP+ M   + P D +    D + F+   + +  G   A+ V  Q   G+
Sbjct: 404 IVTAHLVKPLDMAGQTLPGDGFKEPTDYE-FYMLGLLEGQGASPAAMVGAQARSGS 458


>gi|269105132|ref|ZP_06157826.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Photobacterium damselae subsp. damselae
           CIP 102761]
 gi|268160582|gb|EEZ39081.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Photobacterium damselae subsp. damselae
           CIP 102761]
          Length = 442

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 117/388 (30%), Positives = 188/388 (48%), Gaps = 38/388 (9%)

Query: 62  VPVD--VQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERD 119
           VPVD  +  V +SDP  AD  V     + +FGK +G  N+ +  ++G ++ N  +++ + 
Sbjct: 37  VPVDTEIDSVFISDPAIADYQVIDKNKVVIFGKKIGHTNLFIFDNEGNELANRKVIVNKS 96

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANS 179
           +  ++  +     D+NI +    + VVL G V   Q       +  T LS+   +   N 
Sbjct: 97  LREIKQYISIKFPDANIDIFNFGEQVVLSGTVSNEQVKDEINNIVGTLLSKKSNDFNFNL 156

Query: 180 SSKK---------------VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS 224
            +                 ++N + +    QV +K++IAEV    L+QIG Q++  G + 
Sbjct: 157 ETDDQDYEVQFMKQKHFTGLVNNIEVLATRQVNVKLSIAEVSHSFLEQIGVQYNSIGHAP 216

Query: 225 GPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
           G            FV+   +FS   +L      +V+ A+      + LAEP L+ ISG+S
Sbjct: 217 GV-----------FVNPLTNFSASDIL------SVITAIGNDGIGQVLAEPNLSVISGES 259

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIG 342
           ASF  GG+     V+     T+VT  ++GV L     V    +I L +  EVS  +    
Sbjct: 260 ASFLVGGE--LPVVTIVDNGTNVTYKEFGVKLELLAKVRKDDKITLSLMPEVSSLDTQYS 317

Query: 343 VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
            +  D+P+ + R+A TTVEL  G + VL GLL  + ++    +P +  IP+LGALFRNSR
Sbjct: 318 NDKYDLPALKTRRARTTVELGDGQSFVLGGLLSTEDKERLNKVPYIGDIPVLGALFRNSR 377

Query: 403 FNREETEIFIAATPFLVKPVAMRDLSRP 430
             R +TE+ I AT  LV+P+    +  P
Sbjct: 378 TERNKTELIIVATVNLVQPIHPSQVQLP 405


>gi|221067360|ref|ZP_03543465.1| type II and III secretion system protein [Comamonas testosteroni
           KF-1]
 gi|220712383|gb|EED67751.1| type II and III secretion system protein [Comamonas testosteroni
           KF-1]
          Length = 520

 Score =  161 bits (407), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 120/380 (31%), Positives = 194/380 (51%), Gaps = 31/380 (8%)

Query: 78  DVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NI 136
           +V + SPR ++  G+  G  NVIL    G   +  D+++  D   L+  L   + +  +I
Sbjct: 100 EVQLLSPRDLFFRGRKSGSMNVILQNAQGACFIK-DVIVTMDPGPLQAKLSELMPEERSI 158

Query: 137 RVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQV 196
           RV+   + +VL G +         V L+  +           S SKK++NLL      QV
Sbjct: 159 RVQGADNALVLSGEISNPLRLDDVVTLAGAY-----------SDSKKIVNLLRTTSPHQV 207

Query: 197 TLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSF 256
            L+V IAE+ + +L ++G   S++G     +   +      F+S GG       L R S 
Sbjct: 208 MLEVKIAEISKTLLDKLG--SSLSGQRVTSNGQNSYTVLSNFLSGGGGLLNAMRLGRGSI 265

Query: 257 ETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYG 313
              +   +    +R LAEP + AISGQ ASF SGG+       ++T    V T    ++G
Sbjct: 266 S--IDGQKDDGLVRILAEPNIMAISGQQASFLSGGKIFIPVAQTNTNGVPVMTLEEKEFG 323

Query: 314 VVLHFTPTVLSPGRIGLRIQTEVSE------PVIGVNA--GDMPSYRVRKADTTVELPSG 365
           + + FTPTVL   R+ L++ +EVS+      P   +N     +PS  VR+ADTTV+L  G
Sbjct: 324 IGVKFTPTVLGNSRVNLKLVSEVSDLSQTGSPFTSINGVTSVIPSLTVRRADTTVQLNDG 383

Query: 366 GTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMR 425
            ++V+AGL+K++I +  +  P L +IP+LGAL R++ F  ++TE+    TP LV+  A+ 
Sbjct: 384 QSLVIAGLIKNNITEAIKRFPGLGEIPVLGALARSTEFQTDQTELMFVITPRLVQ--ALA 441

Query: 426 DLSR-PDDHYSVEDDAKAFF 444
           +  R P D++ V   A+ + 
Sbjct: 442 EAPRVPTDNHVVPSRAEVYL 461


>gi|258621447|ref|ZP_05716481.1| Flp pilus assembly protein [Vibrio mimicus VM573]
 gi|262171232|ref|ZP_06038910.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio mimicus MB-451]
 gi|258586835|gb|EEW11550.1| Flp pilus assembly protein [Vibrio mimicus VM573]
 gi|261892308|gb|EEY38294.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio mimicus MB-451]
          Length = 488

 Score =  160 bits (406), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 124/430 (28%), Positives = 205/430 (47%), Gaps = 30/430 (6%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
           I  GK +++  +K   + +    + V + DP   D+V+     ++L G+ +G  N++   
Sbjct: 22  IQTGKVVTVPHHKSTFVVLSGKAKRVSLGDPQVLDIVMLKSDELFLIGRKLGSTNLMAWD 81

Query: 104 HDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL 163
             G  + +L++ +  D+  L+  L   + D  I+V    + ++L GMV   +    A+ +
Sbjct: 82  SRGNLIESLNVEVTHDLNSLKQKLYELLPDEPIQVHSAQNRLMLSGMVSNQEKMNIALRV 141

Query: 164 SETFLSQSGRNQYANSSSKKV-----MNLLNIAGEDQVTLKVTIAEVRRDILKQIG---- 214
           +ET+ +    ++   S + +V     +NL+ I G  QV L+VT+AEV+R ++++      
Sbjct: 142 AETYAAGQQADEATASLNSQVDKNGVINLMTIGGAQQVMLEVTVAEVQRSLVRRFDSNFH 201

Query: 215 -FQHSITGSSSGPSKS-FAADFGGKF--VSEGGDFSVKGVLDRF-----SFETVLHALER 265
            F+ +   S  G S      D GG    V    +    G+L  F      F   L   + 
Sbjct: 202 FFEKNGNFSWGGTSAGGIIDDIGGVVGPVFNAPNIESTGLLGTFIDGDTLFTFALDIAKE 261

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
               + LAEP LTA+SG  A F +GG+     V    G T +   +YGV L F PT+LS 
Sbjct: 262 NGVAKVLAEPNLTALSGAKAEFLAGGEFPIP-VPDKDGVT-IEYKEYGVGLKFIPTILSD 319

Query: 326 GRIGLRIQTEVSE----PVIGVNAGD------MPSYRVRKADTTVELPSGGTIVLAGLLK 375
            RI L +  +VSE      + +N G       +P    R A +T+EL  G TI +AGLL 
Sbjct: 320 KRINLNLAVDVSEIASSNTLTLNPGTTNASYFIPPITRRSASSTLELADGQTIGIAGLLS 379

Query: 376 DDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYS 435
           ++++ +   +P    IP+LG LFR+  +   ETE+ I  TP L KPV    ++ P D + 
Sbjct: 380 ENVRDVTSKMPGFGDIPVLGQLFRSQNYISGETELVILVTPRLAKPVDRNKITLPTDAFV 439

Query: 436 VEDDAKAFFF 445
              D K +  
Sbjct: 440 EPSDFKYYLL 449


>gi|258627504|ref|ZP_05722285.1| Flp pilus assembly protein [Vibrio mimicus VM603]
 gi|258580310|gb|EEW05278.1| Flp pilus assembly protein [Vibrio mimicus VM603]
          Length = 488

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 124/430 (28%), Positives = 205/430 (47%), Gaps = 30/430 (6%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
           I  GK +++  +K   + +    + V + DP   D+V+     ++L G+ +G  N++   
Sbjct: 22  IQTGKVVTVPHHKSTFVVLSGKAKRVSLGDPQVLDIVMLKSDELFLIGRKLGSTNLMAWD 81

Query: 104 HDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL 163
             G  + +L++ +  D+  L+  L   + D  I+V    + ++L GMV   +    A+ +
Sbjct: 82  SRGNLIESLNVEVTHDLNSLKQKLYELLPDEPIQVHSAQNRLMLSGMVSNQEKMNIALRV 141

Query: 164 SETFLSQSGRNQYANSSSKKV-----MNLLNIAGEDQVTLKVTIAEVRRDILKQIG---- 214
           +ET+ +    ++   S + +V     +NL+ I G  QV L+VT+AEV+R ++++      
Sbjct: 142 AETYAAGQQADEATASLNSQVDKNGVINLMTIGGAQQVMLEVTVAEVQRSLVRRFDSNFH 201

Query: 215 -FQHSITGSSSGPSKS-FAADFGGKF--VSEGGDFSVKGVLDRF-----SFETVLHALER 265
            F+ +   S  G S      D GG    V    +    G+L  F      F   L   + 
Sbjct: 202 FFEKNGNFSWGGTSAGGIIDDIGGVVGPVFNAPNIESTGLLGTFIDGDTLFTFALDIAKE 261

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
               + LAEP LTA+SG  A F +GG+     V    G T +   +YGV L F PT+LS 
Sbjct: 262 NGVAKVLAEPNLTALSGAKAEFLAGGEFPIP-VPDKDGVT-IEYKEYGVGLKFIPTILSD 319

Query: 326 GRIGLRIQTEVSE----PVIGVNAGD------MPSYRVRKADTTVELPSGGTIVLAGLLK 375
            RI L +  +VSE      + +N G       +P    R A +T+EL  G TI +AGLL 
Sbjct: 320 KRINLNLAVDVSEIASSNTLTLNPGTTNASYFIPPITRRSASSTLELADGQTIGIAGLLS 379

Query: 376 DDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYS 435
           ++++ +   +P    IP+LG LFR+  +   ETE+ I  TP L KPV    ++ P D + 
Sbjct: 380 ENVRDVTSKMPGFGDIPVLGQLFRSQNYISGETELVILVTPRLAKPVDRNKITLPTDAFV 439

Query: 436 VEDDAKAFFF 445
              D K +  
Sbjct: 440 EPSDFKYYLL 449


>gi|262165919|ref|ZP_06033656.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio mimicus VM223]
 gi|262025635|gb|EEY44303.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio mimicus VM223]
          Length = 488

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 124/430 (28%), Positives = 205/430 (47%), Gaps = 30/430 (6%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
           I  GK +++  +K   + +    + V + DP   D+V+     ++L G+ +G  N++   
Sbjct: 22  IQTGKVVTVPHHKSTFVVLSGKAKRVSLGDPQVLDIVMLKSDELFLIGRKLGSTNLMAWD 81

Query: 104 HDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL 163
             G  + +L++ +  D+  L+  L   + D  I+V    + ++L GMV   +    A+ +
Sbjct: 82  SRGNLIESLNVEVTHDLNSLKQKLYELLPDEPIQVHSAQNRLMLSGMVSNQEKMNIALRV 141

Query: 164 SETFLSQSGRNQYANSSSKKV-----MNLLNIAGEDQVTLKVTIAEVRRDILKQIG---- 214
           +ET+ +    ++   S + +V     +NL+ I G  QV L+VT+AEV+R ++++      
Sbjct: 142 AETYAAGQQADEATASLNSQVDKNGVINLMTIGGAQQVMLEVTVAEVQRSLVRRFDSNFH 201

Query: 215 -FQHSITGSSSGPSKS-FAADFGGKF--VSEGGDFSVKGVLDRF-----SFETVLHALER 265
            F+ +   S  G S      D GG    V    +    G+L  F      F   L   + 
Sbjct: 202 FFEKNGNFSWGGTSAGGIIDDIGGVVGPVFNAPNIESTGLLGTFIDGDTLFTFALDIAKE 261

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
               + LAEP LTA+SG  A F +GG+     V    G T +   +YGV L F PT+LS 
Sbjct: 262 NGVAKVLAEPNLTALSGAKAEFLAGGEFPIP-VPDKDGVT-IEYKEYGVGLKFIPTILSD 319

Query: 326 GRIGLRIQTEVSE----PVIGVNAGD------MPSYRVRKADTTVELPSGGTIVLAGLLK 375
            RI L +  +VSE      + +N G       +P    R A +T+EL  G TI +AGLL 
Sbjct: 320 KRINLNLAVDVSEIASSNTLTLNPGTTNASYFIPPITRRSASSTLELADGQTIGIAGLLS 379

Query: 376 DDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYS 435
           ++++ +   +P    IP+LG LFR+  +   ETE+ I  TP L KPV    ++ P D + 
Sbjct: 380 ENVRDVTSKMPGFGDIPVLGQLFRSQNYISGETELVILVTPRLAKPVDRNKITLPTDAFV 439

Query: 436 VEDDAKAFFF 445
              D K +  
Sbjct: 440 EPSDFKYYLL 449


>gi|323491532|ref|ZP_08096711.1| pilus assembly protein CpaC [Vibrio brasiliensis LMG 20546]
 gi|323314108|gb|EGA67193.1| pilus assembly protein CpaC [Vibrio brasiliensis LMG 20546]
          Length = 485

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 122/440 (27%), Positives = 213/440 (48%), Gaps = 27/440 (6%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
           GK + +  +K   + +    + V + DP   D+V+     ++L GK +G  N++     G
Sbjct: 25  GKVVKVPHHKSTHVTLAGKAKRVSLGDPDVLDIVMLKSDELFLIGKKLGSTNLMAWDSRG 84

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           + + +++I +  D+  L+  L  F+ + +I V    + ++L G +        A+ ++ET
Sbjct: 85  QLIESINIEVTHDLNSLKAKLFEFLPNESIEVHSAQNRLILSGQISNQAAMNIALRVAET 144

Query: 167 FLSQSGRNQYANSSSKK-----VMNLLNIAGEDQVTLKVTIAEVRRDILKQIG-----FQ 216
           + +    ++   S SK+     V+NL+ I G  QV L+VT+AEV+R ++++       FQ
Sbjct: 145 YSAGRQADKENKSLSKQAEKTGVINLMTIGGAQQVMLEVTVAEVQRSLVRKFDANFAFFQ 204

Query: 217 HSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRF-----SFETVLHALERATAIRT 271
            S +    G + + A   G   + E       G+L  F      F   L    +    + 
Sbjct: 205 SSGSKFKWGGTSTGATVPGATPIFEAPSTGDYGILGSFIDGNTLFTFALDVARQNGTAKV 264

Query: 272 LAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           LAEP LTA+SG  A F +GG+     V    G T +   +YGV L F PTVLS  +I L 
Sbjct: 265 LAEPNLTALSGSKAEFLAGGEFPIP-VPDEDGIT-IEYKEYGVGLKFIPTVLSDKKINLN 322

Query: 332 IQTEVSE----PVIGVNAGD------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
           +  +VSE      + ++ G       +P    R A +T+EL  G TI +AGLL ++++ +
Sbjct: 323 LAVDVSEIANSSSLTLSPGSTNSTYIIPPITRRSASSTLELADGQTIGIAGLLSENVRDV 382

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
              +P  S IPILG +F +  +   ETE+ I  TP L +P+    ++ P D +   +D +
Sbjct: 383 ANEMPGFSDIPILGQMFNSQEYVSGETELVILVTPRLAQPIDRNKVTLPTDSFVEPNDFE 442

Query: 442 AFFFNRVNKIYGPKEASEVE 461
            +   R + +    +AS+ +
Sbjct: 443 YYLLGRGSYLAPASQASQAK 462


>gi|59713403|ref|YP_206178.1| general secretion pathway protein D [Vibrio fischeri ES114]
 gi|59481651|gb|AAW87290.1| general secretion pathway protein D [Vibrio fischeri ES114]
          Length = 440

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 117/383 (30%), Positives = 188/383 (49%), Gaps = 38/383 (9%)

Query: 65  DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
           DV  V VSDP  AD  V   + + ++GK +GQ++V++   +G  + N  +++ + +  ++
Sbjct: 42  DVGSVFVSDPKIADYQVIEKKKVIVYGKKIGQSSVMVFDRNGHTLANKKLIVNKSLDSIK 101

Query: 125 MTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL--------SETF-LSQSGRNQ 175
             +     D ++ V  + + VVL G V T Q+      +         E F   Q   +Q
Sbjct: 102 QYISVKYPDVDVDVFNIGEQVVLSGTVSTEQEKDEINNIVGQLLDKDDEKFTFEQDMEDQ 161

Query: 176 ------YANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKS 229
                    +  K ++N + +A   QV +K++IAEV +  L+ IG Q             
Sbjct: 162 DYEIQFMERTDYKGIVNNIEVATTKQVNVKISIAEVSQSFLQDIGIQ------------- 208

Query: 230 FAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTS 289
           +  D  G F+     FS   ++      +V+ A+   T  + LAEP L+ +SG+SASF  
Sbjct: 209 YGTDAAGVFIQPLTHFSSSDIM------SVITAIGSDTVGQILAEPNLSVVSGESASFLV 262

Query: 290 GGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV--NAGD 347
           GG+     V++   +T+V   +YGV L     V    +I L +  EVS   I    ++ D
Sbjct: 263 GGE--LPVVTTVNNSTNVMYKEYGVRLELMAKVKKDDKITLSLVPEVSSLDIQYENDSYD 320

Query: 348 MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREE 407
           +P+ + R+A TTVEL  G + VL GLL  + ++  + IP +  IPILGALFR S   R +
Sbjct: 321 LPALKTRRARTTVELGDGQSFVLGGLLSSEDKESLQKIPFIGDIPILGALFRGSSTKRNK 380

Query: 408 TEIFIAATPFLVKPVAMRDLSRP 430
           TE+ I AT  LVKP+    +  P
Sbjct: 381 TELLIVATVNLVKPIHSSQIQLP 403


>gi|264678238|ref|YP_003278145.1| type II and III secretion system protein [Comamonas testosteroni
           CNB-2]
 gi|262208751|gb|ACY32849.1| type II and III secretion system protein [Comamonas testosteroni
           CNB-2]
          Length = 523

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 120/380 (31%), Positives = 194/380 (51%), Gaps = 31/380 (8%)

Query: 78  DVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NI 136
           +V + SPR ++  G+  G  NVIL    G   +  D+++  D   L+  L   + +  +I
Sbjct: 101 EVQLLSPRDLFFRGRKSGSMNVILQNAQGACFIK-DVIVTMDPGPLQAKLSELMPEERSI 159

Query: 137 RVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQV 196
           RV+   + +VL G +         V L+  +           S SKK++NLL      QV
Sbjct: 160 RVQGADNALVLSGEISNPLRLDDVVTLAGAY-----------SDSKKIVNLLRTTSPHQV 208

Query: 197 TLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSF 256
            L+V IAEV + +L ++G   +    +S    +F+      F+S GG       + + S 
Sbjct: 209 MLEVKIAEVSKTLLDKLGASLAGQRITSNGMNTFS--IASNFLSGGGGLLSAMRIGKGSI 266

Query: 257 ETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYG 313
              +   +    +R LAEP + AISGQ ASF SGG+       S+T    V T    ++G
Sbjct: 267 S--IDGQKDDGLVRILAEPNIMAISGQQASFLSGGKIFIPVAQSNTTGVPVMTLEEKEFG 324

Query: 314 VVLHFTPTVLSPGRIGLRIQTEVSE------PVIGVNA--GDMPSYRVRKADTTVELPSG 365
           + + FTPTVL   R+ L++ +EVS+      P   +N     +PS  VR+ADTTV+L  G
Sbjct: 325 IGVKFTPTVLGGSRVNLKLVSEVSDLSQTGSPFTAINGVTSVIPSLSVRRADTTVQLNDG 384

Query: 366 GTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMR 425
            ++V+AGL+K++I +  +  P L +IP+LGAL R++ F  ++TE+    TP LV+  A+ 
Sbjct: 385 QSLVIAGLIKNNITEAVKRFPGLGEIPVLGALARSTEFQTDQTELMFIITPRLVQ--ALA 442

Query: 426 DLSR-PDDHYSVEDDAKAFF 444
           +  R P D++ V   A+ + 
Sbjct: 443 EAPRVPTDNHVVPSRAEVYL 462


>gi|197337022|ref|YP_002157812.1| general secretion pathway protein D [Vibrio fischeri MJ11]
 gi|197314274|gb|ACH63723.1| general secretion pathway protein D [Vibrio fischeri MJ11]
          Length = 440

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 117/383 (30%), Positives = 188/383 (49%), Gaps = 38/383 (9%)

Query: 65  DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
           DV  V VSDP  AD  V   + + ++GK +GQ++V++   +G  + N  +++ + +  ++
Sbjct: 42  DVGSVFVSDPKIADYQVIEKKKVIVYGKKIGQSSVMVFDRNGHTLANKKVIVNKSLDSIK 101

Query: 125 MTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL--------SETF-LSQSGRNQ 175
             +     D ++ V  + + VVL G V T Q+      +         E F   Q   +Q
Sbjct: 102 QYISVKYPDVDVDVFNIGEQVVLSGTVSTEQEKDEINNIVGQLLDKDDEKFTFEQDMEDQ 161

Query: 176 ------YANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKS 229
                    +  K ++N + +A   QV +K++IAEV +  L+ IG Q             
Sbjct: 162 DYEIQFMERTDYKGIVNNIEVATTKQVNVKISIAEVSQSFLQDIGIQ------------- 208

Query: 230 FAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTS 289
           +  D  G F+     FS   ++      +V+ A+   T  + LAEP L+ +SG+SASF  
Sbjct: 209 YGTDAAGVFIQPLTHFSSSDIM------SVITAIGSDTVGQILAEPNLSVVSGESASFLV 262

Query: 290 GGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV--NAGD 347
           GG+     V++   +T+V   +YGV L     V    +I L +  EVS   I    ++ D
Sbjct: 263 GGE--LPVVTTVNNSTNVMYKEYGVRLELMAKVKKDDKITLSLVPEVSSLDIQYENDSYD 320

Query: 348 MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREE 407
           +P+ + R+A TTVEL  G + VL GLL  + ++  + IP +  IPILGALFR S   R +
Sbjct: 321 LPALKTRRARTTVELGDGQSFVLGGLLSSEDKESLQKIPFIGDIPILGALFRGSSTKRNK 380

Query: 408 TEIFIAATPFLVKPVAMRDLSRP 430
           TE+ I AT  LVKP+    +  P
Sbjct: 381 TELLIVATVNLVKPIHSSQIQLP 403


>gi|323529413|ref|YP_004231565.1| type II and III secretion system protein [Burkholderia sp.
           CCGE1001]
 gi|323386415|gb|ADX58505.1| type II and III secretion system protein [Burkholderia sp.
           CCGE1001]
          Length = 616

 Score =  160 bits (404), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 122/422 (28%), Positives = 213/422 (50%), Gaps = 35/422 (8%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + + + K  ++Q    V++  + +P  A   + SP+T+Y+ G  VG  N+I+ G  G   
Sbjct: 91  VVVPVGKSTLMQTAEPVRNRTLGNPLVAQATMVSPQTLYVVGMAVGTTNMIVQGKSGACE 150

Query: 110 LNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           + +++++  D   L+ +L + + D  NIRV  V+  +VL G V + Q + +A E+++ + 
Sbjct: 151 V-INVVVNADSGGLQTSLSQLMPDEPNIRVSTVAGDLVLAGRVSSAQAAAQAQEIAKAYA 209

Query: 169 SQS--------GRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
             +          N  A + +  V+N++++    QV L+V +AEV + +L Q+G   +I 
Sbjct: 210 RSTLPAANGGTNGNGGAPAKAATVLNMMSVDSPQQVMLEVKVAEVSKTVLNQLGSAMNIQ 269

Query: 221 GSSSGPSKSFAADFGGKFVSE--GGDFSVKGV--LDRFSFETVLHALERATAIRTLAEPT 276
           G        F + + G  +S    G  S+  V   +   F   +        ++ LAEP 
Sbjct: 270 GG-------FGS-WSGALISSLLSGVQSIAAVSKANNRPFNVAVDGQHGDDLVKILAEPN 321

Query: 277 LTAISGQSASFTSGGQHLYKTVSSSTGATS---VTTHDYGVVLHFTPTVLSPGRIGLRIQ 333
           L  +SGQ A+F +GG+       S+    S   +   ++GV L FTPTVL+ GRI L++ 
Sbjct: 322 LVTLSGQEATFLAGGKVFIPIPQSNLNGVSTIILQEEEFGVGLKFTPTVLAGGRINLKVA 381

Query: 334 TEVSE-PVIGVNAGD--------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
            EVSE    GV  G         +P    R+A TTV++  G T  + GL+K +     + 
Sbjct: 382 PEVSELSSTGVTVGATNTNNLTVLPLITTRRASTTVQMNDGETFAIGGLIKSNAAGTLKA 441

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV-AMRDLSRPDDHYSVEDDAKAF 443
           IP + ++P+LGALFR++ + ++ TE+    TP LVKP+ A+ +L  P D     ++A  +
Sbjct: 442 IPGVGEVPVLGALFRSTSYQQDRTELIFIITPHLVKPLQAVANLPLPTDRLKTPNEADVY 501

Query: 444 FF 445
             
Sbjct: 502 LL 503


>gi|86159249|ref|YP_466034.1| type II and III secretion system protein [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85775760|gb|ABC82597.1| type II and III secretion system protein [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 487

 Score =  160 bits (404), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 131/449 (29%), Positives = 217/449 (48%), Gaps = 69/449 (15%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
           D E+G  + +S+   +  +L V   +  + V++P  AD+ V +P  + L  K +G  ++ 
Sbjct: 30  DREVGAARSMSLEAGQNRLLVVSDQIGRIAVANPDVADLKVVTPYQVLLTAKGIGSTDLT 89

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           L   D   ++ + + + R++  L   L+   A   I V    D VV+ G V  ++  +R 
Sbjct: 90  LWDRDNHPLV-IALQVTRNLEGLRKQLKELFAGEKIEVSSAGDLVVISGQVSDVRIPERV 148

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG---FQH 217
            E+             A   + KV NL+ ++G+ QV L+V  AEV R  L+++G   F  
Sbjct: 149 AEV-------------ARLHATKVANLVQVSGQQQVQLEVRFAEVGRTGLREMGVNFFHK 195

Query: 218 SITGSSSGP---SKSFAADF------------GGK----------------------FVS 240
           S  G   G    ++++  DF            G +                      F+S
Sbjct: 196 SDDGKRVGGMTGNRTYPGDFLNTQSNPAIPGTGPRGLWGPGMPPDVPNPAFNNAFSFFLS 255

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
           +GG         +F F  +L+ LE++   +TLAEPTL A+SGQ A+F +GG+ L   ++S
Sbjct: 256 QGG---------QFPFSVMLNLLEQSNLAKTLAEPTLVAMSGQEAAFLAGGE-LPIPLAS 305

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKA 356
           + G T+V    +G+ L FTPTV+    I LR++ EVS+      + V    +P    R++
Sbjct: 306 TFGQTAVEWKKFGIQLRFTPTVIGDA-IHLRLKAEVSDLDPTTAVTVGGTTIPGLVSRQS 364

Query: 357 DTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATP 416
           +TT+ L  G +  +AGL+ D ++     +P+L  IPILGALFR+  + R+ETE+ +  T 
Sbjct: 365 ETTIRLGDGQSFAVAGLISDKVRSQSARVPVLGSIPILGALFRSQAYQRDETELLVVVTA 424

Query: 417 FLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
            L KPVA  +L      +   D + A  F
Sbjct: 425 RLAKPVAPHELPPLPTDFENNDPSDAALF 453


>gi|156975620|ref|YP_001446527.1| Flp pilus assembly protein secretin [Vibrio harveyi ATCC BAA-1116]
 gi|156527214|gb|ABU72300.1| hypothetical protein VIBHAR_03353 [Vibrio harveyi ATCC BAA-1116]
          Length = 449

 Score =  160 bits (404), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 116/398 (29%), Positives = 194/398 (48%), Gaps = 49/398 (12%)

Query: 60  LQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERD 119
           ++V   +  V VSDP   D  V +  T+ +F K VGQA  I+ G   K +L+  I+++ D
Sbjct: 36  IEVKEPISTVFVSDPEIVDYNVVNENTVVVFAKEVGQARFIIYGKSKKVLLSDRIIVDID 95

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYA-- 177
           ++ +   ++    + NI+VE V + V + G+V + Q       +  T L +    ++   
Sbjct: 96  LSLVRRQIKLHYPELNIKVESVGNQVAVSGVVESEQQRDDIYRMVATLLGRDKTEKWEET 155

Query: 178 ----------------------NSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
                                 N + + ++ L+ +A + QV +K+++A+V     + +G 
Sbjct: 156 QVLEFENEAYDIEEPQSMIFARNMTWEGILELIEVATDQQVNVKISVAQVTETFSQTVGV 215

Query: 216 QHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEP 275
             S  G          AD G     +          D     T++ AL      + LAEP
Sbjct: 216 DWSSVG----------ADVGEFLFQQ---------FDAADLTTLITALGNENVAQVLAEP 256

Query: 276 TLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            LT ISG+SASF  GG+     + ++    ++T  ++G+ L  T  VL  G+I +R+  E
Sbjct: 257 NLTVISGESASFLVGGE--VPVIVTTNNNINITFREFGIKLDLTAKVLHEGKIRMRLMPE 314

Query: 336 VSEPVIGVNAG--DMPSYRVRKADTTVELPSGGTIVLAGLLKD-DIQQLKEGIPLLSKIP 392
           VSE    + +   ++P +  R+A TT+EL  G + VL GL+   D+++LK+ IPLL  IP
Sbjct: 315 VSEVERYIRSAGLEVPQFATRRAMTTIELGDGDSFVLGGLMSSADLEELKK-IPLLGDIP 373

Query: 393 ILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           +LGA FR +  +R  TE+ I AT  LVKP+  +D+  P
Sbjct: 374 VLGAAFRKASTDRRRTELIIVATVNLVKPMKKKDIQMP 411


>gi|260462607|ref|ZP_05810813.1| type II and III secretion system protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259031513|gb|EEW32783.1| type II and III secretion system protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 478

 Score =  160 bits (404), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 208/418 (49%), Gaps = 30/418 (7%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           ++ + +++ + +QV  ++ D++V D   AD    + RT+Y+ GK  G   V L   D + 
Sbjct: 42  RVFLPMSQSVTIQVNANLGDIVVGDEKIADAQPMTDRTLYVIGKGAGTTTVNLFSTDKRS 101

Query: 109 MLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           +  + I +  D++ +   +R+    S I +  ++  V L G V+     +  +++++   
Sbjct: 102 LGVIQIEVGVDVSDMAQAIRQVSPRSRIEIGSINGKVRLGGHVKDGATLEAIMQVAQ--- 158

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS---- 224
                 QY   +   ++N + +    QV L+V + E +R+  + +G      GSS+    
Sbjct: 159 ------QYGPDA---IINSVTVDDSQQVNLEVRVLEAKRNAGRDLGVSFRSRGSSATIFG 209

Query: 225 ---GPSKSFAADFGG---KFVSEGGDFS--VKGVLD-RFSFETVLHALERATAIRTLAEP 275
                +    AD G      +S+   F+  +  ++D     + ++ ALE    +RTLA P
Sbjct: 210 TGIAATTPPGADPGTLVTGLLSKTNPFASLITQIIDSNIKVDLIIEALEAKGVVRTLANP 269

Query: 276 TLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            LT +SG+ ASF +GGQ   ++V+   G   +    +GV L FTP VL+  +I + +  E
Sbjct: 270 NLTTLSGEPASFNAGGQVPIRSVTKD-GLIQIEYKQFGVNLQFTPIVLADDKIHISLAPE 328

Query: 336 VSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILG 395
           VS+     +AGD P +  RK DT VEL  G +  + GLL     +L+  +P L ++P++G
Sbjct: 329 VSDLTGFTSAGD-PIFTNRKLDTVVELRDGQSFAVGGLLSSKTTKLQNQVPWLGQVPVIG 387

Query: 396 ALFRNSRFNREETEIFIAATPFLVKPVAM-RDLSRPDDHYSVEDDAKAFFFNR--VNK 450
            LFRNS   +EETE+ +  TP +V+PV     L+ P D     +D + F   +  VNK
Sbjct: 388 TLFRNSSNQKEETELVVIVTPHIVRPVKPGEQLATPFDKTRPANDPEFFVLGQLEVNK 445


>gi|227819321|ref|YP_002823292.1| CpaC pilus assembly protein [Sinorhizobium fredii NGR234]
 gi|227338320|gb|ACP22539.1| CpaC pilus assembly protein [Sinorhizobium fredii NGR234]
          Length = 496

 Score =  159 bits (403), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 129/429 (30%), Positives = 215/429 (50%), Gaps = 51/429 (11%)

Query: 45  GKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGH 104
           G  +++++  N  I ++      D+++      DVV  S +++++ GK  G  N I +  
Sbjct: 47  GSVQQVTLAPNDTITVRTGKPFGDLVIGSAEMIDVVPLSDQSLFIRGKQTGATN-ISVYD 105

Query: 105 DGKQMLN-LDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL 163
           D K ++  +D+ +  D + +   +R     + +RV   +D + L G VR   + QR +E+
Sbjct: 106 DNKALVGVIDVRVAADFSEVASAIRSTAPSAQVRVFNSNDRIRLTGTVRDAVELQRVMEI 165

Query: 164 SETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS 223
           ++++            S++ V+N L +A   QV L+V + E  R   + +G   S  G +
Sbjct: 166 AQSY------------SAEPVLNQLRVAESQQVMLEVRVIEASRQTGRDLGIGWSGQGRN 213

Query: 224 ----SGPSKSFAADFGGKFVSEGGDFS------------VKGVLD--RFSFETVLHALER 265
               +  S+    D  G      GD +            +  VL+      + V++ALE+
Sbjct: 214 GIGKATTSQGITVDDDGNLARTLGDAAGAATGMQPFGQLIAKVLEISGGQIDIVINALEQ 273

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQ-HLYKTVSSSTGATSVTTHDY---GVVLHFTPT 321
              +R LA+P L A+SG++ASF +GG+  +  TV++  GAT  T  DY   GV L F+P 
Sbjct: 274 KGLVRRLAQPNLIAMSGETASFHAGGEVPIQSTVAN--GATLATETDYRPFGVRLTFSPV 331

Query: 322 VLSPGRIGLRIQTEVSE--PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD--- 376
           VL  G I L+I+ EVSE  P I VN    P +  R A TTV L  G +  +AGLL+    
Sbjct: 332 VLDGGLISLKIEPEVSEIDPSISVNGN--PGFISRAASTTVALRDGQSFAMAGLLQSVNA 389

Query: 377 -DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA-MRDLSRPDDHY 434
            D+QQL    P L ++P++GALFR++ F + E+++ I  TP +V+P     DL  P +  
Sbjct: 390 KDVQQL----PWLGQVPVIGALFRSTSFLKRESDLVIVVTPHIVRPSKPGEDLYSPLEQT 445

Query: 435 SVEDDAKAF 443
              +D + F
Sbjct: 446 RSSNDVELF 454


>gi|84386797|ref|ZP_00989822.1| type II and III secretion system protein [Vibrio splendidus 12B01]
 gi|84378325|gb|EAP95183.1| type II and III secretion system protein [Vibrio splendidus 12B01]
          Length = 465

 Score =  159 bits (402), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 125/453 (27%), Positives = 220/453 (48%), Gaps = 47/453 (10%)

Query: 52  IGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLN 111
           + +N+  ++++P   + + +S+   A+    +   + +FGK  G A + ++    + +  
Sbjct: 29  VTINEARMIRLPEKAKSIFISNTHIANYQTLTNTKVMIFGKQAGSATITVLNEQERVIYT 88

Query: 112 LDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQ- 170
             I +  +       ++    ++++  E +   + L G V +   +   V L++ +LS  
Sbjct: 89  NKIRVTHNSREFNELVKNKFPEASVNAESLGGKLWLKGRVPSPMMAHNIVSLAKGYLSPI 148

Query: 171 --SGRNQYANS--------------------SSKKVMNLLNIAGEDQVTLKVTIAEVRRD 208
             S   Q +++                    +  +++N L +   +QV ++V IAEV R+
Sbjct: 149 VGSTEQQESSNSQGNSNNSSSSTNQNQQTQLNDDELINQLVVTMPNQVNIRVKIAEVSRN 208

Query: 209 ILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATA 268
           +  ++G +    GS +G    F+       VS  G  S+  ++D         AL     
Sbjct: 209 VSNKLGIKW---GSIAGGVGQFSFSKLPN-VSSWGKPSITALID---------ALATNGM 255

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRI 328
           +  LAEP LTA+SG+ A F  GGQ     +++ T  T +   D+GV L+FTPTVLS  RI
Sbjct: 256 MSVLAEPNLTAMSGEDAEFLVGGQVPLPLITADT--TQIEYKDFGVKLNFTPTVLSQNRI 313

Query: 329 GLRIQTEVSEPVIG----VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLK-DDIQQLKE 383
            L++  EVS   I     +N  + PS+  R A TT+EL SG +  L GLLK +DI+QL++
Sbjct: 314 SLKVNPEVSNISIESQQVINGTNFPSFTTRSASTTIELASGQSFALGGLLKSEDIEQLQK 373

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHY-SVEDDAKA 442
            +PL+ +IP+LG+LFR++ F R ETE+ I  T +LV+P     +  P D    + D  + 
Sbjct: 374 -VPLIGEIPVLGSLFRSTEFTRRETELIIIVTAYLVQPTRSDSMPLPTDGLIPLSDVERL 432

Query: 443 FFFNRVNKIYGPKEASEVEGQNYK--GAIGFIY 473
             + R  +     +A+  + Q  +  G  GF Y
Sbjct: 433 LAWPREQQKTSNNKATYTDNQKPRLLGDNGFYY 465


>gi|197123317|ref|YP_002135268.1| type II and III secretion system protein [Anaeromyxobacter sp. K]
 gi|196173166|gb|ACG74139.1| type II and III secretion system protein [Anaeromyxobacter sp. K]
          Length = 484

 Score =  159 bits (402), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 131/449 (29%), Positives = 217/449 (48%), Gaps = 69/449 (15%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
           D E+G  + +S+   +  +L V   +  + V++P  AD+ V +P  + L  K +G  ++ 
Sbjct: 30  DREVGAARSMSLEAGQNRLLVVSDQIGRIAVANPDVADLKVVTPYQVLLTAKGIGSTDLT 89

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           L   D   ++ + + + R++  L   L+   A   I V    D VV+ G V  ++  +R 
Sbjct: 90  LWDRDNHPLV-VALQVTRNLEGLRKQLKELFAGEKIDVSSAGDLVVISGQVSDVRIPERV 148

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG---FQH 217
            E++    S             KV NL+ ++G+ QV L+V  AEV R  L+++G   F  
Sbjct: 149 AEVARLHAS-------------KVANLVQVSGQQQVQLEVRFAEVGRTGLREMGVNFFHK 195

Query: 218 SITGSSSGP---SKSFAADF------------GGK----------------------FVS 240
           S  G   G    ++++  DF            G +                      F+S
Sbjct: 196 SDDGKRVGGMTGNRTYPGDFLNTQSNPAIPGTGPRGLWGPGLPPDVPNAAFNNAFSFFLS 255

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
           +GG         +F F  +L+ LE++   +TLAEPTL A+SGQ A+F +GG+ L   ++S
Sbjct: 256 QGG---------QFPFSVMLNLLEQSNLAKTLAEPTLVAMSGQEAAFLAGGE-LPIPLAS 305

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKA 356
           + G T+V    +G+ L FTPTV+    I LR++ EVS+      + V    +P    R++
Sbjct: 306 TFGQTAVEWKKFGIQLRFTPTVIGDA-IHLRLKAEVSDLDPTTAVTVGGTTIPGLVSRQS 364

Query: 357 DTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATP 416
           +TT+ L  G +  +AGL+ D ++     +P+L  IPILGALFR+  + R+ETE+ +  T 
Sbjct: 365 ETTIRLGDGQSFAVAGLISDKVRSQSARVPVLGSIPILGALFRSQAYQRDETELLVVVTA 424

Query: 417 FLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
            L KPVA  +L      +   D + A  F
Sbjct: 425 RLAKPVAPHELPPLPTDFENNDPSDAALF 453


>gi|312883308|ref|ZP_07743034.1| Flp pilus assembly protein [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368924|gb|EFP96450.1| Flp pilus assembly protein [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 440

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 132/443 (29%), Positives = 216/443 (48%), Gaps = 61/443 (13%)

Query: 8   FFTMMS-IFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDV 66
             T++S IF+F SN S A++  I + +A  IN+ +                        +
Sbjct: 11  ILTLLSLIFIFISNCSAAEILNIDQDSAKTINLKN-----------------------SI 47

Query: 67  QDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMT 126
             V + +PT AD  +     + +FG  VG  +VI+ G  G ++ N ++++ + +  L+ T
Sbjct: 48  STVFLVNPTIADYKIIDDNKLVIFGVGVGSTSVIVYGKGGSEIYNTELIVNKSLRLLKQT 107

Query: 127 -LRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVE--LSETFLSQSGRNQYANSSS-- 181
            L RF  ++ I V  + D VVL G+V + +  ++AV   + E    Q    +Y+++S   
Sbjct: 108 ILARFPGET-ISVSNIGDQVVLDGVVSS-ERVKKAVSRLVGEMLKKQRNVQKYSDASGGN 165

Query: 182 -------KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADF 234
                   +++N + +   +Q+ +K+T+AEV    L +IG  +S  G  +G         
Sbjct: 166 TQLEYNYHEIINNMKVLSTEQINVKITVAEVASSFLNEIGVSYSEMGGEAG--------- 216

Query: 235 GGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHL 294
             KFV++   FS K ++       V+ A+   +    LAEP L+ ISG+ ASF  GG+ +
Sbjct: 217 --KFVNKITHFSAKDIV------AVISAVGNESVGHVLAEPNLSVISGEKASFLVGGE-I 267

Query: 295 YKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS----EPVIGVNAGDMPS 350
              V    G  S++  +YGV L     V     I L +  EVS      V  V     PS
Sbjct: 268 PIGVRDDKGV-SISYKEYGVKLSMIAKVADSENIRLSLFPEVSTIDENHVTKVGQLTAPS 326

Query: 351 YRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEI 410
            + R+A+TTV+L  G + VLAGLL+ + ++    +P L  IPI+GALF +S+ +R +TE+
Sbjct: 327 LQTRRAETTVQLKDGQSFVLAGLLRSEERESLSKVPYLGDIPIIGALFSHSKTDRSKTEL 386

Query: 411 FIAATPFLVKPVAMRDLSRPDDH 433
            I AT  LV PV    +  P  H
Sbjct: 387 IIVATVNLVTPVDPDKVKLPGFH 409


>gi|320155489|ref|YP_004187868.1| type II/IV secretion system secretin RcpA/CpaC, associated with Flp
           pilus assembly [Vibrio vulnificus MO6-24/O]
 gi|319930801|gb|ADV85665.1| type II/IV secretion system secretin RcpA/CpaC, associated with Flp
           pilus assembly [Vibrio vulnificus MO6-24/O]
          Length = 488

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 126/429 (29%), Positives = 208/429 (48%), Gaps = 34/429 (7%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
           GK +++  +K   + +    + V + DP   D+V+     ++L G+ +G  N++     G
Sbjct: 25  GKVVTVPHHKSTFVALSGKAKRVSLGDPEVLDIVMLKSDELFLIGRKLGSTNLMAWDSRG 84

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
             + +++I +  D+  L+  L  F+ +  I+V    + ++L GMV T +    A+ ++ET
Sbjct: 85  NLIESINIEVTHDLNSLKQKLYEFLPEEPIQVHSAQNRLILSGMVSTQEKMNIALRVAET 144

Query: 167 FLSQSGRNQYA---NSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIG-----FQ 216
           + +    ++     NS  +K  V+NL+ I G  QV L+VT+AEV+R ++++       F+
Sbjct: 145 YAAGQQADEATASLNSQVEKSGVINLMTIGGAQQVMLEVTVAEVQRSLVRRFDSNFHFFE 204

Query: 217 HSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGV-----LDRF-----SFETVLHALERA 266
           ++  GS S  + S            G  F+V G+     L  F      F   L   +  
Sbjct: 205 NN--GSFSWGATSAGGIIDDIGGGVGPIFNVPGIDSTGLLSTFIDGDTLFTFALDIAKEN 262

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
              + LAEP LTA+SG  A F +GG+     V  S G T +   +YGV L F PT+LS  
Sbjct: 263 GVAKVLAEPNLTALSGAKAEFLAGGEFPIP-VPDSDGVT-IEYKEYGVGLKFVPTILSDK 320

Query: 327 RIGLRIQTEVSEPVI---------GVNAGD-MPSYRVRKADTTVELPSGGTIVLAGLLKD 376
           RI L +  +VSE            G NA   +P    R A +T+EL  G TI +AGLL +
Sbjct: 321 RINLNLAVDVSEIAASNTLTLSPGGTNASYFIPPITRRSASSTLELADGQTIGIAGLLSE 380

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSV 436
           +++ +   +P    IP+LG LF +  +   ETE+ I  TP L KP+    ++ P D +  
Sbjct: 381 NVRDVSSKMPGFGDIPVLGQLFSSQDYISGETELVILVTPRLAKPIDRSKITLPTDAFVE 440

Query: 437 EDDAKAFFF 445
             D K +  
Sbjct: 441 PSDLKYYLL 449


>gi|27365106|ref|NP_760634.1| type II/IV secretion system secretin RcpA/CpaC [Vibrio vulnificus
           CMCP6]
 gi|27361252|gb|AAO10161.1| Type II/IV secretion system secretin RcpA/CpaC, associated with Flp
           pilus assembly [Vibrio vulnificus CMCP6]
          Length = 488

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 126/429 (29%), Positives = 208/429 (48%), Gaps = 34/429 (7%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
           GK +++  +K   + +    + V + DP   D+V+     ++L G+ +G  N++     G
Sbjct: 25  GKVVTVPHHKSTFVALSGKAKRVSLGDPEVLDIVMLKSDELFLIGRKLGSTNLMAWDSRG 84

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
             + +++I +  D+  L+  L  F+ +  I+V    + ++L GMV T +    A+ ++ET
Sbjct: 85  NLIESINIEVTHDLNSLKQKLYEFLPEEPIQVHSAQNRLILSGMVSTQEKMNIALRVAET 144

Query: 167 FLSQSGRNQYA---NSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIG-----FQ 216
           + +    ++     NS  +K  V+NL+ I G  QV L+VT+AEV+R ++++       F+
Sbjct: 145 YAAGQQADEATASLNSQVEKSGVINLMTIGGAQQVMLEVTVAEVQRSLVRRFDSNFHFFE 204

Query: 217 HSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGV-----LDRF-----SFETVLHALERA 266
           ++  GS S  + S            G  F+V G+     L  F      F   L   +  
Sbjct: 205 NN--GSFSWGATSAGGIIDDIGGGVGPIFNVPGIDSTGLLSTFIDGDTLFTFALDIAKEN 262

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
              + LAEP LTA+SG  A F +GG+     V  S G T +   +YGV L F PT+LS  
Sbjct: 263 GVAKVLAEPNLTALSGAKAEFLAGGEFPIP-VPDSDGVT-IEYKEYGVGLKFVPTILSDK 320

Query: 327 RIGLRIQTEVSEPVI---------GVNAGD-MPSYRVRKADTTVELPSGGTIVLAGLLKD 376
           RI L +  +VSE            G NA   +P    R A +T+EL  G TI +AGLL +
Sbjct: 321 RINLNLAVDVSEIAASNTLTLSPGGTNASYFIPPITRRSASSTLELADGQTIGIAGLLSE 380

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSV 436
           +++ +   +P    IP+LG LF +  +   ETE+ I  TP L KP+    ++ P D +  
Sbjct: 381 NVRDVSSKMPGFGDIPVLGQLFSSQDYISGETELVILVTPRLAKPIDRSKITLPTDAFVE 440

Query: 437 EDDAKAFFF 445
             D K +  
Sbjct: 441 PSDLKYYLL 449


>gi|297581608|ref|ZP_06943530.1| flp pilus assembly protein [Vibrio cholerae RC385]
 gi|297534015|gb|EFH72854.1| flp pilus assembly protein [Vibrio cholerae RC385]
          Length = 469

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 120/434 (27%), Positives = 207/434 (47%), Gaps = 42/434 (9%)

Query: 54  LNKVIILQVPVDVQDVLVSDPTKADVVVHSP--RTMYLFGKNVGQANVILIGHDGKQMLN 111
           +N+  I+ V  D+QDV VSDP    VVVH+P  R + + GK++G  +++++G + + + +
Sbjct: 29  VNQNQIITVDGDIQDVFVSDPKI--VVVHAPSSRHVMVSGKDIGSTDLLIMGENAQTLAH 86

Query: 112 LDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL--- 168
             + +  D++ LE  ++    ++NIR       +V+ G V     +   + ++  F    
Sbjct: 87  YKLNVNADLSELERAVQHAFPEANIRFAYSKGAIVVMGEVANPLQAHEVLSMASGFARGL 146

Query: 169 ---SQSGRNQYANSSS-----------------KKVMNLLNIAGEDQVTLKVTIAEVRRD 208
               Q   +  ANS+S                 K V+N L   G  QV + + I E+ R 
Sbjct: 147 QKPEQQTLDMPANSASSGRDSGAAKPGGGIGDYKFVVNQLKTQGSAQVNISIRIVEMERA 206

Query: 209 ILKQIGFQHSITGSSSGPS-----KSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHAL 263
             +Q+G + S  G+    +      +  A  G KF +     ++     +     ++ AL
Sbjct: 207 TSEQLGLRWSSIGNMRWGTWDTLQTALGATPGNKFPTN----TLPSGNGQHGLNVIIDAL 262

Query: 264 ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVL 323
              + +  LAEP LTA SG++A+F SGG+  +  V +     S+    +G+ L  TPTVL
Sbjct: 263 VENSLVNVLAEPNLTAKSGEAATFMSGGEFPFP-VDNGDDGVSIEFKKFGIALEVTPTVL 321

Query: 324 SPGRIGLRIQTEVS----EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQ 379
           S  +I L +  EVS    E  + +   ++P    R+A TT+EL  G +  LAGL++    
Sbjct: 322 SNRQISLTVAPEVSTLSRENSVSIAGVEVPGIETRRATTTIELADGQSFALAGLVRTYQD 381

Query: 380 QLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA-MRDLSRPDDHYSVED 438
              E +P L +IPIL   F  + F   E+E+ I AT  LV+P +   +L+ P D Y    
Sbjct: 382 HKVEALPFLGEIPILAPFFSTNSFKNSESELVIIATARLVEPSSDPAELTTPLDRYRPAS 441

Query: 439 DAKAFFFNRVNKIY 452
             +  F +++ + +
Sbjct: 442 RFERLFLHKMGETH 455


>gi|37680844|ref|NP_935453.1| Flp pilus assembly protein, secretin CpaC [Vibrio vulnificus YJ016]
 gi|37199593|dbj|BAC95424.1| Flp pilus assembly protein, secretin CpaC [Vibrio vulnificus YJ016]
          Length = 488

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 126/429 (29%), Positives = 208/429 (48%), Gaps = 34/429 (7%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
           GK +++  +K   + +    + V + DP   D+V+     ++L G+ +G  N++     G
Sbjct: 25  GKVVTVPHHKSTFVALSGKAKRVSLGDPEVLDIVMLKSDELFLIGRKLGSTNLMAWDSRG 84

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
             + +++I +  D+  L+  L  F+ +  I+V    + ++L GMV T +    A+ ++ET
Sbjct: 85  NLIESINIEVTHDLNSLKQKLYEFLPEEPIQVHSAQNRLILSGMVSTQEKMNIALRVAET 144

Query: 167 FLSQSGRNQYA---NSSSKK--VMNLLNIAGEDQVTLKVTIAEVRRDILKQIG-----FQ 216
           + +    ++     NS  +K  V+NL+ I G  QV L+VT+AEV+R ++++       F+
Sbjct: 145 YAAGQQADEATASLNSQVEKSGVINLMTIGGAQQVMLEVTVAEVQRSLVRRFDSNFHFFE 204

Query: 217 HSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGV-----LDRF-----SFETVLHALERA 266
           ++  GS S  + S            G  F+V G+     L  F      F   L   +  
Sbjct: 205 NN--GSFSWGATSAGGIIDDIGGGVGPIFNVPGIDSTGLLSTFIDGDTLFTFALDIAKEN 262

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
              + LAEP LTA+SG  A F +GG+     V  S G T +   +YGV L F PT+LS  
Sbjct: 263 GVAKVLAEPNLTALSGAKAEFLAGGEFPIP-VPDSDGVT-IEYKEYGVGLKFVPTILSDK 320

Query: 327 RIGLRIQTEVSEPVI---------GVNAGD-MPSYRVRKADTTVELPSGGTIVLAGLLKD 376
           RI L +  +VSE            G NA   +P    R A +T+EL  G TI +AGLL +
Sbjct: 321 RINLNLAVDVSEIAASNTLTLSPGGTNASYFIPPITRRSASSTLELADGQTIGIAGLLSE 380

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSV 436
           +++ +   +P    IP+LG LF +  +   ETE+ I  TP L KP+    ++ P D +  
Sbjct: 381 NVRDVSSKMPGFGDIPVLGQLFSSQDYISGETELVILVTPRLAKPIDRSKITLPTDAFVE 440

Query: 437 EDDAKAFFF 445
             D K +  
Sbjct: 441 PSDLKYYLL 449


>gi|295700370|ref|YP_003608263.1| type II and III secretion system protein [Burkholderia sp.
           CCGE1002]
 gi|295439583|gb|ADG18752.1| type II and III secretion system protein [Burkholderia sp.
           CCGE1002]
          Length = 634

 Score =  158 bits (400), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 121/432 (28%), Positives = 216/432 (50%), Gaps = 36/432 (8%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           EI     +S+ + K I++ +    ++  + +P  A   + S RT+Y+ G +VG  N+I+ 
Sbjct: 97  EIRDESNVSVAVGKSILVPLVEPARNRTLGNPVVAQATLVSQRTLYVVGMSVGTTNMIVQ 156

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           G  G   + +D+ +  D   L+ TL + + +   IRV   +  +VL G V + Q +Q+A+
Sbjct: 157 GRSGACQI-IDVSVGVDAEGLQRTLAQLLPNERGIRVSSAAGNLVLAGRVSSGQAAQQAM 215

Query: 162 ELSETFLSQSGRNQYANSSSK------------------KVMNLLNIAGEDQVTLKVTIA 203
            ++  +       Q  +S++                   +V+N++ +    QV L+V +A
Sbjct: 216 SIAGAYAGAQPTQQDQSSTASFGNGGSISQQSSSVSKGSEVINMMTVDSPQQVMLEVKVA 275

Query: 204 EVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHAL 263
           EV + +L Q+G   +I G     + +  +      VS G   +V    +R  F   + A 
Sbjct: 276 EVSKTLLNQLGAAVNIQGGFGSWTGALVSSLLAG-VSSG--VAVSKANNR-PFNIAVDAQ 331

Query: 264 ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV-SSSTGATSVTTHD--YGVVLHFTP 320
           +  +  + LAEP L  +SGQ ASF +GG+       S+ TG +++T  +  +GV L FTP
Sbjct: 332 KSDSLGKILAEPNLVTLSGQEASFLAGGRVFIPVPQSNGTGGSTITLQEEEFGVGLKFTP 391

Query: 321 TVLSPGRIGLRIQTEVSE--PV-IGVNAGD------MPSYRVRKADTTVELPSGGTIVLA 371
           TVL+  R+ L++  EVSE  P  + V A        +P    R+A TTV++  G +  + 
Sbjct: 392 TVLAGSRVNLKVAPEVSELSPTGVTVQATGTSSTAILPLITTRRASTTVQMNDGESFAIG 451

Query: 372 GLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           GL++++I    + +P + ++P+LGALFR++ F ++ TE+    T  LVKP+   D   P 
Sbjct: 452 GLIQNNITGALKALPGIGEVPVLGALFRSTSFQQDRTELIFIVTVHLVKPLPPGDYPLPT 511

Query: 432 DHYSVEDDAKAF 443
           D ++   D   +
Sbjct: 512 DSFTGVSDGTVY 523


>gi|299532592|ref|ZP_07045981.1| type II and III secretion system protein [Comamonas testosteroni
           S44]
 gi|298719395|gb|EFI60363.1| type II and III secretion system protein [Comamonas testosteroni
           S44]
          Length = 520

 Score =  158 bits (399), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 119/380 (31%), Positives = 192/380 (50%), Gaps = 31/380 (8%)

Query: 78  DVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADS-NI 136
           +V + SPR ++  G+  G  NVIL    G   +  D+++  D   L+  L   + +   I
Sbjct: 98  EVQLLSPRDLFFRGRKSGSMNVILQNAQGACFIK-DVIVTMDPGPLQTKLSELMPEERGI 156

Query: 137 RVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQV 196
           RV+   + +VL G +         V L+  +           S SKK++NLL      QV
Sbjct: 157 RVQGADNALVLSGEISNPLRLDDVVTLAGAY-----------SDSKKIVNLLRTTSPHQV 205

Query: 197 TLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSF 256
            L+V IAEV + +L ++G   +    +S    +F+      F+S GG       + + S 
Sbjct: 206 MLEVKIAEVSKTLLDKLGASLAGQRITSNGMNTFS--IASNFLSGGGGLLSAMRIGKGSI 263

Query: 257 ETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT---HDYG 313
              +   +    +R LAEP + AISGQ ASF SGG+       S+T    V T    ++G
Sbjct: 264 S--IDGQKDDGLVRILAEPNIMAISGQQASFLSGGKIFIPVSQSNTNGVPVMTLEEKEFG 321

Query: 314 VVLHFTPTVLSPGRIGLRIQTEVSE------PVIGVNA--GDMPSYRVRKADTTVELPSG 365
           + + FTPTVL   R+ L++ +EVS+      P   +N     +PS  VR+ADTTV+L  G
Sbjct: 322 IGVKFTPTVLGSSRVNLKLVSEVSDLSQTGSPFTAINGVTSVIPSLSVRRADTTVQLNDG 381

Query: 366 GTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMR 425
            ++V+AGL+K++I +  +  P L +IP+LGAL R++ F  ++TE+    TP LV+  A+ 
Sbjct: 382 QSLVIAGLIKNNITEAVKRFPGLGEIPVLGALARSTEFQTDQTELMFIITPRLVQ--ALA 439

Query: 426 DLSR-PDDHYSVEDDAKAFF 444
           +  R P D++     A+ + 
Sbjct: 440 EAPRVPTDNHVPPSRAEVYL 459


>gi|227820510|ref|YP_002824481.1| type II and III secretion system protein RhcC2 [Sinorhizobium
           fredii NGR234]
 gi|227339509|gb|ACP23728.1| type II and III secretion system protein RhcC2 [Sinorhizobium
           fredii NGR234]
          Length = 447

 Score =  158 bits (399), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 115/392 (29%), Positives = 190/392 (48%), Gaps = 18/392 (4%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
            G+ + + + +  IL+    V+ V ++D   ADV V SP  +Y++    G  N+I +  D
Sbjct: 43  NGQVLELTVGEGTILRFDEPVESVFLADTAIADVRVVSPGVVYIYATKTGDTNLIALSAD 102

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
                 + + +  +    E +       + + + +     V  G  R + +   A+++  
Sbjct: 103 QMTRGTVQVRVSGNPRAAEQSALALQPTTRVDISLFGGQYVGTGQTRNVGE---AMDMES 159

Query: 166 TFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSG 225
              S S       +  +  +N   IAG +QV ++V  AEV R+ L + G   S+  +S  
Sbjct: 160 VLQSYS-------TPDRPALNNTTIAGSNQVNIRVRFAEVARNELTRFGIDWSLFVNSG- 211

Query: 226 PSKSFA-ADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
            S SF     GG    +    ++    D  +   +L AL+    +  LAEP +TA++GQ+
Sbjct: 212 -SFSFGIVRTGGASNEDDTGIAIGARGDHVNVNVLLDALQANGILTILAEPNITAVTGQT 270

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN 344
           ASF +GG+ +   V +  G   +    +GV L FTPT+L   RI L+++ EVS       
Sbjct: 271 ASFLAGGE-IPVPVPAGDGQIGIEYKQFGVSLQFTPTLLPNNRIALQVRPEVSSVSQDSV 329

Query: 345 AGD----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
                  +PS R+R+ADT VE+ SG T  +AGL +    Q     P++  +PILG LF++
Sbjct: 330 VSISGLVVPSLRIRRADTAVEVGSGQTFAIAGLFQRQESQTLNKTPVVGDVPILGELFKS 389

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSRPDD 432
            RF R ETE+ I  TP+LV P + R++  P D
Sbjct: 390 KRFQRNETELVILITPYLVTPTSERNMKTPLD 421


>gi|149911409|ref|ZP_01900027.1| Flp pilus assembly protein, secretin CpaC [Moritella sp. PE36]
 gi|149805517|gb|EDM65522.1| Flp pilus assembly protein, secretin CpaC [Moritella sp. PE36]
          Length = 489

 Score =  157 bits (398), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 119/416 (28%), Positives = 199/416 (47%), Gaps = 42/416 (10%)

Query: 60  LQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERD 119
           LQ+   +  V V +   AD+++   R +Y+ GK +G  N+++   D   +   ++ +  D
Sbjct: 55  LQMDKAIHRVSVGNSDIADILILRSRELYIVGKRLGTTNMMVWDKDDNLVHVQNLEVTHD 114

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANS 179
           +  L   L +++ + +I VE     +V+ G V ++     AVE++E + + +        
Sbjct: 115 LNSLRKRLYKYLPNEDIGVETSQGQLVVSGQVSSLVKMNTAVEIAEGYATAAN----VGK 170

Query: 180 SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI------------GFQHSITGSSSGPS 227
           S+  V+N++++ G  QV L+VT+AEV  DI + +            GF    TG+ + P+
Sbjct: 171 SNSIVVNMMSVGGGQQVMLEVTVAEVSTDIGRNLDGNTVLGAFGSDGFAGIGTGTGNVPT 230

Query: 228 K---SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
               S   +   ++++  GD           F       +     + LAEP LTA+SGQS
Sbjct: 231 NILGSIDTNIFARYLT--GDML---------FSVAFDVAKSKGLTKILAEPNLTALSGQS 279

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PV 340
           A F SGG+  Y    S+    ++   D+GV + F PTVL  G+I L ++  VSE      
Sbjct: 280 AEFLSGGE--YPVPVSTDDGITIEYRDFGVGVSFVPTVLDSGKINLNLKVLVSELSSVNS 337

Query: 341 IGVNAGDM------PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPIL 394
           + ++A D       PS   R   TTVEL  G TIV+ GLL D +++     P L  IPIL
Sbjct: 338 VTISASDTNTSTITPSLIKRSTATTVELGDGQTIVIGGLLSDSLRESITKFPGLGDIPIL 397

Query: 395 GALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNK 450
           G LF +  +   +TE+ I  TP LV+P     +  P D +    D + +   ++ +
Sbjct: 398 GQLFTSQEYISGQTELVIMVTPRLVRPFNKDGMILPTDGFVPVSDMEFYLLGKMTQ 453


>gi|254506750|ref|ZP_05118890.1| Flp pilus assembly protein, secretin CpaC [Vibrio parahaemolyticus
           16]
 gi|219550331|gb|EED27316.1| Flp pilus assembly protein, secretin CpaC [Vibrio parahaemolyticus
           16]
          Length = 487

 Score =  157 bits (397), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 124/431 (28%), Positives = 213/431 (49%), Gaps = 34/431 (7%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
           GK + +  +K   + +    + V + DP   D+V+     ++L GK +G  N++     G
Sbjct: 25  GKIVKVPHHKSTHVTLAGKAKRVSLGDPEVLDIVMLKSDEVFLIGKKLGSTNLMAWDRRG 84

Query: 107 KQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           + + +++I +  D+  L+  L  F+ +  I+V    + ++L G + +      A+ ++ET
Sbjct: 85  QLIESINIEVTHDLNSLKAKLYEFLPNEEIKVHSAQNRLILSGQISSQSAMNIALRVAET 144

Query: 167 FLSQSGRNQYANSSSKKV-----MNLLNIAGEDQVTLKVTIAEVRRDILKQIG-----FQ 216
           + +    ++   S S++V     +NL+ I G  QV L+VT+AEV+R ++++       F+
Sbjct: 145 YSAGQEVDKENKSLSEQVQKTGVINLMTIGGAQQVMLEVTVAEVQRSLVRKFDSNFHFFE 204

Query: 217 HSITGSSSGPSK-SFAADFGGK----FVSEGGDFSVKGVLDRF-----SFETVLHALERA 266
            + + S  G S  +   D GG     F + G D +  G+L  F      F   L   ++ 
Sbjct: 205 SNGSFSWGGTSAGAIIDDVGGGIGPIFNTPGIDST--GLLGTFIDGDTLFTFALDIAKQN 262

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
              + LAEP LTA+SG  A F +GG+     V    G T +   +YGV L F PTVLS  
Sbjct: 263 GTAKVLAEPNLTALSGAKAEFLAGGEFPIP-VPDENGIT-IEYKEYGVGLKFIPTVLSDK 320

Query: 327 RIGLRIQTEVSE----PVIGVNAGD------MPSYRVRKADTTVELPSGGTIVLAGLLKD 376
            I L +  +VSE      + ++ G       +P    R A +T+EL  G TI +AGLL +
Sbjct: 321 NINLNLAVDVSEIANTSSLTLSPGGTNSTYVIPPITRRSASSTLELADGQTIGIAGLLSE 380

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSV 436
           +++ +  G+P  S IP+LG +F +  +   ETE+ I  TP L KP+    +S P D +  
Sbjct: 381 NVRDVVSGMPGFSDIPVLGQMFNSQEYISGETELVILVTPRLAKPIDRNRVSLPTDSFVE 440

Query: 437 EDDAKAFFFNR 447
            +D + +   R
Sbjct: 441 PNDFEYYLLGR 451


>gi|218660088|ref|ZP_03516018.1| pilus assembly secretion protein [Rhizobium etli IE4771]
          Length = 157

 Score =  156 bits (395), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 82/152 (53%), Positives = 109/152 (71%), Gaps = 4/152 (2%)

Query: 248 KGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSV 307
           K  + ++   T L+ALE+A  +RTLAEPTLTAISGQ+A+F SGGQ LY T + + G  +V
Sbjct: 10  KSSIGKYDISTYLNALEQAKVVRTLAEPTLTAISGQAATFNSGGQQLYST-TDNDGNVTV 68

Query: 308 TTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGT 367
              +YG+ L F P VLS GRI L I+T VSEPV G  +G+  +Y+ R A+T+VELPSGG+
Sbjct: 69  VPFNYGINLAFKPVVLSSGRISLEIKTNVSEPVAG--SGNA-TYQRRSAETSVELPSGGS 125

Query: 368 IVLAGLLKDDIQQLKEGIPLLSKIPILGALFR 399
           I LAGL++D++ Q   G P +SKIP+LG LFR
Sbjct: 126 IALAGLIRDNVSQTMGGTPGVSKIPLLGTLFR 157


>gi|307726375|ref|YP_003909588.1| type II and III secretion system protein [Burkholderia sp.
           CCGE1003]
 gi|307586900|gb|ADN60297.1| type II and III secretion system protein [Burkholderia sp.
           CCGE1003]
          Length = 616

 Score =  156 bits (395), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 120/424 (28%), Positives = 211/424 (49%), Gaps = 35/424 (8%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           + + + + K  ++     V++  + +P  A   + SP+T+Y+ G  VG  N+I+ G  G 
Sbjct: 89  RTVVVPVGKSTLMPTAEPVRNRTLGNPLVAQATMVSPQTLYVVGMAVGTTNMIVQGKSGA 148

Query: 108 QMLNLDILIERDIAHLEMTLRRFIAD-SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
             + +++++  D   L+ +L + + D  NIRV  V+  +VL G V + Q + +A E+++ 
Sbjct: 149 CEV-INVVVNADSGGLQTSLSQLMPDEPNIRVSTVAGDLVLAGRVSSAQAAAQAQEIAKA 207

Query: 167 FLSQS--------GRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
           +   +          N  A   +  V+N++++    QV L+V +AEV + +L Q+G   +
Sbjct: 208 YARSTLPGASGGANGNGTAAGKTATVLNMMSVDSPQQVMLEVKVAEVSKTVLNQLGAAMN 267

Query: 219 ITGSSSGPSKSFAADFGGKFVSE--GGDFSVKGV--LDRFSFETVLHALERATAIRTLAE 274
           I G        F + + G  +S    G  S+  V   +   F   +        ++ LAE
Sbjct: 268 IQGG-------FGS-WSGALISSLLAGVSSIVDVNKANNRPFNVAIDGQHGDNLVKILAE 319

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATS---VTTHDYGVVLHFTPTVLSPGRIGLR 331
           P L  +SGQ A+F +GG+       S+    S   +   ++GV L FTPTVL+ GRI L+
Sbjct: 320 PNLVTLSGQEATFLAGGKVFIPIPQSNLNGVSTIILQEEEFGVGLKFTPTVLAGGRINLK 379

Query: 332 IQTEVSE-PVIGVNAGD--------MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLK 382
           +  EVSE    GV  G         +P    R+A TTV++  G T  + GL+K++     
Sbjct: 380 VAPEVSELSSTGVTVGATNTNNLTVLPLITTRRASTTVQMNDGETFAIGGLIKNNAAGTL 439

Query: 383 EGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV-AMRDLSRPDDHYSVEDDAK 441
           + IP + ++P+LGALFR++ + ++ TE+    TP LVKP+    +L  P D     ++A 
Sbjct: 440 KAIPGVGEVPVLGALFRSTSYQQDRTELVFIITPHLVKPLQTAANLPLPTDRLKTPNEAD 499

Query: 442 AFFF 445
            +  
Sbjct: 500 VYLM 503


>gi|317491683|ref|ZP_07950118.1| type II and III secretion system protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316920117|gb|EFV41441.1| type II and III secretion system protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 467

 Score =  156 bits (395), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 112/398 (28%), Positives = 203/398 (51%), Gaps = 42/398 (10%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           ++QV  ++  + +S P  AD  +   R + ++ K+ G+ ++I    +G Q++   ++++ 
Sbjct: 51  VIQVNGNIDTIFISAPKVADYEIIGERGVMVYAKSEGKTDLIAFDKNGDQLVKTTLVVDP 110

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS---GRNQ 175
            ++ L+  +   + DS I ++ +  T +L G V T +D  R  ++    +  +    + +
Sbjct: 111 ILSSLQKKVSSLVPDSQITLQKMGKTYILSGSVATEEDRDRVYQIVGEGVGATRTTNKKE 170

Query: 176 YANSSS------------------KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH 217
            AN++                   ++V+N L +   +QV +K+++ EV +     +G   
Sbjct: 171 VANTNGGSGGNGENSNSWLDEVVYQEVINQLKLPMTNQVNVKLSVVEVTKTFSDNVGIDW 230

Query: 218 -SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPT 276
            +I+GS             G  ++ G    VK   D  S  +++HA+   +  R LAEP 
Sbjct: 231 GTISGS-------------GGNITPGTFRFVKFNADTLS--SLVHAISNDSVARVLAEPN 275

Query: 277 LTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           L+ +SG+SA F  GG+     V+SS   ++V   D+G+ L+    V S  RI + +  EV
Sbjct: 276 LSVLSGESAEFLVGGE--VPVVTSSANGSNVQYKDFGIKLNVGAKVSSNKRIRVTLGEEV 333

Query: 337 S--EPVIGVNAGD-MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPI 393
           S  +     NAGD  P+++ R+A TTVEL  G + +L GL+ ++ ++    +P +  +PI
Sbjct: 334 SNVDSTYSTNAGDSFPAFQTRRAKTTVELADGESFLLGGLISNNEREELSRLPFIGDVPI 393

Query: 394 LGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           LGALFRN++  R   E+ + AT  LVKPV MRD+  PD
Sbjct: 394 LGALFRNAKTERSRGELVVVATVNLVKPVTMRDIVMPD 431


>gi|145219384|ref|YP_001130093.1| type II and III secretion system protein [Prosthecochloris
           vibrioformis DSM 265]
 gi|145205548|gb|ABP36591.1| type II and III secretion system protein [Chlorobium
           phaeovibrioides DSM 265]
          Length = 472

 Score =  156 bits (395), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 132/447 (29%), Positives = 209/447 (46%), Gaps = 54/447 (12%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + +G ++V  L+ P+  + V V +P  AD ++ +   +YL GK  G  N+IL    GK  
Sbjct: 39  VPVGESRVYRLEQPI--KRVAVGNPEVADYIMLNSSELYLLGKKTGATNLILWNQQGKFT 96

Query: 110 LNLDILIERDIAHLEMTLRRFIAD-SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
             L + + R+   ++  LR  + + S I++    + +VL G V     ++ A  L + +L
Sbjct: 97  STL-LQVSRNSYPIKQLLRTALPEESEIQIFSSGEALVLAGSVSNRLAAETAYRLVKAYL 155

Query: 169 SQSGRNQYANSSSKK----------------------------------VMNLLNIAGED 194
                +    SS  K                                  V+NLL +    
Sbjct: 156 GGKVPDVNPESSLAKTTSASAASASIAGTTNGSSAVPVQASTQSTAPAGVVNLLTVRDTQ 215

Query: 195 QVTLKVTIAEVRRDILKQ--IGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLD 252
           QV L+V IAEV +  L+   IG+Q   TG++ G            FVS      +     
Sbjct: 216 QVRLEVRIAEVSKTYLQTLGIGWQQG-TGNTQG-------SLMTGFVSNATLNVLLQTKS 267

Query: 253 RFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDY 312
               E  + A  +   I+ LAEPTL A+SG+   F  GG+    TV+S+ GA       Y
Sbjct: 268 NPGNELSMDAERKEGVIKILAEPTLVAMSGEEGYFLVGGKVFTPTVTSN-GAIDYVERTY 326

Query: 313 GVVLHFTPTVLSPGRIGLRIQTEVSEPVI-GVNAGD---MPSYRVRKADTTVELPSGGTI 368
           GV L FTPTVL  GRI L++  EVSEP+   V AG    +P ++   A +TV++  G  +
Sbjct: 327 GVGLRFTPTVLDSGRISLKVAPEVSEPLKEAVTAGTSTPLPGFKTSFASSTVQMNEGENL 386

Query: 369 VLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLS 428
           V+ GLL+D++ ++   +PLLS IPILG+LFR++  + E TE+ +   P L+K  +     
Sbjct: 387 VIGGLLRDNLTEVVRAVPLLSDIPILGSLFRHTEKSSETTELMVIIRPTLIK-ASTTAQE 445

Query: 429 RPDDHYSVEDDAKAFFFNRVNKIYGPK 455
            P D ++    ++ F   ++    G K
Sbjct: 446 LPTDKFAPPSSSELFLEGKLQGSRGSK 472


>gi|258405291|ref|YP_003198033.1| type II and III secretion system protein [Desulfohalobium retbaense
           DSM 5692]
 gi|257797518|gb|ACV68455.1| type II and III secretion system protein [Desulfohalobium retbaense
           DSM 5692]
          Length = 455

 Score =  155 bits (393), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 124/422 (29%), Positives = 205/422 (48%), Gaps = 42/422 (9%)

Query: 38  NISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPT-KADVVVHSPRTMYLFGKNVGQ 96
           N +D  I +  +++ G  K ++L+   ++  V   DP    D ++  P  +YL     G 
Sbjct: 42  NSADDSIMRSLELTYG--KSVVLKSNREITRVSEPDPNVLKDPLLIGPNELYLTPAGAGT 99

Query: 97  ANVILIGHDGKQMLNL-DILIERDIAHLEMTLRRFIADSN-IRVEMVSDTVVLHGMVRTI 154
           AN+IL    GK++  + +I ++ D++ L+  L     + N +RV   ++++ L G V + 
Sbjct: 100 ANLIL--WQGKEVSTVYEITVKHDLSRLKQRLHELFPEENELRVLSTNESITLSGQVSSA 157

Query: 155 QDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
               + + L+ET+  + G           + N + + G  QV L+V +AEV R  L ++G
Sbjct: 158 SALDQIMALAETYAPEGG-----------IKNQVTVKGIHQVMLEVKVAEVSRQSLDRLG 206

Query: 215 FQHSITGSSSGPSKSFAADFGGKFVSEGG---------DFSVKGVLDRFSFETVLHALER 265
               +           AA+F   F+             +F   G  D   F  +   L+R
Sbjct: 207 INFDLIND--------AAEFSIGFLGAASAGSSGSGSFNFWRNG--DNVDFNGLFDFLKR 256

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
               + LAEP+L ++SGQ++SF +GG+     V S  G   V    YG+ L FTPTV+S 
Sbjct: 257 EGLAKILAEPSLISMSGQTSSFLAGGEIPIPDVDSD-GNIGVEFKSYGIELAFTPTVMSK 315

Query: 326 GRIGLRIQTEVSE--PVIG--VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
            RI +++   VSE     G  +N   +P  +VR+A+TTVEL  G +  +AGLL ++ ++ 
Sbjct: 316 ERIAIKVVPVVSELDEASGTVINGAQVPGLKVRRANTTVELGDGQSFAIAGLLSENSEET 375

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAK 441
               P L  +P+LG LF +  F  +ETE+ I  TP LV P+     S P D +    DA+
Sbjct: 376 VSKFPGLGDLPVLGPLFTSKSFTSDETELVIMVTPKLVTPLVAEKQSLPTDFFIHPTDAE 435

Query: 442 AF 443
            +
Sbjct: 436 FY 437


>gi|260776715|ref|ZP_05885610.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio coralliilyticus ATCC BAA-450]
 gi|260607938|gb|EEX34203.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio coralliilyticus ATCC BAA-450]
          Length = 476

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 126/434 (29%), Positives = 207/434 (47%), Gaps = 53/434 (12%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
           +GK K++S+G                   DP   D+V+     ++L GK +G  N++   
Sbjct: 30  VGKAKRVSLG-------------------DPEVLDIVMLKSNEVFLIGKKLGSTNLMAWD 70

Query: 104 HDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL 163
             G+ + +++I +  D+  L+  L  F+ D  I V    + ++L G+V +      A+ +
Sbjct: 71  SRGRLIESINIEVTHDLNSLKAKLFEFLPDEEIGVHSAQNRLILSGLVSSQSAMNIALRV 130

Query: 164 SETFLSQSGRNQYANSSSKKV-----MNLLNIAGEDQVTLKVTIAEVRRDILKQIG---- 214
           +ET+ +    ++   S S++V     +NLL I G  QV L+VT+AEV+R ++++      
Sbjct: 131 AETYAAGQEVDKETESLSEQVSKTGVINLLTIGGAQQVMLEVTVAEVQRTLVRKFDSNFH 190

Query: 215 -FQHS----ITGSSSGPS-----KSFAADFGGKFVSEGGDFSVKGVLDRFSFET-VLHAL 263
            FQ S      G+S+G S        A  F    +   G      ++D  +F T  L   
Sbjct: 191 FFQSSGDFNWGGTSAGGSIDDVNNVVAPIFNAPTIENTGLLGT--LIDSNTFFTFALDIA 248

Query: 264 ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVL 323
           ++    + LAEP LTA+SG  A F +GG+     V    G T +   +YGV L F PT+L
Sbjct: 249 KQNGTAKVLAEPNLTALSGAKAEFLAGGEFPIP-VPDEDGIT-IEYKEYGVGLKFIPTIL 306

Query: 324 SPGRIGLRIQTEVSEPVI---------GVNAGD-MPSYRVRKADTTVELPSGGTIVLAGL 373
           +  +I L +  +VSE            G NA   +P    R A +T+EL  G TI +AGL
Sbjct: 307 TDQKINLNLAVDVSEIANSATLTLAPGGTNATYVIPPITRRSASSTLELADGQTIGIAGL 366

Query: 374 LKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDH 433
           L ++++     +P  S IPILG +F +  +   ETE+ I  TP L KP+    ++ P D 
Sbjct: 367 LSENVRDSVAEMPGFSDIPILGQMFNSQEYISGETELVILVTPRLAKPIDRNRVTLPTDS 426

Query: 434 YSVEDDAKAFFFNR 447
           +   +D + +   R
Sbjct: 427 FVEPNDFEYYLLGR 440


>gi|238782881|ref|ZP_04626910.1| Type II/III secretion system protein [Yersinia bercovieri ATCC
           43970]
 gi|238716304|gb|EEQ08287.1| Type II/III secretion system protein [Yersinia bercovieri ATCC
           43970]
          Length = 426

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 116/395 (29%), Positives = 197/395 (49%), Gaps = 29/395 (7%)

Query: 45  GKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGH 104
              K + I   +  I++   ++  V VS    AD  + +  ++ ++ K+ G   +IL   
Sbjct: 17  ANAKSVYISPGESYIIKTEAEIDTVFVSSAAVADYELVNKNSIIVYAKSEGTTEIILFDD 76

Query: 105 DGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQR-AVEL 163
             + +    IL+   I      +     DSNI ++ + D+ +L G+V + ++    A  +
Sbjct: 77  KHQVLAKKTILVNNIINAANKRVLIEYPDSNIDIDKIGDSYILTGIVESEEEKDTLATIV 136

Query: 164 SETFLSQ----SGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI 219
            E   SQ    S R   +      ++N L +   +QV +K+TIAEV +D  + +G   S 
Sbjct: 137 GEAIGSQKEKTSERQYLSTPDYAHIVNKLKLPQANQVNVKLTIAEVTKDFTENVGVDWST 196

Query: 220 TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            G + G   SF      +FV     F+  G+       T++HA+   +  R LAEP L+ 
Sbjct: 197 MGDAIG---SF------QFVK----FNANGI------STLVHAINDESIARVLAEPNLSV 237

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE- 338
           +SG+SASF  GG+      S++  + +VT  ++G+ L+    V    RI + +  EVS  
Sbjct: 238 LSGESASFLVGGE--IPIASNTENSQTVTYKEFGIKLNIGAKVNEKKRIRILLNEEVSSI 295

Query: 339 -PVIGVNAGD-MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
                +  GD  PS + RKA TT+EL  G + +L GL+ +  ++  + IP +  IPILGA
Sbjct: 296 GKSFSMEGGDSYPSLKTRKAATTLELGDGESFILGGLISNSERESLKKIPFIGDIPILGA 355

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           LFRN++  + +TE+ + AT  LVKPV+ +++  PD
Sbjct: 356 LFRNAQTEQSQTELVVIATVNLVKPVSRKEIELPD 390


>gi|238793622|ref|ZP_04637245.1| Type II/III secretion system protein [Yersinia intermedia ATCC
           29909]
 gi|238727037|gb|EEQ18568.1| Type II/III secretion system protein [Yersinia intermedia ATCC
           29909]
          Length = 425

 Score =  155 bits (391), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 115/383 (30%), Positives = 195/383 (50%), Gaps = 32/383 (8%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           I++   ++  V VS    AD  +    ++ ++ K  G A  IL   D   M+   I++  
Sbjct: 29  IIKTEEEIDTVFVSTAAIADYELVGKNSIIVYAKKEGTAEFILFNKDNHPMIKTTIMVND 88

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRT--IQDSQRAVELSETFLSQSGRNQ- 175
            I      ++    DSN+ +  + ++ +L G   +   +D+  A+ + E    +  +N+ 
Sbjct: 89  IITSAYQRIKIEYPDSNVEINKIGNSYLLTGKAESEEAKDTIAAI-IGEAINKKREQNRE 147

Query: 176 ---YANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS-ITGSSSGPSKSFA 231
              + N +   V+N + +   +QV +K+TIAEV +D  + IG   S I+ +S G   SF 
Sbjct: 148 DQHFNNPNYLGVINKIKLPESNQVNVKLTIAEVTKDFSENIGVDWSSISEASVG---SF- 203

Query: 232 ADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGG 291
                KF+     F+  G+       T++HA+   +  R LAEP L+ +SG+SASF  GG
Sbjct: 204 -----KFLK----FNATGI------STLVHAINDDSIARVLAEPNLSVLSGESASFLVGG 248

Query: 292 QHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGVNAGD-M 348
           +      +++  +T +    YG+ L+    V    RI + ++ EVS  + V  V  G+  
Sbjct: 249 E--IPMFNTNQNSTIIKYKTYGIKLNIAAKVNEKNRIRISMEEEVSSVDKVFNVEGGNAY 306

Query: 349 PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREET 408
           PS R RKA TT+EL  G + +L GL+    ++  + IP +  IPILGA FRN++  +++T
Sbjct: 307 PSLRTRKAATTLELGDGESFILGGLISKSERESLKKIPFIGDIPILGAFFRNAQTQKQQT 366

Query: 409 EIFIAATPFLVKPVAMRDLSRPD 431
           E+ + AT  LV PVA +D+  PD
Sbjct: 367 ELVVVATVSLVNPVAGKDVELPD 389


>gi|77919345|ref|YP_357160.1| Flp pilus assembly protein CpaC [Pelobacter carbinolicus DSM 2380]
 gi|77545428|gb|ABA88990.1| Flp pilus assembly protein CpaC [Pelobacter carbinolicus DSM 2380]
          Length = 507

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 127/450 (28%), Positives = 211/450 (46%), Gaps = 39/450 (8%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPR-----TMYLFGKNVGQANVILIGH 104
           ++IG ++++ ++ P     +L+S+    D++   P       +Y  GK +G + V +   
Sbjct: 38  VNIGGSELVEIREPSQRMKILISN---GDIIGARPLRPNLINVYNLGKKIGFSRVTVWDD 94

Query: 105 DGKQMLNL-DILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL 163
             +Q+  + D+ +  D+  L+  +       NI+V      VVL G V + +  ++ + L
Sbjct: 95  AARQVRAIIDVSVNLDLTPLKQKIGELYPHENIKVYASETGVVLSGTVSSPEVVEQVIRL 154

Query: 164 SETFLSQSGR----NQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRR----DILKQIGF 215
           +ETFL +        +    S   + NLL++ G  QV L+V  AEV R    D    +GF
Sbjct: 155 TETFLPKKAEASTSGKGTGKSGSGITNLLSVGGVQQVMLEVKFAEVTRSSGRDWQAALGF 214

Query: 216 QHS------ITGSSSGPSKSFAADFGGKFVS---EGGDFSVKGV---LDRFSFETVLHAL 263
                    + G           DF GK  S      DF+       +    F + L  L
Sbjct: 215 NGLGDNSGLVAGVGGISGDISGGDFTGKLGSVLLNFADFASNPANIFVQMGDFTSALRFL 274

Query: 264 ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVL 323
           E     R LAEP L  +SGQ ASF +GG+  +          ++   ++GV L FTP V+
Sbjct: 275 EDEGLARILAEPRLVTMSGQEASFLAGGE--FPIPVPDEDGITIEFREFGVSLRFTPVVM 332

Query: 324 SPGRIGLRIQTEVSEPVIGVNAG--------DMPSYRVRKADTTVELPSGGTIVLAGLLK 375
           S G+I LR+   VS+     +          ++P+   RK +TTV+L  G T+ LAGLL+
Sbjct: 333 SDGKISLRVAPSVSDIASTSSIPSSITGTTYNVPNLTTRKLETTVQLYDGQTLALAGLLQ 392

Query: 376 DDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYS 435
           D +++    IP L  +PILGALFR++ + +E+T++ IA TP LVKP     LS P ++  
Sbjct: 393 DTLRESVSKIPGLGDLPILGALFRSTSYTQEKTDLLIAVTPHLVKPSKEGTLSFPGEYMR 452

Query: 436 VEDDAKAFFFNRVNKIYGPKEASEVEGQNY 465
             +  + +   R+     P + S +   ++
Sbjct: 453 PPNRLEFYLEGRLEGRRFPNDPSALSQHSF 482


>gi|261251598|ref|ZP_05944172.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio orientalis CIP 102891]
 gi|260938471|gb|EEX94459.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio orientalis CIP 102891]
          Length = 457

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 119/404 (29%), Positives = 199/404 (49%), Gaps = 36/404 (8%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + + +N+  ++ +P D + + +S+   AD    +   + +FG   G A + ++    + +
Sbjct: 27  LEVNINEAKMINLPQDAKSIFISNTHIADYQPMTNTKIMVFGMQAGTATITILNAQERVI 86

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            N  I +  D   L+  +     ++++  E +   + L G V T   +   V +++ +LS
Sbjct: 87  YNNKIRVVHDTKELDSLIAAQFPEASVHSESLGGKLWLKGNVPTPVMAHSIVSVAKGYLS 146

Query: 170 -----QSGRNQYANS----------SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
                Q   N   +S          +S +++N L +    QV ++V IAEV R++  ++G
Sbjct: 147 PVIAPQQSENGSTSSDSSTQNSGSDNSDELVNQLMVTMPTQVNIRVRIAEVSRNVSNKLG 206

Query: 215 FQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAE 274
            +            S  A  G    ++  D S  G   + +   ++ AL     +  LAE
Sbjct: 207 IKWG----------SLQAGMGSFLYTKAWDVSSWG---KPTLGALVDALASDGTMSILAE 253

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           P LTA+SG+ ASF  GG+     ++  T   +V    +GV L+FTP VL P RI LR+  
Sbjct: 254 PNLTAMSGEDASFLVGGEIPLPLINGDTA--TVEYKPFGVNLNFTPVVLGPDRISLRVSP 311

Query: 335 EVS----EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD-DIQQLKEGIPLLS 389
           EVS    +    +N    PS+  R+A TT+EL SG +  L GLL+  +I QL++ +P   
Sbjct: 312 EVSSVSVDNQTTLNGNTYPSFTSRRATTTIELASGQSFALGGLLQSSEIDQLQK-LPGAG 370

Query: 390 KIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDH 433
            IPILG LFR+S + R+ETE+ I AT +LV+PV    L  P D+
Sbjct: 371 DIPILGGLFRSSEYQRKETELIIIATAYLVEPVRNDALPLPTDN 414


>gi|13475417|ref|NP_106981.1| pilus assembly protein [Mesorhizobium loti MAFF303099]
 gi|14026169|dbj|BAB52767.1| pilus assembly protein [Mesorhizobium loti MAFF303099]
          Length = 481

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 126/462 (27%), Positives = 216/462 (46%), Gaps = 36/462 (7%)

Query: 8   FFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQ 67
           F+  M+    S   ++     + +A    I++S+  +    ++ + +++ + + V   + 
Sbjct: 4   FWVRMAAVALSCFATLPTWSLVADAADRFIDVSNPSV---HRVFLPMSQSVTIAVNATLG 60

Query: 68  DVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTL 127
           D++V D   AD    + RT+Y+ GK  G   V L   + + +  + I +  D++ +   +
Sbjct: 61  DIVVGDEKIADAQPMTDRTLYVIGKGAGTTTVNLFSPEKRSLGVIQIEVGVDVSDMAQAI 120

Query: 128 RRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNL 187
           R+    S I V  V+  V L G V+        +E+++         QY       ++N 
Sbjct: 121 RQVAPRSRIEVASVNGRVRLGGHVKDGVTMAAILEVAK---------QYG---PDDIINS 168

Query: 188 LNIAGEDQVTLKVTIAEVRRDILKQIGFQ--------HSITGSSSGPSKSFAADFG-GKF 238
           + I    QV L+V I E +R+  + +G           +I G+            G G F
Sbjct: 169 VTIDDSQQVNLEVRILEAKRNAGRDLGVSIRSNNSRSTTIVGTGIAAVDKDNVVLGTGGF 228

Query: 239 VSE-------GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGG 291
           +S+        G    + + +    +  + ALE   A+RTLA P LT +SG+ ASF +GG
Sbjct: 229 LSDLLSTSTPFGALLTRVIDNNIKVDLYIEALEAKGAVRTLANPNLTTLSGEQASFNAGG 288

Query: 292 QHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSY 351
           +   +T+  + G  S+    +GV L FTP VL  G+I + +  EVS+      AGD P +
Sbjct: 289 EVPIRTLDKN-GEISIVYKQFGVNLLFTPVVLDDGKIHMNLAPEVSDLNGFTTAGD-PIF 346

Query: 352 RVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIF 411
             RK  T VEL  G +  + GLL     +L+  +P L ++P++G LFRNS   +EETE+ 
Sbjct: 347 TNRKLSTVVELRDGQSFAVGGLLSSRTTKLQNQVPWLGQVPVIGTLFRNSSNQKEETELV 406

Query: 412 IAATPFLVKPVAM-RDLSRPDDHYSVEDDAKAFFFNR--VNK 450
           +  TP +V+PV     L+ P D     +D + F   +  VNK
Sbjct: 407 VIVTPHIVRPVKPGEQLATPFDKTRPANDPEFFVLGQLEVNK 448


>gi|323493503|ref|ZP_08098625.1| Flp pilus assembly protein CpaC [Vibrio brasiliensis LMG 20546]
 gi|323312326|gb|EGA65468.1| Flp pilus assembly protein CpaC [Vibrio brasiliensis LMG 20546]
          Length = 458

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 112/404 (27%), Positives = 194/404 (48%), Gaps = 37/404 (9%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + + +N+  ++ +P D + + +S+   AD    +   + +FG   G A + ++    + +
Sbjct: 27  LEVTINQAKMINLPQDAKSIFISNTHVADYQPMTNTKIMVFGLQAGSATITILNAQERVI 86

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            N  I +  D   L   +     +++++ E +   + L G V T   +   V +++ +LS
Sbjct: 87  YNNKIRVTHDTFELNSLISSQFPEASVKSESLGGKLWLKGSVPTPVMAHSIVNIAKGYLS 146

Query: 170 QSGRNQYA----------------NSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
                Q +                  S  +++N L +    QV ++V IAEV R++  ++
Sbjct: 147 PPTAGQSSDSSSDSESSNNTSEQQGDSGNELVNQLVVTMPTQVNIRVRIAEVSRNVSNKL 206

Query: 214 GFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLA 273
           G +            S  +  G    ++  D S  G   + +   ++ AL     +  LA
Sbjct: 207 GIKWG----------SLESGMGSFLYTKAWDVSSWG---KPTLGALIDALASDGTMSILA 253

Query: 274 EPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQ 333
           EP LTA+SG+ A+F  GG+     +   T   +V    +GV L+FTP VL P RI LR+ 
Sbjct: 254 EPNLTAMSGEEANFLVGGEIPLPLIIGDTA--TVEYKPFGVNLNFTPVVLGPDRISLRVS 311

Query: 334 TEVSEPVIG----VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD-DIQQLKEGIPLL 388
            EVS   +     +N    PS+  R+A TT+EL SG +  L GLL+  +I QL++ +P +
Sbjct: 312 PEVSSISVDNQTTLNGNTYPSFTSRRATTTIELASGQSFALGGLLQSSEIDQLQK-LPGI 370

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDD 432
             +P+LG LFR+S + R ETE+ I AT +LV+PV    +  P D
Sbjct: 371 GDMPVLGGLFRSSDYQRRETELIIIATAYLVEPVRNDAIPLPTD 414


>gi|54309660|ref|YP_130680.1| Flp pilus assembly protein [Photobacterium profundum SS9]
 gi|46914098|emb|CAG20878.1| hypothetical Flp pilus assembly protein [Photobacterium profundum
           SS9]
          Length = 461

 Score =  152 bits (385), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 121/404 (29%), Positives = 195/404 (48%), Gaps = 47/404 (11%)

Query: 52  IGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLN 111
           I LN    L+ P ++  V VS P   D  V   R + +F   +GQA VI+ G + + +L+
Sbjct: 34  ITLNDANNLEFPQEIGTVFVSQPDILDYKVIDNRKLVIFSNKIGQAKVIVYGKENQVLLS 93

Query: 112 LDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS 171
               ++ +++ +   L+ +  D NI V  V + V + G V   +       +  T L + 
Sbjct: 94  QRYHVDINLSQVRRQLKLYYPDLNISVSSVGEQVAVRGTVNNEKQRDDIYRMVATLLGKK 153

Query: 172 GRNQYANSSSKK----------------------VMNLLNIAGEDQVTLKVTIAEVRRDI 209
              +Y  +   K                      ++  L IA   QV +K+++A+V ++ 
Sbjct: 154 EIERYNEAEKLKFVESGFEEANWVRYSKNYIWEGIVEGLVIAQAQQVNVKISVAQVTKEF 213

Query: 210 LKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAI 269
            + IG   S  G S G   SF      KF  +  D S           TV++A+      
Sbjct: 214 NETIGVDWSTVGRSVGEF-SFL-----KF--KANDLS-----------TVINAIGNDNIA 254

Query: 270 RTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIG 329
             LAEP LT +SG+SASF  GG+     + ++  +T+++  ++G+ L  +  VLS   I 
Sbjct: 255 EILAEPNLTVLSGESASFLVGGE--VPVIVTNDNSTNISFKEFGIKLELSAKVLSNKSIK 312

Query: 330 LRIQTEVS--EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLK-DDIQQLKEGIP 386
           L++  EVS  E  +     ++P    R+A TT++L  G + +L GL+  DDI+++ + IP
Sbjct: 313 LQLAPEVSAVEGYVKAAGIEVPQLSSRRAMTTIQLADGDSFMLGGLMSSDDIEEISK-IP 371

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           LL  IPILGA FR S   R++TE+ I AT  LVKPV+  D+  P
Sbjct: 372 LLGDIPILGAAFRKSSTTRKKTELVIVATVNLVKPVSPTDVRLP 415


>gi|87312292|ref|ZP_01094390.1| putative outer membrane channel for pilus assembly CpaC
           [Blastopirellula marina DSM 3645]
 gi|87284996|gb|EAQ76932.1| putative outer membrane channel for pilus assembly CpaC
           [Blastopirellula marina DSM 3645]
          Length = 534

 Score =  152 bits (385), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 121/398 (30%), Positives = 188/398 (47%), Gaps = 31/398 (7%)

Query: 35  AVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNV 94
           AV N++       +++ + +N   I  +   +    V++P    +   SP  + +     
Sbjct: 25  AVPNVNFKVDAPNQRLEMMVNSSRIFTLDEKIPKAQVNNPDLLRLTPLSPNKIQVSALKP 84

Query: 95  GQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTI 154
           G   V L   DG  +  +DI++  D   L++ L     +S+I+V  ++ +VVL G V   
Sbjct: 85  GVTQVNLWNEDGT-IHTIDIIVIGDGRELQLLLETEFPNSSIKVRPLASSVVLSGYVDRP 143

Query: 155 QDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
           +   R V ++E +               KV+N + + G  QV LKV + EV R  L+++G
Sbjct: 144 EAVSRIVAMAEDYY-------------PKVINNITVGGVQQVMLKVKVYEVSRTKLRRLG 190

Query: 215 FQHSITGS-------------SSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLH 261
              +  GS              +G   S A D  G    +   F V G      F   L 
Sbjct: 191 IDWAAIGSDYFISSTAANVLTPAGVLTSGARDALGA-TGQTVQFGVLG--SSTQFFGFLD 247

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPT 321
           AL +    +  AEPTLT ISG+ ASF SGG+   + V+S  G TS+    YG  + F P 
Sbjct: 248 ALRQNNVAKLSAEPTLTTISGRPASFLSGGEVPIQ-VASGLGTTSIEYKQYGTRVDFVPI 306

Query: 322 VLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
           VL  G + L ++ EVSEP   V     P +R+R  DT VE+ +G +  LAGL+++ I+  
Sbjct: 307 VLGNGNLKLEVRPEVSEPDYSVAINGTPGFRLRWVDTAVEMKAGQSFALAGLIQEKIETE 366

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLV 419
             G+P L+ +P +GA FR +  +R E E+ I  TP LV
Sbjct: 367 TRGLPYLADLPWVGAAFRRNTDSRNEVELLIIVTPELV 404


>gi|149188863|ref|ZP_01867153.1| hypothetical Flp pilus assembly protein [Vibrio shilonii AK1]
 gi|148837283|gb|EDL54230.1| hypothetical Flp pilus assembly protein [Vibrio shilonii AK1]
          Length = 456

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 112/407 (27%), Positives = 200/407 (49%), Gaps = 49/407 (12%)

Query: 51  SIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQML 110
           SI LN    +Q+ + +  V +S+P  AD  + +  T+ +F   VGQ+ +I+ G +   +L
Sbjct: 34  SITLNDGQHIQLKMPIGKVFISNPAIADYKIINDNTLVVFANGVGQSRLIVYGTNNDVLL 93

Query: 111 NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQ 170
           +  I+++ D++ +   L+    D+ ++V+ V + V + G+V + Q       L  T L +
Sbjct: 94  SDRIIVDLDLSEVRRQLKFHFPDAKVKVQSVGEQVAVSGVVDSEQTRDDIYRLVATLLGR 153

Query: 171 SGRNQY------------------------ANSSSKKVMNLLNIAGEDQVTLKVTIAEVR 206
               ++                         N + + ++  + +A   QV +K+++A+V 
Sbjct: 154 EKIKKWDKTEKLEFKSEHMERKEPESMVFARNMTWEGILERIEVATTQQVNVKISVAQVT 213

Query: 207 RDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERA 266
               K +G   S  GSS G           +FV +          D  +  T++ AL   
Sbjct: 214 ESFGKTVGVDWSSVGSSVG-----------EFVFDQ--------FDAANLSTLITALGND 254

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
           +    LAEP LT +SG+SASF  GG+     + S++   ++T  ++G+ L  T  VLS  
Sbjct: 255 SIAEVLAEPNLTVLSGESASFLVGGE--VPVIVSTSNNVNITFKEFGIKLDLTAKVLSQD 312

Query: 327 RIGLRIQTEVSEPVIGVNAG--DMPSYRVRKADTTVELPSGGTIVLAGLLKD-DIQQLKE 383
           +I +++  EVSE    V A    +P    R+A TTVEL  G + +L GL+   D++++++
Sbjct: 313 KIRMQLSPEVSEVESYVEAAGVKVPQLASRRAMTTVELADGDSFILGGLMSSSDLEKMQK 372

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
            IP +  +P+LGA FR +   R+ TE+ I AT  LV+P+  +D+  P
Sbjct: 373 -IPFIGDVPVLGAAFRKATTQRKRTELIIVATVNLVEPMKPKDIQLP 418


>gi|218708107|ref|YP_002415728.1| putative bacterial type II secretion system protein D; rcpA, CpaC
           [Vibrio splendidus LGP32]
 gi|218321126|emb|CAV17076.1| putative bacterial type II secretion system protein D; rcpA, CpaC
           [Vibrio splendidus LGP32]
          Length = 435

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 118/384 (30%), Positives = 185/384 (48%), Gaps = 38/384 (9%)

Query: 65  DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
           ++  V +S    AD  V     + +FGKN+G A+ I     G+++ N  +L+ +    +E
Sbjct: 35  EIASVFISGKNIADYQVIDSNKVVVFGKNIGSASFIAFDAKGRELFNRLLLVNKSYREIE 94

Query: 125 MTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRN---QYANSSS 181
             +     D+ + V  + + VVL G+V   Q+     +L    L ++  +   Q ++  S
Sbjct: 95  QQIDVLFPDAEVFVAGIGENVVLSGVVANEQEKDNIHQLVGELLGKTANSTSFQMSDEES 154

Query: 182 KKV----MNLLNIAG---------EDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK 228
             +    M  LN AG           QV +K+TIAEV    ++  G +    GS+  P  
Sbjct: 155 DDIDVGFMTQLNYAGVVNNIEISATKQVNVKLTIAEVSHSFMQDFGIK---MGSNGTP-- 209

Query: 229 SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
                  G FV +   FS   ++      +V+ AL   +  + LAEP L+ ISG+ ASF 
Sbjct: 210 -------GIFVDQLTHFSASDIV------SVISALGTDSVGQVLAEPNLSVISGEKASFL 256

Query: 289 SGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGVNAG 346
            GG+     V+   GAT+V   ++GV L     VL   +I L +  EVS  +     +  
Sbjct: 257 VGGE--LPVVTVIDGATNVEYKEFGVRLELLAKVLRDDKIKLALTPEVSSLDGSYSSDNF 314

Query: 347 DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNRE 406
           D+P+ R R+A TTVEL  G + VL GLL  + ++    IP +  IPI+GALFR++   R 
Sbjct: 315 DLPALRTRRAQTTVELGDGQSFVLGGLLNSEEKESLTRIPYIGDIPIIGALFRHTGTERS 374

Query: 407 ETEIFIAATPFLVKPVAMRDLSRP 430
           +TE+ I AT  LV+PV    +  P
Sbjct: 375 KTELVIVATVNLVQPVKAEQIQLP 398


>gi|86147184|ref|ZP_01065500.1| general secretion pathway protein D [Vibrio sp. MED222]
 gi|85835068|gb|EAQ53210.1| general secretion pathway protein D [Vibrio sp. MED222]
          Length = 439

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 118/384 (30%), Positives = 185/384 (48%), Gaps = 38/384 (9%)

Query: 65  DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
           ++  V +S    AD  V     + +FGKN+G A+ I     G+++ N  +L+ +    +E
Sbjct: 39  EIASVFISGKNIADYQVIDSNKVVVFGKNIGSASFIAFDAKGRELFNRLLLVNKSYREIE 98

Query: 125 MTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRN---QYANSSS 181
             +     D+ + V  + + VVL G+V   Q+     +L    L ++  +   Q ++  S
Sbjct: 99  QQIDVLFPDAEVFVAGIGENVVLSGVVANEQEKDNIHQLVGELLGKTANSTSFQMSDEES 158

Query: 182 KKV----MNLLNIAG---------EDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK 228
             +    M  LN AG           QV +K+TIAEV    ++  G +    GS+  P  
Sbjct: 159 DDIDVGFMTQLNYAGVVNNIEISATKQVNVKLTIAEVSHSFMQDFGIK---MGSNGTP-- 213

Query: 229 SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
                  G FV +   FS   ++      +V+ AL   +  + LAEP L+ ISG+ ASF 
Sbjct: 214 -------GIFVDQLTHFSASDIV------SVISALGTDSVGQVLAEPNLSVISGEKASFL 260

Query: 289 SGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGVNAG 346
            GG+     V+   GAT+V   ++GV L     VL   +I L +  EVS  +     +  
Sbjct: 261 VGGE--LPVVTVIDGATNVEYKEFGVRLELLAKVLRDDKIKLALTPEVSSLDGSYSSDNF 318

Query: 347 DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNRE 406
           D+P+ R R+A TTVEL  G + VL GLL  + ++    IP +  IPI+GALFR++   R 
Sbjct: 319 DLPALRTRRAQTTVELGDGQSFVLGGLLNSEEKESLTRIPYIGDIPIIGALFRHTGTERS 378

Query: 407 ETEIFIAATPFLVKPVAMRDLSRP 430
           +TE+ I AT  LV+PV    +  P
Sbjct: 379 KTELVIVATVNLVQPVKAEQIQLP 402


>gi|193213115|ref|YP_001999068.1| type II and III secretion system protein [Chlorobaculum parvum NCIB
           8327]
 gi|193086592|gb|ACF11868.1| type II and III secretion system protein [Chlorobaculum parvum NCIB
           8327]
          Length = 472

 Score =  152 bits (383), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 124/442 (28%), Positives = 206/442 (46%), Gaps = 60/442 (13%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           ++S G ++V  +  P+  + V V +P  AD ++ +P  +YL GK  G  N+I+   +G  
Sbjct: 37  RVSEGESRVYRMGSPI--KRVAVGNPEIADYIILNPTELYLLGKKTGATNLIVWDQNGNS 94

Query: 109 MLNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
             +  + + R++  ++  +R  +  +++I +      +VL G V     ++ A  L + +
Sbjct: 95  A-STPLQVSRNVEPIKDLIRTVLPNETDIHIYSSGPALVLAGTVSNSLAAETAYRLVKGY 153

Query: 168 L--------------SQSGRNQYANSSS-----------------------KKVMNLLNI 190
           L              +    + YA ++S                         V+NLL +
Sbjct: 154 LGGDVPADNPEKTLTNTKPADSYAGTASLSGIVKSASLVAGGPTGAEGSGMSGVVNLLKV 213

Query: 191 AGEDQVTLKVTIAEVRRDILKQIGFQHS--ITGSSSGPSKSFAADFGGKFVSEGGDFSVK 248
               QV L+V IAEV +  ++ +GF+ +  I   S G    F ++       E  +  +K
Sbjct: 214 RDAQQVRLEVHIAEVSKTFMQALGFEWAGRIGNVSGGLMTGFVSN-------ETINLLLK 266

Query: 249 GVLDRFSFETVLHALERAT--AIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATS 306
              D  S    + A        I+ LAEPT+ A+SGQ   F  GG+ +Y    ++ GA  
Sbjct: 267 ---DNTSHSQRIKAENECDNGWIKILAEPTIVAMSGQEGYFLVGGK-IYVPTITANGAVD 322

Query: 307 VTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV--NAGDMPSYRVRKADTTVELPS 364
                YGV L FTPTVL  GRI L++  EVSEP        G + +++   A TTV++  
Sbjct: 323 YQERTYGVGLRFTPTVLDAGRISLKVAPEVSEPPTSAADGTGTLLAFKTSYASTTVQMNE 382

Query: 365 GGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAM 424
           G  +V+ GLLKD I +  + +PLL  IP+LGALFR+++   E TE+ +   P LV+  + 
Sbjct: 383 GQNLVIGGLLKDKITETLKAVPLLGDIPLLGALFRHTKIESENTELLVVVRPTLVE-ASD 441

Query: 425 RDLSRPDDHYSVEDDAKAFFFN 446
                P D + +    K  FF+
Sbjct: 442 TPPELPTDRF-IPPTQKELFFD 462


>gi|238796996|ref|ZP_04640500.1| Type II/III secretion system protein [Yersinia mollaretii ATCC
           43969]
 gi|238719256|gb|EEQ11068.1| Type II/III secretion system protein [Yersinia mollaretii ATCC
           43969]
          Length = 340

 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 106/320 (33%), Positives = 176/320 (55%), Gaps = 32/320 (10%)

Query: 123 LEMTLRRFIA---DSNIRVEMVSDTVVLHGMVRTIQDSQR-AVELSETFLS---QSGRNQ 175
           +  T +R IA   DS+I ++ + D+ +L G V + ++    A  + E   S   +SG+ Q
Sbjct: 6   INATNKRIIAEYPDSHIEIDKIGDSYILTGEVESEEEKDTIATLVGEAIGSKKEESGKGQ 65

Query: 176 YANSSS-KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADF 234
           Y N+     ++N + +   +QV +K+TIAEV +D  + +G   S  G + G   SF    
Sbjct: 66  YFNTPYYSNIINKIKLPQSNQVNVKLTIAEVTKDFSENVGVDWSTAGDAVG---SF---- 118

Query: 235 GGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHL 294
             +F+     F+ KG+       T++HA+   +  R LAEP L+ +SG+SASF  GG+  
Sbjct: 119 --QFIR----FNAKGI------STLVHAINDDSIARILAEPNLSVLSGESASFLVGGE-- 164

Query: 295 YKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PVIGVNAGD-MPSY 351
              +S++  + +V+  ++G+ L+    V    RI + I  EVS       +  GD +PS 
Sbjct: 165 IPIISTTENSRTVSYKEFGIKLNIGAKVNEKKRIRIHINEEVSSIGKTFNIEGGDSIPSL 224

Query: 352 RVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIF 411
           R RKA+TT+EL  G + +L GL+    ++  + IPL+  IPILGALFRN++  + +TE+ 
Sbjct: 225 RTRKAETTLELGDGESFILGGLISHTERESLKKIPLIGDIPILGALFRNAQTEQNQTELV 284

Query: 412 IAATPFLVKPVAMRDLSRPD 431
           + AT  LVK V+ +++  PD
Sbjct: 285 VIATVNLVKSVSKKEVELPD 304


>gi|328470518|gb|EGF41429.1| rough colony protein RcpA [Vibrio parahaemolyticus 10329]
          Length = 447

 Score =  151 bits (381), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 124/409 (30%), Positives = 202/409 (49%), Gaps = 38/409 (9%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
           +  G+ +S+       + V  ++  V V+D   AD  V +   + ++G   G  ++I   
Sbjct: 21  VSAGELLSLDKGAAKTINVKRNIDTVFVADTQIADYKVIANGKLVIYGIGRGATSIIAYD 80

Query: 104 HDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVE- 162
             G ++ N ++++ + +  L+ T+     D +I++  + + +V+ G+V + +   +    
Sbjct: 81  RAGNEIYNAEVVVNKSLRLLKQTIIARYPDEDIKLTNIGEQIVIDGVVSSEEIKDKVYRH 140

Query: 163 LSETFLSQSGRNQY----ANSSS------------KKVMNLLNIAGEDQVTLKVTIAEVR 206
           + E       RN +    AN  S            + ++N L +   DQ+ +K+T+AEV 
Sbjct: 141 VGEMLKKSKQRNTFELSGANGESVDPLDYTATYVFEDIINNLKVLTTDQINVKLTVAEVS 200

Query: 207 RDILKQIGFQHSIT-GSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
              L ++G  ++ T G S G +        G+FV++  DF+ + ++       V+ A   
Sbjct: 201 SSFLTELGVSYAETNGKSIGGA--------GQFVNKILDFTAEDIV------AVISASGN 246

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
            +  + LAEP L+ ISG+SASF  GG+ +  TV  + G  SVT  +YGV L     V   
Sbjct: 247 DSIGQVLAEPNLSVISGESASFLVGGE-IPITVRDNDG-ISVTYKEYGVKLSMVAKVTDS 304

Query: 326 GRIGLRIQTEVS--EPVIGVNAG--DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
             I L +  EVS  +   GVN+G   +PS R RKA TTV+L  G + VLAGLL  + Q+ 
Sbjct: 305 ENIRLSLLPEVSSIDKTNGVNSGLVSVPSLRTRKAQTTVQLKDGQSFVLAGLLTSEEQES 364

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
              IP L  IPILGALF  +   R +TE+ I AT  LV PV   D+  P
Sbjct: 365 LAKIPYLGDIPILGALFSKTNTERRKTELIIVATVNLVDPVKETDIKLP 413


>gi|238762407|ref|ZP_04623378.1| Type II/III secretion system protein [Yersinia kristensenii ATCC
           33638]
 gi|238699392|gb|EEP92138.1| Type II/III secretion system protein [Yersinia kristensenii ATCC
           33638]
          Length = 379

 Score =  151 bits (381), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 104/358 (29%), Positives = 184/358 (51%), Gaps = 31/358 (8%)

Query: 86  TMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTV 145
           ++ ++ K  G A  IL   + + +    +L+   I      ++    +S+I +  +  + 
Sbjct: 5   SIIVYAKQEGTAEFILFNQNNQPIKKSAVLVNNTITAANKRIQIEYPESDIEINKIGTSY 64

Query: 146 VLHGMVRTIQDSQRAVEL-SETFLSQSG---RNQYANSSSKK-VMNLLNIAGEDQVTLKV 200
           +L GM  + +     V +  E   S+      +QY N+     ++N + + G +QV +K+
Sbjct: 65  ILTGMAESEEAKDTIVSIIGEAIGSKKTIDTDSQYLNTPEYYGIINKIKLMGTNQVNVKL 124

Query: 201 TIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKF----VSEGGDFSVKGVLDRFSF 256
           TIAEV +D  + IG   S  G           DF G F    ++   +FS +G+      
Sbjct: 125 TIAEVTKDFSENIGVDWSTIG-----------DFSGSFQLVKLNSLNNFSARGI------ 167

Query: 257 ETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVL 316
             ++HA+   +  R LAEP L+ +SG+SASF  GG+     V+++  +T +T  ++G+ L
Sbjct: 168 SALVHAINDDSIARVLAEPNLSVLSGESASFLVGGE--IPMVNTTQNSTVITYKEFGIKL 225

Query: 317 HFTPTVLSPGRIGLRIQTEVS--EPVIGVNAGD-MPSYRVRKADTTVELPSGGTIVLAGL 373
           +    V    RI + +  EVS  + V  ++ G+  PS+R RKA TT+EL  G + +L GL
Sbjct: 226 NIGAKVNEKKRIRIMLDEEVSSIDKVFNIDGGNAYPSFRTRKAATTLELGDGESFILGGL 285

Query: 374 LKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           + +  ++  + IP +  IPILGA FRN+   + +TE+ + AT  LV+PV+ R++  P+
Sbjct: 286 ISNSERESLKKIPFIGDIPILGAFFRNAETRKNQTELVVVATVNLVRPVSEREVELPN 343


>gi|28900576|ref|NP_800231.1| rough colony protein RcpA [Vibrio parahaemolyticus RIMD 2210633]
 gi|153836379|ref|ZP_01989046.1| rough colony protein RcpA [Vibrio parahaemolyticus AQ3810]
 gi|260877521|ref|ZP_05889876.1| rough colony protein RcpA [Vibrio parahaemolyticus AN-5034]
 gi|260901740|ref|ZP_05910135.1| rough colony protein RcpA [Vibrio parahaemolyticus AQ4037]
 gi|308095456|ref|ZP_05906034.2| rough colony protein RcpA [Vibrio parahaemolyticus Peru-466]
 gi|308125917|ref|ZP_05777993.2| rough colony protein RcpA [Vibrio parahaemolyticus K5030]
 gi|28808956|dbj|BAC62064.1| rough colony protein RcpA [Vibrio parahaemolyticus RIMD 2210633]
 gi|149750281|gb|EDM61026.1| rough colony protein RcpA [Vibrio parahaemolyticus AQ3810]
 gi|308087133|gb|EFO36828.1| rough colony protein RcpA [Vibrio parahaemolyticus Peru-466]
 gi|308090527|gb|EFO40222.1| rough colony protein RcpA [Vibrio parahaemolyticus AN-5034]
 gi|308108872|gb|EFO46412.1| rough colony protein RcpA [Vibrio parahaemolyticus AQ4037]
 gi|308114419|gb|EFO51959.1| rough colony protein RcpA [Vibrio parahaemolyticus K5030]
          Length = 447

 Score =  151 bits (381), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 124/409 (30%), Positives = 202/409 (49%), Gaps = 38/409 (9%)

Query: 44  IGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIG 103
           +  G+ +S+       + V  ++  V V+D   AD  V +   + ++G   G  ++I   
Sbjct: 21  VSAGELLSLDKGAAKTINVKRNIDTVFVADTQIADYKVIANGKLVIYGIGRGATSIIAYD 80

Query: 104 HDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVE- 162
             G ++ N ++++ + +  L+ T+     D +I++  + + +V+ G+V + +   +    
Sbjct: 81  RAGNEIYNAEVVVNKSLRLLKQTIIARYPDEDIKLTNIGEQIVIDGVVSSEEIKDKVYRH 140

Query: 163 LSETFLSQSGRNQY----ANSSS------------KKVMNLLNIAGEDQVTLKVTIAEVR 206
           + E       RN +    AN  S            + ++N L +   DQ+ +K+T+AEV 
Sbjct: 141 VGEMLKKSKQRNTFELSGANGESVDPLDYTATYVFEDIINNLKVLTTDQINVKLTVAEVS 200

Query: 207 RDILKQIGFQHSIT-GSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
              L ++G  ++ T G S G +        G+FV++  DF+ + ++       V+ A   
Sbjct: 201 SSFLTELGVSYAETNGKSIGGA--------GQFVNKILDFTAEDIV------AVISASGN 246

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
            +  + LAEP L+ ISG+SASF  GG+ +  TV  + G  SVT  +YGV L     V   
Sbjct: 247 DSIGQVLAEPNLSVISGESASFLVGGE-IPITVRDNDG-ISVTYKEYGVKLSMVAKVTDS 304

Query: 326 GRIGLRIQTEVS--EPVIGVNAG--DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
             I L +  EVS  +   GVN+G   +PS R RKA TTV+L  G + VLAGLL  + Q+ 
Sbjct: 305 ENIRLSLLPEVSSIDKTNGVNSGLVSVPSLRTRKAQTTVQLKDGQSFVLAGLLTSEEQES 364

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
              IP L  IPILGALF  +   R +TE+ I AT  LV PV   D+  P
Sbjct: 365 LAKIPYLGDIPILGALFSKTNTERRKTELIIVATVNLVDPVKETDIKLP 413


>gi|149176581|ref|ZP_01855194.1| putative outer membrane channel for pilus assembly CpaC
           [Planctomyces maris DSM 8797]
 gi|148844694|gb|EDL59044.1| putative outer membrane channel for pilus assembly CpaC
           [Planctomyces maris DSM 8797]
          Length = 590

 Score =  150 bits (380), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 115/384 (29%), Positives = 175/384 (45%), Gaps = 34/384 (8%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           IL+ P  ++ V   DPT   V   +P  + +     G   +++   +GK +  L+  +  
Sbjct: 63  ILKFPGKIKRVDGFDPTVLSVSALTPNELRIQALVPGVTTLVITDENGK-VYTLETFVSG 121

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           D  HL+  LR     S++    V D+VVL G V   +     VE++E F           
Sbjct: 122 DARHLQAYLRELFPTSSVTAIKVQDSVVLRGWVTEPEAITEMVEIAEQFFPNG------- 174

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF------QHSITGSSSG---PSKS 229
                V+N + +AG  QV LKV I EV+R  ++Q+G       Q     S+ G   P   
Sbjct: 175 -----VLNQMKLAGVQQVLLKVKIMEVQRSKIRQLGVNWLFLNQSGYAYSTPGTLVPITG 229

Query: 230 FAADFGGKFVSEGGDFSVKGVLDRFS-------FETVLHALERATAIRTLAEPTLTAISG 282
               FGG          + G    F        F+  + AL++   ++ LAEP L   SG
Sbjct: 230 INVPFGGPPALTASQNLISGTSLGFGLVDGSSIFQAFIEALKKEALLKILAEPELVTTSG 289

Query: 283 QSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE---- 338
           + A+  SGG+     V  S G  ++   ++GV +   P VL  GR+ L +Q EVSE    
Sbjct: 290 RPANLLSGGEFPI-LVPQSLGTVTIEWREFGVRMEAVPIVLGNGRLRLEVQPEVSERDFS 348

Query: 339 PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALF 398
             + V    +P   VR+A+T VE+  G T+V+AGL+           P L ++P++GA F
Sbjct: 349 NAVQVAGTTVPGLTVRRANTAVEMNFGETMVIAGLISSRKTAETSKTPFLGELPVVGAAF 408

Query: 399 RNSRFNREETEIFIAATPFLVKPV 422
           R  R+   ETE+ I  TP LV P+
Sbjct: 409 RRVRYTEGETELVIMVTPELVSPL 432


>gi|78186671|ref|YP_374714.1| type II secretion system protein [Chlorobium luteolum DSM 273]
 gi|78166573|gb|ABB23671.1| type II secretion system protein [Chlorobium luteolum DSM 273]
          Length = 486

 Score =  150 bits (380), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 121/423 (28%), Positives = 205/423 (48%), Gaps = 59/423 (13%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           ++ +G ++V   ++P  V  V V DP  AD ++ +P  +YL GK  G  N+ +    GK 
Sbjct: 38  RVPVGESRV--YRLPQPVTRVAVGDPEVADYIMLNPSEIYLLGKKTGSTNLTVWDRKGK- 94

Query: 109 MLNLDILIERDIAHLEMTLRRFI-ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL---- 163
           + +  + + R++A ++  LR  +  ++ I++      +VL G       +  A  L    
Sbjct: 95  VSSRSLRVSRNVAPIQELLRVVLPGETGIQLYASGHALVLSGSASDAMAADTAYRLVIAY 154

Query: 164 ---------SETFL--------------SQSGRNQYANSS-----------------SKK 183
                     E+ L                SG +  A ++                 + +
Sbjct: 155 SGGTVPALNPESALLAGSAGASGSVGAPGISGIHDSAPAAPSALPGAAASRSPAARDTPR 214

Query: 184 VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI-TGSSSGP-SKSFAADFGGKFVSE 241
           V+NLL I    QV L+V IAEV R  ++ +G   +   GS+ G     F ++     + +
Sbjct: 215 VVNLLKIRDPQQVRLEVRIAEVSRSHIESLGIGWTQGRGSTQGSLMTGFVSNATLDLLLK 274

Query: 242 GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS 301
            G        +R + +    A ++   ++ LAEPT+ A+SG+   F  GG+ +Y     +
Sbjct: 275 TGGMPGSTEGNRLTVD----AEQKKGLVKILAEPTIVAMSGEEGYFLVGGK-VYTPTLGT 329

Query: 302 TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI-GVNAG---DMPSYRVRKAD 357
            G+       YGV L  TPTVL  GRI L++  EVSEP+   V AG    +P++++  A 
Sbjct: 330 NGSVDYVERTYGVGLRCTPTVLDSGRISLKVAPEVSEPLKEAVTAGTSTSLPAFKLSYAS 389

Query: 358 TTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPF 417
           TTV++  G  +V+ GLL+D++ ++K  +PLLS IP+LG+LFR++  N+E TE+ +   P 
Sbjct: 390 TTVQMQEGENLVIGGLLRDNLTEVKRSVPLLSSIPVLGSLFRHTEMNKETTELMVIVRPT 449

Query: 418 LVK 420
           LVK
Sbjct: 450 LVK 452


>gi|260775653|ref|ZP_05884549.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608069|gb|EEX34238.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio coralliilyticus ATCC BAA-450]
          Length = 442

 Score =  150 bits (379), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 116/384 (30%), Positives = 190/384 (49%), Gaps = 36/384 (9%)

Query: 65  DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
           ++  V VS+P  AD  V     + ++ K+ G++++I+    G  +L+  I + +    ++
Sbjct: 42  EIGTVFVSNPAVADYQVIDKHKVVIYSKSTGKSSLIVFDQSGNTILSRRIQVNKSADSIQ 101

Query: 125 MTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ-DSQRAVELSETFLSQSGRNQYANSSSKK 183
             LR    ++ +    V + VVL G V + Q   +  + + E     + R ++   +  +
Sbjct: 102 RYLRNHYPNAQVNAYYVGEQVVLSGTVSSEQVKDEIYIVVGEMLEKPANRQKFELETEDE 161

Query: 184 --------------VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKS 229
                         V+N + +    QV +KV+IAEV +  L+QIG  +   G   G    
Sbjct: 162 SYEMKFMERREYDGVVNNIEVVVTKQVNVKVSIAEVSQKALEQIGVSYFSKGQVPG---- 217

Query: 230 FAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTS 289
                 G FV+    FS   +L       +++A++  +  R LAEP L+  SG+SASF  
Sbjct: 218 -----SGVFVNAINAFSADDIL------MMINAIDNESVGRVLAEPNLSVTSGESASFLV 266

Query: 290 GGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGVNAGD 347
           GG+     V++  G +SV+  ++GV L     V    +I L +  EVS  +     +  D
Sbjct: 267 GGE--LPVVTTIDGGSSVSYKEFGVRLELMAKVKRDNKITLSLVPEVSSLDSQYENDTYD 324

Query: 348 MPSYRVRKADTTVELPSGGTIVLAGLLK-DDIQQLKEGIPLLSKIPILGALFRNSRFNRE 406
           +P+ + R+A TTVEL  G + VL GLL  +D++ L + IPL+  IPILG LFRN+   R 
Sbjct: 325 LPALKTRRARTTVELGDGQSFVLGGLLSSEDMESLSK-IPLIGDIPILGTLFRNAETERN 383

Query: 407 ETEIFIAATPFLVKPVAMRDLSRP 430
           +TE+ I AT  LVKPV    +S P
Sbjct: 384 KTELIIVATVNLVKPVETSTISLP 407


>gi|148259497|ref|YP_001233624.1| type II and III secretion system protein [Acidiphilium cryptum
           JF-5]
 gi|146401178|gb|ABQ29705.1| type II and III secretion system protein [Acidiphilium cryptum
           JF-5]
          Length = 491

 Score =  150 bits (379), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 133/439 (30%), Positives = 198/439 (45%), Gaps = 40/439 (9%)

Query: 32  ANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFG 91
           A  A +  ++    +G  I  G  ++I L+      +V V+DP    V   S  T+++FG
Sbjct: 50  ARHATMRPAEAARARGLTIEQGSGRLITLKG--SAANVFVADPGVVAVRPASAHTLFVFG 107

Query: 92  KNVGQANVILIGHDGKQMLNLDILIERDI---AHLEMTLRRFIADSNIRVEMVSDTVVLH 148
              G   V +    G  +  L + +       A +     R    + + +   ++ VV+ 
Sbjct: 108 TAPGFTTVAVTDAQGHAVATLHVAVTPKTYPAAAIRAGATRSAPGARLSISSAANGVVVR 167

Query: 149 GMVRT-IQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRR 207
           G V T +QD Q         + Q+        +  KV+N   +    QV LKV IA++ R
Sbjct: 168 GNVPTPVQDYQ--------IMQQA---HLIAGTGAKVVNQTEVRLPQQVALKVRIAQMSR 216

Query: 208 DILKQIG--FQHSITGSSSGPSKSFAADFGGKFVSEG--------GDFSVKGVLDRFSFE 257
            I +Q+G  +Q +  G S G    F   F    V  G        G ++    +   + +
Sbjct: 217 TITQQLGINWQSAGNGISVG---KFLFGFSALDVLNGSSPATPAAGSYNAGLSVGGGAID 273

Query: 258 TVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLH 317
           +VL AL        LAEPTLTA+SGQSASF  GG      V    G  +V    +GV L 
Sbjct: 274 SVLDALNSDNLAHILAEPTLTALSGQSASFIDGGSFPVP-VPGQNGQVTVQYKKFGVQLK 332

Query: 318 FTPTVLSPGRIGLRIQTEVSEPV------IGVNAGDM--PSYRVRKADTTVELPSGGTIV 369
           F P VL  G I L +Q  VS P       I V    +  PS   + A TTV + SG T+ 
Sbjct: 333 FRPVVLDNGSIILHVQPTVSSPTTQNAFQIAVAGTSIVVPSLSTQSASTTVVIGSGQTLA 392

Query: 370 LAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV-AMRDLS 428
           +AGLL +   Q  + +P L  +P+LGA FR+  +NR+E E+ I  TP+LVKPV     L 
Sbjct: 393 IAGLLSNSSNQTDKSVPGLGDMPVLGAAFRDDNYNRQEQELVILVTPYLVKPVNNAGQLM 452

Query: 429 RPDDHYSVEDDAKAFFFNR 447
            PD+ +S  +  +    +R
Sbjct: 453 TPDEGWSPPNQIQRIVLHR 471


>gi|302343419|ref|YP_003807948.1| type II and III secretion system protein [Desulfarculus baarsii DSM
           2075]
 gi|301640032|gb|ADK85354.1| type II and III secretion system protein [Desulfarculus baarsii DSM
           2075]
          Length = 466

 Score =  150 bits (378), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 110/385 (28%), Positives = 178/385 (46%), Gaps = 40/385 (10%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           ++ +P  ++ V V+D T ADV+V +PR +Y+ G+  G  N+ +     + +    + + R
Sbjct: 42  LVDLPAPLKRVSVADETVADVLVINPRQIYVNGRKPGNTNITVWDRAERVIAAYAVGVGR 101

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
           D   L+    R +    I V  +   +VL G V +    ++A  ++  F           
Sbjct: 102 DYTRLKAAFARVLPGEAIEVHELEGALVLAGSVSSESAREKAESIARLF----------- 150

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG-----------------FQHSITG 221
              ++V NLL +  + QV LK+  AEV R   K++                  F  ++TG
Sbjct: 151 -EKERVSNLLEVVDQKQVLLKLRFAEVNRQAAKRMNVNLGYWDPARPGNIFFTFLDNMTG 209

Query: 222 SSSGPSKSFAADFG-GKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAI 280
             S      + +F     V   G  +  G      +   L  L++    + LAEP L  +
Sbjct: 210 PPSIDYSKGSIEFDLSANVGAWGGLNDSGR----QYMAFLDILKQNGLAKILAEPNLVCV 265

Query: 281 SGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE-- 338
           SG+ A+F +GG+  +         T++    YGV L F P VL  G+I L ++ EVSE  
Sbjct: 266 SGKKANFLAGGE--FPIPVPGRDYTAIVFKKYGVQLTFLPKVLPNGKISLEVEPEVSELD 323

Query: 339 --PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
             P +  +   +P    R+A T +EL  G    +AGLLK D+ +     P L  +PILGA
Sbjct: 324 YSPGVVTDGFVVPGLTTRRASTQLELGDGQGFAIAGLLKQDVTRSVSKWPFLGDLPILGA 383

Query: 397 LFRNSRFNREETEIFIAATPFLVKP 421
           LFR+S++   ETE+ I  TP +V+P
Sbjct: 384 LFRSSQYRNRETELLIVVTPHIVRP 408


>gi|32473554|ref|NP_866548.1| outer membrane channel for pilus assembly CpaC [Rhodopirellula
           baltica SH 1]
 gi|32398234|emb|CAD78329.1| putative outer membrane channel for pilus assembly CpaC
           [Rhodopirellula baltica SH 1]
          Length = 589

 Score =  150 bits (378), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 109/377 (28%), Positives = 179/377 (47%), Gaps = 34/377 (9%)

Query: 89  LFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLH 148
           +FGK  G   + L   + K +  +D+ +  D   +E  L   +  +++RV  + ++ ++ 
Sbjct: 99  VFGKTPGTTQINLWDTEDK-LYTIDVTVVADAREVEGILNSQLPLASLRVTPIGESAIIS 157

Query: 149 GMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRD 208
           G V ++ D  +AV ++E F +              V+N + + G  QV L   I EV R 
Sbjct: 158 GYVTSVDDVDKAVAITEQFYT-------------TVINNIQVVGIQQVLLHTKIMEVSRT 204

Query: 209 ILKQIGFQHSITGSS----SGPSKSFAADFGGKFVSEGGDFSVKGVLD---RFS----FE 257
            L+++G   +I   +    +GPS     D G   V     F    + D   RF+    FE
Sbjct: 205 KLRELGVDLAILDDNFTLLNGPSGVL--DVGAGIVEGDAGFGPIPLGDTNLRFNVNGNFE 262

Query: 258 TVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLH 317
           T+++AL      + LAEPT+ A  G+ A FT GG+ +   V    G   +T  DYG  + 
Sbjct: 263 TLINALHEQRLTKLLAEPTVVATHGRPARFTVGGR-IPTIVPGQNGQVQITYEDYGTSID 321

Query: 318 FTPTVLSPGRIGLRIQTEVSEP----VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGL 373
           F P V+ PGRI L ++ EVSEP     + VN  ++ ++  R  +T VE+ +G T  LAGL
Sbjct: 322 FLPFVVGPGRIRLEVRPEVSEPDPSRAVTVNGTNVTAFTTRYVETAVEMQAGQTFALAGL 381

Query: 374 LKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSR--PD 431
           L+   +      P    +P +G LFR  +  R E E+ I  TP LV+ +   ++ R  P 
Sbjct: 382 LQSRTESTTSRTPFFGSLPYVGTLFRKMQERRNEIELLILVTPELVEAMDPHEVPRGGPG 441

Query: 432 DHYSVEDDAKAFFFNRV 448
            +    DD + + +  +
Sbjct: 442 MNSHSPDDKEFYLYGHI 458


>gi|319782173|ref|YP_004141649.1| type II and III secretion system protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317168061|gb|ADV11599.1| type II and III secretion system protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 481

 Score =  150 bits (378), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 119/425 (28%), Positives = 202/425 (47%), Gaps = 31/425 (7%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
           DV      +I + +++ + +QV  ++ D++V D   AD    + RT+Y+ GK  G   V 
Sbjct: 34  DVSTPAVHRIFLPMSQSVTIQVSANLGDIVVGDEKIADAQPMTDRTLYVIGKGAGTTTVN 93

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           L   D + +  L I +  D++ +   +R+    S I V  V+  V L G V+        
Sbjct: 94  LFSTDKRSLGALQIEVGVDVSDMAQAIRQVAPKSRIEVGSVNGRVRLGGHVKDGATLAAI 153

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ---H 217
           + +++         QY   +   V+N + +    QV L+V + E +R+  + +G      
Sbjct: 154 MAVAQ---------QYGPDA---VINSVIVDDSQQVNLEVRVLEAKRNTGRDLGVSIKSR 201

Query: 218 SITGSSSGPSKSFAADFGGKFVSEG-------------GDFSVKGVLDRFSFETVLHALE 264
           +  G++   +   A D  G  +  G             G    + +      + ++ ALE
Sbjct: 202 NGDGTTRTGTGVAAVDEDGVVLGPGGLLSGLLSNSAPFGALITRVIDSNIKVDLIIEALE 261

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLS 324
              A+RTLA P LT +SG+ ASF +GG+   +T+    G  S+    +GV L FTP VL 
Sbjct: 262 SKGAVRTLANPNLTTLSGEQASFNAGGEVPIRTLDKD-GEISIVYKQFGVNLLFTPVVLD 320

Query: 325 PGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG 384
            G+I + +  EVS+      AGD P +  RK  T VEL  G +  + GLL     +L++ 
Sbjct: 321 DGKIHMNLAPEVSDLTGFTTAGD-PIFTNRKLATVVELRDGQSFAVGGLLSSKTTKLQDQ 379

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAM-RDLSRPDDHYSVEDDAKAF 443
           +P L ++P++G LFR+S   +EETE+ +  TP +V+PV     L+ P D     +D + F
Sbjct: 380 VPWLGQVPVIGTLFRSSSNQKEETELVVIVTPHIVRPVKPGEQLATPFDKTRPANDPEFF 439

Query: 444 FFNRV 448
              ++
Sbjct: 440 VLGQL 444


>gi|220922532|ref|YP_002497834.1| type II and III secretion system protein [Methylobacterium nodulans
           ORS 2060]
 gi|219947139|gb|ACL57531.1| type II and III secretion system protein [Methylobacterium nodulans
           ORS 2060]
          Length = 479

 Score =  150 bits (378), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 133/435 (30%), Positives = 201/435 (46%), Gaps = 52/435 (11%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           ++ + +NK   ++V     D+L+     A+V+  S +T+Y+ GK VG  NV L+  + K 
Sbjct: 16  RVRVPVNKSQTMRVVAPFSDILIGASKIAEVIPLSDQTLYILGKEVGTTNVSLVDANKKV 75

Query: 109 MLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           +  +D+ +  D  ++   +        +R     D  VL G       + RAV       
Sbjct: 76  IGVVDVEVGLDAGNIGAKVLGGSGARGVRFTTEGDKAVLTGTAEDAVAADRAVA------ 129

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS-SGPS 227
                   +N +   VMN+  +    QV LKV   E+ R   + +G +   T  S +G S
Sbjct: 130 ------LASNLAPGGVMNMTTVRSTQQVMLKVRFIEIDRTAGRDLGVRWEGTNRSVAGRS 183

Query: 228 KSFAADFGGKFVSEGGDF---------SVKGV---------LDRFSFETV---------- 259
            + AA       + GG+          +V G            +F+   +          
Sbjct: 184 GTVAATPEALTTAPGGNGIGLLSNAIPAVAGAALSTVAAPQFGQFAARLINSNSAKVDLF 243

Query: 260 LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT-----HDYGV 314
           + ALE     R LAEP L A SGQ A F +GG++   T SSS GA  V T      ++GV
Sbjct: 244 ISALETQGLARRLAEPNLVASSGQPAEFLAGGEYPIPTASSS-GALGVPTITVTFKEFGV 302

Query: 315 VLHFTPTVLSPGRIGLRIQTEVSE--PVIGVNAG--DMPSYRVRKADTTVELPSGGTIVL 370
            L FTPTVLS G I L+++ EVSE  P I VN G   +P    R+A T +E+  G +  +
Sbjct: 303 RLTFTPTVLSNGLINLQLEPEVSEIDPAISVNTGLVTVPGLSKRRARTNIEMRDGQSFAI 362

Query: 371 AGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV-AMRDLSR 429
           AGLL+   ++  E +P L  IP+LGALF +  F + +TE+ +  TP LVKP    + L+ 
Sbjct: 363 AGLLQAVNEKNLEQLPWLGSIPVLGALFSSKEFRQRDTELVVIVTPHLVKPSKPGQPLAT 422

Query: 430 PDDHYSVEDDAKAFF 444
           P D     +DA  F 
Sbjct: 423 PLDTRMPTNDADYFL 437


>gi|312883754|ref|ZP_07743473.1| Flp pilus assembly protein CpaC [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368503|gb|EFP96036.1| Flp pilus assembly protein CpaC [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 460

 Score =  149 bits (376), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 120/410 (29%), Positives = 200/410 (48%), Gaps = 44/410 (10%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           + + + +N+  ++ +  D + + +S+   AD    +   + +FG   G A + ++    +
Sbjct: 25  EPLEVNINEAKMINLSQDAKSIFISNTHIADYQPMTNTKIMVFGMQAGTATITILNAQER 84

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
            + N  I +  D   L+  +     ++++  E +   + L G V T   +   V +++ +
Sbjct: 85  VIYNNKIRVVHDTKELDSLIAAQFPEASVHSESLGGKLWLKGNVPTPVMAHSIVSVAKGY 144

Query: 168 LS---------------QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQ 212
           LS                S  +   N +  +++N L +    QV ++V IAEV R++  +
Sbjct: 145 LSPVTANAQSEKGSTSPDSSTHSRGNENEDELINQLVVTMPTQVNIRVRIAEVSRNVSNK 204

Query: 213 IGFQHSITGSSSGPSKSF----AADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATA 268
           +G +    G   G   SF    A D     VS  G  ++ G++D         AL     
Sbjct: 205 LGIKWGSVGEGIG---SFLYTKAWD-----VSSWGKPTLSGLVD---------ALASDGT 247

Query: 269 IRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRI 328
           +  LAEP LTA+SG+ ASF  GG+     ++  T   +V    +GV L+FTP VL P RI
Sbjct: 248 MSILAEPNLTAMSGEEASFLVGGEIPLPLINGDTA--TVEYKPFGVNLNFTPVVLGPDRI 305

Query: 329 GLRIQTEVSEPVIG----VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD-DIQQLKE 383
            LR+  EVS   +     +N    PS+  R+A TT+EL SG +  L GLL+  +I QL++
Sbjct: 306 SLRVSPEVSSVSVSNQTTLNGNTYPSFTSRRATTTIELASGQSFALGGLLQSSEIDQLQK 365

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDH 433
            +P    IPILG LFR++ + R+ETE+ I AT +LV+PV    L  P D+
Sbjct: 366 -LPGAGDIPILGGLFRSNEYQRKETELIIIATAYLVEPVRNDTLPLPTDN 414


>gi|90412176|ref|ZP_01220182.1| hypothetical Flp pilus assembly protein [Photobacterium profundum
           3TCK]
 gi|90326900|gb|EAS43285.1| hypothetical Flp pilus assembly protein [Photobacterium profundum
           3TCK]
          Length = 461

 Score =  149 bits (375), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 119/404 (29%), Positives = 197/404 (48%), Gaps = 47/404 (11%)

Query: 52  IGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLN 111
           + LN    L+   ++  V VS P   D  V   R + +F   +GQA VI+ G D + +L+
Sbjct: 34  VTLNDANNLEFSQEIGTVFVSQPDILDYKVIDSRKLVIFSNKIGQAKVIVYGKDNQVLLS 93

Query: 112 LDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS 171
               ++ +++ +   L+ +  D +I V  V + V + G V   +       +  T LS+ 
Sbjct: 94  QRYHVDINLSQVRRQLKLYYPDLSISVTSVGEQVAIRGTVNNEKQRDDIYRMVATLLSKK 153

Query: 172 GRNQY----------------------ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDI 209
              +Y                       N + + ++  L +A   QV +K+++A+V ++ 
Sbjct: 154 EIERYNEAEKLKFVESGFEEANWVRYSKNYTWEGIIEGLVVAQAQQVNVKISVAQVTKEF 213

Query: 210 LKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAI 269
            + IG   S  G S G   SF  +F      +  D S           TV++A+      
Sbjct: 214 NETIGVDWSTVGRSVGEF-SFL-EF------KANDLS-----------TVINAIGNDNIA 254

Query: 270 RTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIG 329
             LAEP LT +SG+SASF  GG+     + ++  +T+++  ++G+ L  +  VLS  +I 
Sbjct: 255 EILAEPNLTVLSGESASFLVGGE--VPVIVTNDNSTNISFKEFGIKLELSAKVLSNKKIK 312

Query: 330 LRIQTEVSEPVIGVNAG--DMPSYRVRKADTTVELPSGGTIVLAGLLK-DDIQQLKEGIP 386
           L++  EVS     V A   ++P    R+A TT++L  G + +L GL+  DDI+++ + IP
Sbjct: 313 LQLAPEVSAVDGYVKAAGIEVPQLSSRRAMTTIQLADGDSFMLGGLMSSDDIEEISK-IP 371

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           LL  IPILGA FR S   R++TE+ I AT  LVKPV+  D+  P
Sbjct: 372 LLGDIPILGAAFRKSSTTRKKTELVIVATVNLVKPVSPTDVRLP 415


>gi|51597670|ref|YP_071861.1| outer membrane secretin family protein [Yersinia pseudotuberculosis
           IP 32953]
 gi|186896808|ref|YP_001873920.1| type II and III secretion system protein [Yersinia
           pseudotuberculosis PB1/+]
 gi|51590952|emb|CAH22610.1| putative outer membrane secretin family protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|186699834|gb|ACC90463.1| type II and III secretion system protein [Yersinia
           pseudotuberculosis PB1/+]
          Length = 439

 Score =  148 bits (374), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 109/390 (27%), Positives = 192/390 (49%), Gaps = 31/390 (7%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + IG + +I +Q  +D   V VS    AD  +    ++ ++ K  G A   L   + + +
Sbjct: 37  LPIGGSHIIKMQEEIDT--VFVSAAKTADYEIVDNNSVIIYAKKEGLAEFTLFNKNHQPI 94

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRT--IQDSQRAV--ELSE 165
               +L+   I      +R    DS I +  + ++ +L G   T   +D+  ++  E + 
Sbjct: 95  SKTRVLVNNTINDAYRRIRTEFPDSKIEINKIGESYILTGSAETEEAKDTIASIVGEATA 154

Query: 166 TFLSQSGRNQY-ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS 224
           +   +     Y +N   + V+N + +   +QV +K+TI E+ +D  + IG   +   S++
Sbjct: 155 SKKEKEREESYQSNPEYRGVINKIKLPQANQVNVKLTIVEITKDFTENIGLDWNSIKSAA 214

Query: 225 GPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
           G  +    +F  + +S                 T++HA+      + LAEP L+ +SG+ 
Sbjct: 215 GAFQFL--NFNAQSIS-----------------TLVHAINDEAIAKVLAEPNLSVLSGEY 255

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIG 342
           ASF  GG+     VS++    SV   ++G+ L+    V    RI + +  EVS  + V  
Sbjct: 256 ASFLVGGE--IPIVSTNQNGISVEYKEFGIKLNIGAKVNEKKRIRVMLGEEVSSIDKVFN 313

Query: 343 VNAGD-MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNS 401
           +  GD  PS R+RKA+TTVEL  G + +L GL+    ++  + IP +  +P+LGALFRN+
Sbjct: 314 LRGGDSYPSLRIRKANTTVELGDGESFILGGLISSTERESLKKIPFIGDVPLLGALFRNA 373

Query: 402 RFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           +  R ++E+ + AT  LVKPV+ R +  PD
Sbjct: 374 QTQRNQSELVVVATVNLVKPVSARQIELPD 403


>gi|283787693|ref|YP_003367558.1| tight adherence secretin RcpA [Citrobacter rodentium ICC168]
 gi|282951147|emb|CBG90838.1| putative tight adherence secretin RcpA [Citrobacter rodentium
           ICC168]
          Length = 482

 Score =  148 bits (374), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 117/414 (28%), Positives = 202/414 (48%), Gaps = 44/414 (10%)

Query: 65  DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
           D+  + +SDP  AD  V + + + ++ KN G  ++I+ G +   +L   I ++  ++ + 
Sbjct: 51  DLDTIFISDPRVADYKVVNNKNIIVYAKNTGTTDLIVYGRNNTVLLKHSISVDPFLSDIN 110

Query: 125 MTLRRFIADSNIRV------EMVSDTVV--LHGMVRTIQDSQRAV-ELSETFLSQSGRNQ 175
             + R    ++I V         +D VV  ++G V T ++S  A+ +L  + ++ SG  +
Sbjct: 111 QRVARLFPGNSIEVTRFMGGATAADKVVYIINGSV-TDEESMDAIYQLVGSIVNSSGGEE 169

Query: 176 YANSSSKK-------------------VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ 216
             N S+ K                   V+N + +   +QV + +T+ EV +     +G  
Sbjct: 170 KDNKSANKRVVDSKINTDLIEKKKYANVINKMQLVASNQVNVHLTVVEVSKTFTDALGID 229

Query: 217 HSITGSSSGPSKSFAADFGGKFVSEGGDFSV---KGVLDRFSFETVLHALERATAIRTLA 273
            S    SS  +       GG  ++  G F++   KG  D  +  TV++A++  +  R +A
Sbjct: 230 WSSLTLSSIVN-------GGASINNPGTFNLLGFKGGFDAKNISTVINAIQNDSVARIMA 282

Query: 274 EPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQ 333
           +P LT +SG++A F  GG+    + +S    T+VT  +YG+ L     V    +I L + 
Sbjct: 283 QPNLTVLSGETADFLVGGEIPILSKNSDNEGTTVTYKEYGIKLSIAAKVEKKSKIKLSLS 342

Query: 334 TEVSE--PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKI 391
            E+S        NA  +P+   R++ +T+EL  G +  + GLL +   +    +P +  I
Sbjct: 343 NEISSISGAYSFNAYSIPTLTTRRSSSTIELADGDSFAIGGLLTEKDYETLGKVPFIGDI 402

Query: 392 PILGALFRNSRFNREETEIFIAATPFLVKPVAM-RDLSRPDDHYSVEDDAKAFF 444
           PILGAL RNS   RE+TE+ I AT  LVKPVA  RD+  P+  Y+   + K FF
Sbjct: 403 PILGALARNSNTQREKTELVIFATVNLVKPVASNRDIVLPE--YNKTSNNKLFF 454


>gi|21673269|ref|NP_661334.1| type II secretion system protein [Chlorobium tepidum TLS]
 gi|21646357|gb|AAM71676.1| type II secretion system protein [Chlorobium tepidum TLS]
          Length = 445

 Score =  148 bits (374), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 131/413 (31%), Positives = 201/413 (48%), Gaps = 59/413 (14%)

Query: 53  GLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNL 112
           G ++V  L VP   + V V DP  AD ++ SP  +YL GK  G  N+I+ G +G      
Sbjct: 16  GESRVYRLAVPA--KRVAVGDPAIADFIMISPSELYLSGKKTGATNLIVWGKNG-NFTTA 72

Query: 113 DILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL--- 168
            +++ R++  ++  LR  +  + +I++    D +VL G V     ++ A+ L +TFL   
Sbjct: 73  PLVVSRNVKPIQDLLRAVLPKEHDIQLYSSGDALVLAGSVSNALAAETAIRLVKTFLGGT 132

Query: 169 ------------------------SQSGRN------------QYANSSSKKVMNLLNIAG 192
                                   S SG                A+S     +NLL I  
Sbjct: 133 VPDVTPEATLTKKSEAATGTSGGTSISGMTGVASAAGMSGAATVASSGIHGFINLLKIRD 192

Query: 193 EDQVTLKVTIAEVRRDILKQIGFQHSI-TGSSSGPSKSFAADFGGKFVSEGGDFSVKGVL 251
             QV L+V IAEV +  ++ +GF  +   GS++G S          FVS     +   +L
Sbjct: 193 PQQVRLEVRIAEVSKSYMEALGFSWTQGVGSTAGSS------LMTGFVSN----ATLNLL 242

Query: 252 DRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHD 311
            + S    + A  +   I+ LAEPT+ A+SGQ   F  GG+ +Y    +  GA       
Sbjct: 243 LKNSGNLKVEADSQKNWIKMLAEPTIVAMSGQEGYFLVGGK-IYTPTPTGNGAVDYQERT 301

Query: 312 YGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAG----DMPSYRVRKADTTVELPSGGT 367
           YGV L FTPTVL  GRI L++  EVSEP     +     ++P+++V  A TTVE+  G  
Sbjct: 302 YGVGLRFTPTVLDAGRISLKVAPEVSEPDSQFQSAGSLYNLPAFKVSAASTTVEMNEGQN 361

Query: 368 IVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           +V+ GLLKD + +  E +PLL ++P+LGALFR++  + E+ E+ +   P LVK
Sbjct: 362 LVIGGLLKDKLTETIEAVPLLGQLPLLGALFRHTSMDSEKVEVIVIVRPTLVK 414


>gi|84385704|ref|ZP_00988735.1| rough colony protein RcpA [Vibrio splendidus 12B01]
 gi|84379684|gb|EAP96536.1| rough colony protein RcpA [Vibrio splendidus 12B01]
          Length = 447

 Score =  147 bits (372), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 121/392 (30%), Positives = 195/392 (49%), Gaps = 36/392 (9%)

Query: 60  LQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERD 119
           + +  ++  V V++   AD  + +   + ++G   G  ++I     G ++ N ++++ + 
Sbjct: 37  INIKRNIDTVFVANSQIADYKIIANGKLVIYGIGRGATSIIAYDRAGNEIYNAEVVVNKS 96

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSG-RNQY-- 176
           +  L+ TL     D NI++  + + VVL G+V + +       L    + +S  R+ +  
Sbjct: 97  LRLLKQTLVARYPDENIKLTNIGEQVVLDGVVSSEEVKANVYRLVGEMMKKSKERHTFEL 156

Query: 177 --ANSSS------------KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGS 222
             AN  S            + ++N L +   +Q+ +K+T+AEV    L ++G  ++    
Sbjct: 157 SGANGESVDALDFTATYVFQDIINNLKVLTTEQINVKLTVAEVSSSFLTELGVSYA---E 213

Query: 223 SSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISG 282
           S+G S   A    G FV++  DF+ + ++       V+ A       R LAEP L+ ISG
Sbjct: 214 SNGKSIGGA----GTFVNKILDFTAQDIV------AVISASGNDNIGRVLAEPNLSVISG 263

Query: 283 QSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPV 340
           +SASF  GG+ +   V  + G  S+T  +YGV L     V     I L +  EVS  +  
Sbjct: 264 ESASFLVGGE-IPIAVRDNDGV-SITYKEYGVKLSMVAKVTDSENIRLSLLPEVSSIDKA 321

Query: 341 IGVNAG--DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALF 398
            GVN+G   +PS R RKA TTV+L  G + VLAGLL  + Q+    IPLL  IPILGALF
Sbjct: 322 NGVNSGLISVPSLRTRKAQTTVQLKDGQSFVLAGLLTTEEQESLSRIPLLGDIPILGALF 381

Query: 399 RNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
             +   R +TE+ I AT  LV PV   ++  P
Sbjct: 382 SKTNTERRKTELIIVATVNLVDPVKEDEIKLP 413


>gi|330862294|emb|CBX72455.1| hypothetical protein YEW_HH31870 [Yersinia enterocolitica W22703]
          Length = 271

 Score =  147 bits (372), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 86/250 (34%), Positives = 141/250 (56%), Gaps = 18/250 (7%)

Query: 185 MNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGD 244
           MN + + G +QV +K+TIAEV +D  + IG   S  G+ SG  + F  +   KF ++G  
Sbjct: 1   MNKIKLPGSNQVNVKLTIAEVSKDFSENIGMDWSTIGNFSGSFQFFKLNGSNKFNAKG-- 58

Query: 245 FSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGA 304
                         ++HA+   +  R LAEP L+ +SG+SASF  GG+     V+++  +
Sbjct: 59  -----------ISALVHAINDDSIARVLAEPNLSVLSGESASFLVGGE--LPLVNTTANS 105

Query: 305 TSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGVNAGD-MPSYRVRKADTTVE 361
           T +T   +G+ L+    V +  RI +++  EVS  + V  ++ GD  PS+R RKA TT+E
Sbjct: 106 TVITYKQFGIKLNIGAKVNAKKRIRIKLDEEVSSVDKVFNIDGGDAYPSFRTRKAATTLE 165

Query: 362 LPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
           L  G + +L GL+    ++  + IP +  IPILGA FRN+   + +TE+ + AT  LV+P
Sbjct: 166 LGDGESFILGGLISSSEREALKKIPFIGDIPILGAFFRNAETRKNQTELVVVATVNLVRP 225

Query: 422 VAMRDLSRPD 431
           V+ +++  P+
Sbjct: 226 VSEKEVELPN 235


>gi|153833257|ref|ZP_01985924.1| general secretion pathway protein D [Vibrio harveyi HY01]
 gi|148870528|gb|EDL69443.1| general secretion pathway protein D [Vibrio harveyi HY01]
          Length = 456

 Score =  147 bits (372), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 116/407 (28%), Positives = 196/407 (48%), Gaps = 49/407 (12%)

Query: 51  SIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQML 110
           SI LN    + V   +  V +S+P  AD  V +  T+ +F   +GQ+ +I+ G D   +L
Sbjct: 34  SITLNDGQHISVKQPIGKVFISNPDVADYKVINDTTLVVFANGIGQSRLIVYGIDEDVLL 93

Query: 111 NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQ 170
           +  I+++ D+  +   L+    D+ + V+ V + V + G+V + +       L  T L +
Sbjct: 94  SDRIIVDLDLTEIRRQLKFHFPDAKVTVQSVGEQVAVGGVVDSEETRDEIYRLVATLLGR 153

Query: 171 SG------------RNQYA------------NSSSKKVMNLLNIAGEDQVTLKVTIAEVR 206
                         ++ YA            N + K ++  + +A   QV +K+++A+V 
Sbjct: 154 EKTEKWDKTYKFEFKSDYAQYEEPEGMIFARNMTWKGIVERIQVATTQQVNVKISVAQVT 213

Query: 207 RDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERA 266
               K +G   S  GSS G           +FV +          D  +  T++ AL   
Sbjct: 214 ESFGKTVGVDWSSVGSSVG-----------EFVFDQ--------FDAANLSTLITALGND 254

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
                LAEP LT +SG+SASF  GG+     + S+    +++  ++G+ L  T  VLS  
Sbjct: 255 QVAEVLAEPNLTVLSGESASFLVGGE--VPVIVSTNNNVNISFKEFGIKLDLTAKVLSQD 312

Query: 327 RIGLRIQTEVSEPVIGVNAG--DMPSYRVRKADTTVELPSGGTIVLAGLLKD-DIQQLKE 383
           +I +++  EVSE    V A    +P    R+A TTVEL  G + +L GL+   D++++++
Sbjct: 313 KIRMQLAPEVSEVESYVEAAGVKVPQLASRRALTTVELADGDSFILGGLMSSADLEKMQK 372

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
            IP +  IPILGA FR +   R+ TE+ I AT  LV+P+  +D+  P
Sbjct: 373 -IPFVGDIPILGAAFRKATTERKRTELIIVATVNLVEPIKPKDVQLP 418


>gi|170022934|ref|YP_001719439.1| type II and III secretion system protein [Yersinia
           pseudotuberculosis YPIII]
 gi|169749468|gb|ACA66986.1| type II and III secretion system protein [Yersinia
           pseudotuberculosis YPIII]
          Length = 423

 Score =  147 bits (372), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 108/390 (27%), Positives = 189/390 (48%), Gaps = 31/390 (7%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + IG + +I +Q  +D   V VS    AD  +    ++ ++ K  G A   L   + + +
Sbjct: 21  LPIGGSHIIKMQEEIDT--VFVSAAKTADYEIVDNNSVIIYAKKEGLAEFTLFNKNHQPI 78

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL---SET 166
               +L+   I      +R    DS I +  + ++ +L G   T +       +   +  
Sbjct: 79  SKTRVLVNNTINDAYRRIRTEFPDSKIEINKIGESYILTGSAETEEAKDTIANIVGEATA 138

Query: 167 FLSQSGRNQYANSSS--KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS 224
              +  R ++  SS   + V+N + +   +QV +K+TI E+ +D  + IG   +   S++
Sbjct: 139 SKKEKEREEHYQSSPEYRGVINKIKLPQANQVNVKLTIVEITKDFTENIGLDWNSIKSAA 198

Query: 225 GPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
           G  +    +F  + +S                 T++HA+      + LAEP L+ +SG+ 
Sbjct: 199 GAFQFL--NFNAQSIS-----------------TLVHAINDEAIAKVLAEPNLSVLSGEY 239

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIG 342
           ASF  GG+     VS++    SV   ++G+ L+    V    RI + +  EVS  + V  
Sbjct: 240 ASFLVGGE--IPIVSTNQNGISVEYKEFGIKLNIGAKVNEKKRIRVMLGEEVSSIDKVFN 297

Query: 343 VNAGD-MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNS 401
           +  GD  PS R+RKA+TTVEL  G + +L GL+    ++  + IP +  +P+LGALFRN+
Sbjct: 298 LRGGDSYPSLRIRKANTTVELGDGESFILGGLISSTERESLKKIPFIGDVPLLGALFRNA 357

Query: 402 RFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           +  R ++E+ + AT  LVKPV+ R +  PD
Sbjct: 358 QTQRNQSELVVVATVNLVKPVSARQIELPD 387


>gi|153948843|ref|YP_001399594.1| type II/III secretion system protein [Yersinia pseudotuberculosis
           IP 31758]
 gi|152960338|gb|ABS47799.1| type II/III secretion system protein [Yersinia pseudotuberculosis
           IP 31758]
          Length = 439

 Score =  147 bits (370), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 105/382 (27%), Positives = 188/382 (49%), Gaps = 31/382 (8%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER 118
           I++   ++  V VS    AD  +    ++ ++ K  G A   L   + + +    +L+  
Sbjct: 44  IIKTQEEIDTVFVSAAKTADYEIVDNNSVIIYAKKEGLAEFTLFNKNHQPISKTRVLVNN 103

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRT--IQDSQRAVELSETFLSQSGRNQ- 175
            I      +R    DS I +  + ++ +L G   T   +D+  ++ + E   S+  + + 
Sbjct: 104 TINDAYRRIRTEFPDSKIEINKIGESYILTGSAETEEAKDTITSI-IGEATASKKEKERE 162

Query: 176 ---YANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAA 232
               +N   + V+N + +   +QV +K+TI E+ +D  + IG   +   S++G  +    
Sbjct: 163 ESYQSNPEYRGVINKIKLPQANQVNVKLTIVEITKDFTENIGLDWNSIKSAAGAFQFL-- 220

Query: 233 DFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQ 292
           +F  + +S                 T++HA+      + LAEP L+ +SG+ ASF  GG+
Sbjct: 221 NFNAQSIS-----------------TLVHAINDEAIAKVLAEPNLSVLSGEYASFLVGGE 263

Query: 293 HLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGVNAGD-MP 349
                VS++    SV   ++G+ L+    V    RI + +  EVS  + V  +  GD  P
Sbjct: 264 --IPIVSTNQNGISVEYKEFGIKLNIGAKVNEKKRIRVMLGEEVSSIDKVFNLRGGDSYP 321

Query: 350 SYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETE 409
           S R+RKA+TTVEL  G + +L GL+    ++  + IP +  +P+LGALFRN++  R ++E
Sbjct: 322 SLRIRKANTTVELGDGESFILGGLISSTERESLKKIPFIGDVPLLGALFRNAQTQRNQSE 381

Query: 410 IFIAATPFLVKPVAMRDLSRPD 431
           + + AT  LVKPV+ R +  PD
Sbjct: 382 LVVVATVNLVKPVSARQIELPD 403


>gi|312116090|ref|YP_004013686.1| type II and III secretion system protein [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311221219|gb|ADP72587.1| type II and III secretion system protein [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 519

 Score =  147 bits (370), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 114/408 (27%), Positives = 198/408 (48%), Gaps = 48/408 (11%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + + LN+   ++V     + LV++   ADVV  +  ++ + GK +G   + L+  D + +
Sbjct: 74  VRVVLNRSENVKVEYPFTEALVTNSDIADVVPLTNASINILGKKIGNTRLSLLDQDKRVI 133

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
             +DI +  D+  L   +R   + SN+RV  V+  +++ G         RA+ L+E F  
Sbjct: 134 GIVDIEVSHDVDMLRRVMRDNPSFSNLRVAAVNGRIMIAGQASDAVALSRALALAEQF-- 191

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDI-------------------- 209
                     +  +V N + +A   QV L+V   E  R++                    
Sbjct: 192 ----------APGQVTNAMTVASPQQVMLEVRFIEASRNLARGVGVNVSGGGRYAGGTTG 241

Query: 210 LKQIGFQHSITGSSSGPSKSFAADFG---GKFVSEGGDFSVKGVLDRFSFETVLHALERA 266
           ++ +  + SIT  S+G + +  +D     G  +   G  + + +      +  + ALE  
Sbjct: 242 VETLKEKSSITSDSTGITTNLISDLAAGLGSNLVPFGAMTGRVIGGSAPIDVTIRALESQ 301

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
              R LAEP L A+SG +ASF +GG+  +  V+ +    +     +G+ L FTPTVL+  
Sbjct: 302 GLARRLAEPNLVALSGDTASFLAGGEFPFP-VAGTNNTITTEFKKFGIGLAFTPTVLARR 360

Query: 327 RIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD----DI 378
           +I L+I+ EVSE      + +   ++P   VR+A TTVEL  G +  +AGL++     D 
Sbjct: 361 QINLKIEPEVSEIDYSAAVKIGNVEVPGLSVRRASTTVELRDGQSFAIAGLMQGFHNADT 420

Query: 379 QQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRD 426
           +QL    P +  +PILGAL R++ F ++ET++ I  TP LV+P+   D
Sbjct: 421 RQL----PWIGDVPILGALTRSTSFQKKETDLVIIVTPCLVQPMVPGD 464


>gi|156977409|ref|YP_001448315.1| Flp pilus assembly protein, secretin CapC [Vibrio harveyi ATCC
           BAA-1116]
 gi|156529003|gb|ABU74088.1| hypothetical protein VIBHAR_06196 [Vibrio harveyi ATCC BAA-1116]
          Length = 456

 Score =  145 bits (366), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 110/389 (28%), Positives = 188/389 (48%), Gaps = 49/389 (12%)

Query: 69  VLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLR 128
           V +S+P  AD  V +  T+ +F   +GQA +I+ G D   +L+  I+++ D+  +   ++
Sbjct: 52  VFISNPDVADYKVINDTTLVVFANGIGQARLIVYGIDEDVLLSDRIIVDLDLTDVRRQIK 111

Query: 129 RFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSG------------RNQY 176
               D+ + V+ + + V + G V + +       L  T L +              ++ Y
Sbjct: 112 FNFPDAKVTVQSIGEQVAVSGFVDSEETRDEIYRLVATLLGREKIKKWDKADKFEFKSDY 171

Query: 177 A------------NSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS 224
           A            N S + ++  + +A   QV +K+++A+V     K +G   S  GSS 
Sbjct: 172 AQYEAPEGMIFARNMSWRGIVERIEVATTQQVNVKISVAQVTESFGKTVGVDWSSVGSSV 231

Query: 225 GPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
           G           +FV +          D  +  T++ AL        LAEP LT +SG+S
Sbjct: 232 G-----------EFVFDQ--------FDAANLSTLITALGNDQVAEVLAEPNLTVLSGES 272

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN 344
           ASF  GG+     + S+    +++  ++G+ L  T  VLS  +I +++  EVSE    V 
Sbjct: 273 ASFLVGGE--VPVIISTNNNVNISFKEFGIKLDLTAKVLSKDKIRMQLAPEVSEVESYVE 330

Query: 345 AG--DMPSYRVRKADTTVELPSGGTIVLAGLLKD-DIQQLKEGIPLLSKIPILGALFRNS 401
           A    +P    R+A TTVEL  G + +L GL+   D++++++ IP +  IPILGA FR +
Sbjct: 331 AAGIKVPQLASRRALTTVELADGDSFILGGLMSSADLEKMQK-IPFVGDIPILGAAFRKA 389

Query: 402 RFNREETEIFIAATPFLVKPVAMRDLSRP 430
              R+ TE+ I AT  LV+P+  +D+  P
Sbjct: 390 MTERKRTELIIVATVNLVEPIKPKDVQLP 418


>gi|78186537|ref|YP_374580.1| type II secretion system protein [Chlorobium luteolum DSM 273]
 gi|78166439|gb|ABB23537.1| type II secretion system protein [Chlorobium luteolum DSM 273]
          Length = 461

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 122/448 (27%), Positives = 206/448 (45%), Gaps = 53/448 (11%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + +G ++V  L+ P+  + V V +P  AD ++ +   +YL GK  G  N+IL    G   
Sbjct: 25  VPVGESRVYRLEQPI--KRVAVGNPEVADYIMLNSSELYLLGKKTGATNLILWDQKGNCT 82

Query: 110 LNLDILIERDIAHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
             L + + R++  ++  L+  +  +++I++      +VL G       ++ A  L + +L
Sbjct: 83  STL-LQVSRNVYPIKKLLKTALPKETDIQIFASGPALVLAGSASNSLAAESAYRLVKAYL 141

Query: 169 ------------------------SQSGRNQ-------YANSSSKK------VMNLLNIA 191
                                   S SG           A S+S        ++NLL + 
Sbjct: 142 GGTVPGVNPESSLSNSGSGSAAPASMSGTQNSSYAAPVIATSASTAPAGMSGLVNLLTVR 201

Query: 192 GEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVL 251
              QV L+V IAEV +  ++ +G      G + G   +  +   G FVS      +    
Sbjct: 202 DTQQVRLEVRIAEVSKSYIETLGL-----GWTQGVGNTQGSLMTG-FVSNATLNLLLQTK 255

Query: 252 DRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHD 311
                   + A  +   I+ LAEPT+ A+SGQ   F  GG+ +Y    S+ GA       
Sbjct: 256 SNPGNRLDMDAERKEGLIKILAEPTMVAMSGQEGYFLVGGK-VYTPTLSTNGAVDYVERT 314

Query: 312 YGVVLHFTPTVLSPGRIGLRIQTEVSEP----VIGVNAGDMPSYRVRKADTTVELPSGGT 367
           YGV L FTP VL  GRI L++  EVSEP    V    +G +P ++   A +TV++  G  
Sbjct: 315 YGVGLRFTPVVLDSGRISLKVAPEVSEPLKEAVTAGTSGPLPGFKTSFASSTVQMREGEN 374

Query: 368 IVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDL 427
           +V+ GLL+D++ ++   +PLL+ IPILG+LFR++  + E TE+ +   P L+K  + +  
Sbjct: 375 LVIGGLLRDNLTEVVRAVPLLADIPILGSLFRHTEKSSETTELMVIIRPTLIK-ASDKAP 433

Query: 428 SRPDDHYSVEDDAKAFFFNRVNKIYGPK 455
             P D +     ++ F   ++    G K
Sbjct: 434 ELPTDRFVPPSSSELFIEGKLQSSRGSK 461


>gi|197335194|ref|YP_002155269.1| general secretion pathway protein D [Vibrio fischeri MJ11]
 gi|197316684|gb|ACH66131.1| general secretion pathway protein D [Vibrio fischeri MJ11]
          Length = 436

 Score =  144 bits (363), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 111/379 (29%), Positives = 180/379 (47%), Gaps = 33/379 (8%)

Query: 65  DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
           ++  V +S+P  AD  +     + LFG+ VG +  I     G+++LN  I++ R+ + +E
Sbjct: 41  EIGSVFISNPKVADYKIIDKYKVVLFGREVGDSVFIAFDVQGRELLNKKIIVSRNYSGIE 100

Query: 125 MTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKK- 183
             ++     S+I +  +    V+ G V   +D  +  E+  T L     +  A     + 
Sbjct: 101 QQVKLRFPTSDIDIFAIGTNAVVSGTVLNEEDRDQIYEMVATLLFDDNADNNAQDDRTEL 160

Query: 184 ----------VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAAD 233
                     V+N + +A   QV +K+TIAEV    ++  G +    G +          
Sbjct: 161 TYMDKLNFEGVVNQIEVARTKQVNVKLTIAEVSHSFMQDFGIKVGSNGQA---------- 210

Query: 234 FGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQH 293
             G FV +   FS   ++      +V+ A+   +  + LAEP L+ ISG+ ASF  GG+ 
Sbjct: 211 --GIFVDQLVHFSASDIV------SVITAVGTDSVGQVLAEPNLSVISGEDASFLVGGE- 261

Query: 294 LYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGVNAGDMPSY 351
               V+   GAT+V   ++GV L  T  V    +I L +   VS  +     +  ++PS 
Sbjct: 262 -LPVVTVIDGATNVQYKEFGVKLDLTAKVERDDKIKLALAPSVSSLDTQYANDNYNLPSL 320

Query: 352 RVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIF 411
           + R A TTVEL  G + VL GLL  + ++    IP +  IPILGALFR++   R +TE+ 
Sbjct: 321 KTRSARTTVELGDGQSFVLGGLLNSEEKESLTRIPFVGDIPILGALFRHTGTERNKTELI 380

Query: 412 IAATPFLVKPVAMRDLSRP 430
           I AT  LV+PV    +  P
Sbjct: 381 IVATVNLVQPVKANQIQLP 399


>gi|149188846|ref|ZP_01867136.1| hypothetical Flp pilus assembly protein [Vibrio shilonii AK1]
 gi|148837266|gb|EDL54213.1| hypothetical Flp pilus assembly protein [Vibrio shilonii AK1]
          Length = 453

 Score =  144 bits (362), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 108/394 (27%), Positives = 187/394 (47%), Gaps = 53/394 (13%)

Query: 66  VQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEM 125
           +  V VSDP   D  V +  ++ +F K VGQA +++ G   K + +  I+ + D++ +  
Sbjct: 46  ITKVFVSDPDIVDYNVINENSIVIFSKAVGQARLMIYGESEKLLYSERIIADIDLSQVRR 105

Query: 126 TLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQY--------- 176
            +     D+++++E V + V + G+V + ++      L  T L +    ++         
Sbjct: 106 QVALLFPDTSVKIESVGNQVAVSGIVNSERERDDIYRLVATLLGREKLEKWDKVQKLKFQ 165

Query: 177 ---------------ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG 221
                           N +   ++  L +A   QV +K+++A+V     + +G   S   
Sbjct: 166 NDNISIEEPESMIFERNMTWDGIIERLEVATVQQVNVKISVAQVTERFAETVGVDWS--- 222

Query: 222 SSSGPSKSFAADFGGKFVS--EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
                  SF A+ G       E  D +           T++ AL      + LAEP LT 
Sbjct: 223 -------SFGANVGQFLFQQFEAADLT-----------TLITALGNENVAQVLAEPNLTV 264

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP 339
           ISG+SASF  GG+     + S+    ++T  ++G+ L  T  VL+  +I +++  EVSE 
Sbjct: 265 ISGESASFLVGGE--VPVIVSTNNNVNITFKEFGIKLDLTAKVLTEEKIRMQLFPEVSEI 322

Query: 340 VIGVNAG--DMPSYRVRKADTTVELPSGGTIVLAGLLKD-DIQQLKEGIPLLSKIPILGA 396
              + A   ++P    R+A TT+EL  G + VL GL+   D +++++  PL+  IP+LGA
Sbjct: 323 ERYIRAAGIEVPQLATRRAMTTIELGDGDSFVLGGLMSSADFEEIQK-TPLIGDIPVLGA 381

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
            FR S  +R  TE+ I AT  LVKP+  +D+  P
Sbjct: 382 AFRKSSTDRRRTELIIVATVNLVKPMKRKDIQLP 415


>gi|221213139|ref|ZP_03586115.1| bacterial type II/III secretion system protein [Burkholderia
           multivorans CGD1]
 gi|221167352|gb|EED99822.1| bacterial type II/III secretion system protein [Burkholderia
           multivorans CGD1]
          Length = 443

 Score =  143 bits (361), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 179/385 (46%), Gaps = 50/385 (12%)

Query: 66  VQDVLVSDPTKADVVVHSPR---TMYLFGKNVGQANVILI--GHDGKQMLNLDILIERDI 120
           +Q V V DP  ADV++        + +  K  G  NV+L   G D   + N++++     
Sbjct: 43  LQRVAVGDPAIADVLIMKGSRSGAVLVIAKAPGATNVMLWERGRDEPTVWNVEVVDAAAH 102

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
           A L+        DS  RV     T VL G   ++   +RAV +        G+N    S 
Sbjct: 103 AVLD--------DSTPRVNTYGGTSVLRGTAASLDAHERAVAV--------GKNV---SG 143

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH-------SITGSSSGPSKSFAAD 233
              V++   +AG++ V + V + E  R +LKQ+GF         S    S G  +S+   
Sbjct: 144 KGAVIDRSTLAGKNVVQVDVRVVEFSRSVLKQVGFNFFKQSNGFSFGSFSPGGVQSYN-- 201

Query: 234 FGGKFVSEGGDFSVKGVLDRFSFETVLHA-----------LERATAIRTLAEPTLTAISG 282
            GG      G     G     +F  V++A           LE     R LAEPTL A+SG
Sbjct: 202 -GGAGPGSAGYLPTLGAPVASAFNLVVNAAGRGIFADLSLLEANNLARVLAEPTLVALSG 260

Query: 283 QSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE---- 338
           QSASF +GG+    +     G+T++    YGV L  TPTVLSP RI L++  E S+    
Sbjct: 261 QSASFLAGGEIPVPS-PQGLGSTAIQWKQYGVGLSLTPTVLSPQRIALKVAPESSQLDFV 319

Query: 339 PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALF 398
             + ++   +P    R+ADTTVEL  G + V+ GL+          +PLL  +PI+G  F
Sbjct: 320 NSVTISGVAVPGITTRRADTTVELGDGESFVIGGLIDRQTMSNVSKVPLLGDLPIIGTFF 379

Query: 399 RNSRFNREETEIFIAATPFLVKPVA 423
           +N  + + + E+ I  TP LV P+A
Sbjct: 380 KNLNYQQNDKELLIIVTPHLVAPIA 404


>gi|221197781|ref|ZP_03570827.1| bacterial type II/III secretion system protein [Burkholderia
           multivorans CGD2M]
 gi|221204661|ref|ZP_03577678.1| bacterial type II/III secretion system protein [Burkholderia
           multivorans CGD2]
 gi|221175518|gb|EEE07948.1| bacterial type II/III secretion system protein [Burkholderia
           multivorans CGD2]
 gi|221181713|gb|EEE14114.1| bacterial type II/III secretion system protein [Burkholderia
           multivorans CGD2M]
          Length = 443

 Score =  143 bits (361), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 179/385 (46%), Gaps = 50/385 (12%)

Query: 66  VQDVLVSDPTKADVVVHSPR---TMYLFGKNVGQANVILI--GHDGKQMLNLDILIERDI 120
           +Q V V DP  ADV++        + +  K  G  NV+L   G D   + N++++     
Sbjct: 43  LQRVAVGDPAIADVLIMKGSRSGAVLVIAKAPGATNVMLWERGRDEPTVWNVEVVDAAAH 102

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
           A L+        DS  RV     T VL G   ++   +RAV +        G+N    S 
Sbjct: 103 AVLD--------DSTPRVNTYGGTSVLRGTAASLDAHERAVAV--------GKNV---SG 143

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH-------SITGSSSGPSKSFAAD 233
              V++   +AG++ V + V + E  R +LKQ+GF         S    S G  +S+   
Sbjct: 144 KGTVIDRSTLAGKNVVQVDVRVVEFSRSVLKQVGFNFFKQSNGFSFGSFSPGGVQSYN-- 201

Query: 234 FGGKFVSEGGDFSVKGVLDRFSFETVLHA-----------LERATAIRTLAEPTLTAISG 282
            GG      G     G     +F  V++A           LE     R LAEPTL A+SG
Sbjct: 202 -GGAGPGSAGYLPTLGAPVASAFNLVVNAAGRGIFADLSLLEANNLARVLAEPTLVALSG 260

Query: 283 QSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE---- 338
           QSASF +GG+    +     G+T++    YGV L  TPTVLSP RI L++  E S+    
Sbjct: 261 QSASFLAGGEIPVPS-PQGLGSTAIQWKQYGVGLSLTPTVLSPQRIALKVAPESSQLDFV 319

Query: 339 PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALF 398
             + ++   +P    R+ADTTVEL  G + V+ GL+          +PLL  +PI+G  F
Sbjct: 320 NSVTISGVAVPGITTRRADTTVELGDGESFVIGGLIDRQTMSNVSKVPLLGDLPIIGTFF 379

Query: 399 RNSRFNREETEIFIAATPFLVKPVA 423
           +N  + + + E+ I  TP LV P+A
Sbjct: 380 KNLNYQQNDKELLIIVTPHLVAPIA 404


>gi|187923645|ref|YP_001895287.1| type II and III secretion system protein [Burkholderia phytofirmans
           PsJN]
 gi|187714839|gb|ACD16063.1| type II and III secretion system protein [Burkholderia phytofirmans
           PsJN]
          Length = 468

 Score =  143 bits (361), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 118/403 (29%), Positives = 187/403 (46%), Gaps = 48/403 (11%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVV---HSPRTMYLFGKNVGQA 97
           D+ +G  ++I++G            +Q V + DP+ ADV++        + L GK  G  
Sbjct: 55  DLTVGAQRQIAVGHT----------LQRVAIGDPSVADVLIIKGDKRGGVLLVGKAAGTT 104

Query: 98  NVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDS 157
           N++L   D    L   + +    A         +      V+++  T ++ G   T++  
Sbjct: 105 NLMLWSRDRDAPLQYTVNVTTPAAA------SLLGADTPAVKVLGGTAIVSGTSATMEAH 158

Query: 158 QRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ- 216
           QRAV  +E  L + G           V +   +A    V + V + E  R +LK++GF  
Sbjct: 159 QRAVVAAEGSLGKDG----------AVFDTSTVASRAVVQVDVRVVEFSRSVLKEVGFNF 208

Query: 217 ----HSITGSSSGPSK-SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHAL-------E 264
               +  T  S  PS  S  +   G+  S  G   +    +   F +  H L       E
Sbjct: 209 FKQNNGFTFGSFAPSALSSVSATAGQAPSLTGVTPISSAFNLI-FNSATHGLFANLSLLE 267

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLS 324
                R LAEPTL A+SGQSASF +GG+ +   V  + G+TS+    YGV L  TPTVLS
Sbjct: 268 SNNLARVLAEPTLVALSGQSASFLAGGE-VPIPVPQALGSTSIEFKPYGVGLTLTPTVLS 326

Query: 325 PGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQ 380
           P RI L++  E S+      + ++   +P++  R+ADTTVEL  G + V+ GL+  +   
Sbjct: 327 PQRIALKVAPEASQLDFANAVTISGVSVPAFTTRRADTTVELGDGESFVIGGLIDRETAS 386

Query: 381 LKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA 423
               +PLL  +P++G  F+   + + E E+ I  TP LV P+A
Sbjct: 387 NVSKVPLLGDLPVIGTFFKQLNYQQNEKELVIIVTPHLVSPLA 429


>gi|197106489|ref|YP_002131866.1| Flp pilus assembly protein, secretin CpaC [Phenylobacterium
           zucineum HLK1]
 gi|196479909|gb|ACG79437.1| Flp pilus assembly protein, secretin CpaC [Phenylobacterium
           zucineum HLK1]
          Length = 438

 Score =  143 bits (361), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 103/376 (27%), Positives = 177/376 (47%), Gaps = 26/376 (6%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           + I +  +K +  ++      ++VS P  A V   S R+ Y+ G   G  N+++ G  G+
Sbjct: 38  RSIHVPRDKSLSFRLAQPAARIVVSQPEIAKVTATSDRSFYVQGLEFGSTNMLVYGPGGR 97

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
            +  LDI +  D   L+  L     +  +RV  + + ++L G V       +A  +++ +
Sbjct: 98  LLEVLDIRVGYDAEGLQQDLAAAFPNEPLRVRNLGEALMLTGEVTDTGVQYKAEAIAQRY 157

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
                       +   +++ +++    QV L+V + E  R  L+ IG + +I       +
Sbjct: 158 ------------APDGLISRVSVRASQQVVLEVRVLEATRSALQDIGVEGAIG------N 199

Query: 228 KSFAADFGGKFVSE---GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
            S+A  FG   +      G   + G       + +L ALE    +RTLA P L AI GQ 
Sbjct: 200 NSWAVAFGNGLIGASPAAGALGISGGWGDTRIDLMLTALEEKGVVRTLARPNLVAIPGQK 259

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PV 340
           A+F +GG++ Y  V       S+    YGV L FTP V   G I L ++ EVS+      
Sbjct: 260 ATFHAGGEYPYP-VPQRDDLISLEFRKYGVELTFTPVVQDNGLIRLDVEPEVSQLDFTNS 318

Query: 341 IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
           + V    +P   VR+  TTVEL  G ++ + GL + +       +P +  +P+LG+LFR+
Sbjct: 319 LRVQGFTVPGLIVRRTHTTVELKPGESLAIGGLFQREYTNALRQVPGIGDVPVLGSLFRS 378

Query: 401 SRFNREETEIFIAATP 416
           +R+ + ETE+ +  TP
Sbjct: 379 ARWKKAETELVVIVTP 394


>gi|254506218|ref|ZP_05118362.1| general secretion pathway protein D [Vibrio parahaemolyticus 16]
 gi|219551036|gb|EED28017.1| general secretion pathway protein D [Vibrio parahaemolyticus 16]
          Length = 431

 Score =  143 bits (361), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 111/399 (27%), Positives = 196/399 (49%), Gaps = 34/399 (8%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++G  +   +    ++  V +SDP  AD  V     + +FGK VG  +++    + + +
Sbjct: 12  MNLGEGEAKAINTKAEIASVFISDPQIADYQVVDKNKLVIFGKKVGTVSLLAFDDNSETI 71

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
           ++  +++ + + H++  ++    D +I +  + + VVL G V + +       L    L+
Sbjct: 72  ISRKLVVNQSLIHIQQQVQIRYPDVSISIYNLGEQVVLAGKVPSEKIRDEINILVGELLN 131

Query: 170 QS----------GRNQY-----ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
           +           G N Y          K ++N + ++   QV +K++IAEV +  L+Q G
Sbjct: 132 KEYEDYKIEWDLGENTYEMEFMTRRHYKGIVNNIEVSTTKQVNVKLSIAEVSQSFLEQFG 191

Query: 215 FQHSITGSSSGPSKSFAADF-GGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLA 273
            ++    SS        A+F GG FV +  +FS   ++      +V+ A+      + LA
Sbjct: 192 VKYGTLDSS--------ANFMGGTFVDQLINFSAADIV------SVISAIGDDAVGQVLA 237

Query: 274 EPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQ 333
           EP L+ ISG++ASF  GG+     V+   G T+V   ++G+ L     VL   +I L + 
Sbjct: 238 EPNLSVISGETASFLVGGE--IPVVTVVDGGTNVLFKEFGIRLEMMAKVLQDDKIKLSLM 295

Query: 334 TEVS--EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKI 391
            EVS  +     +   +P+ + R+A TTVEL  G + VL GLL  + ++    +P +  +
Sbjct: 296 PEVSSLDTQYQNDRYSLPALKTRRARTTVELGDGQSFVLGGLLSTEDRESLSRVPFIGDV 355

Query: 392 PILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           PILGALFR++   R +TE+ I AT  LVKPV    +  P
Sbjct: 356 PILGALFRHTETVRNKTELVIVATVNLVKPVNPSQIQLP 394


>gi|218459699|ref|ZP_03499790.1| cpaC pilus assembly Q protein [Rhizobium etli Kim 5]
          Length = 409

 Score =  143 bits (360), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 121/390 (31%), Positives = 194/390 (49%), Gaps = 53/390 (13%)

Query: 42  VEIGKG-KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVI 100
           V +GK  + +++  N+ + L       D+++      DVV  S R++++ GK +G  N+ 
Sbjct: 42  VTLGKSVQHVTLPPNETLTLNTGQPFGDLVIGSADMIDVVPLSDRSLFVRGKKIGATNIS 101

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           + G D   +  +DI +  D + +   +R     + +RV   +D + L G+VR   + QR 
Sbjct: 102 VYGDDKSLLGVIDIRVASDFSEVASAIRSAAPSARVRVVNSNDRIRLVGVVRDGIELQRV 161

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSIT 220
           +E+++++            S + V+N L ++   QV L+V I E  R   + +G   S  
Sbjct: 162 LEIAQSY------------SEQPVLNQLRVSDSQQVMLEVRIIEASRQTGRDLGIGWSGQ 209

Query: 221 GSSSGPSKSFAADFGGKFVSEGGDFSVKGVLD----------------------RFSFET 258
           GS+ G  K+  +   G  V++ G+ + + +LD                        + + 
Sbjct: 210 GSN-GIGKATTSQ--GITVNDDGNLA-RTLLDPKGAATGMLPFGQLIAKVLQISGGNIDV 265

Query: 259 VLHALERATAIRTLAEPTLTAISGQSASFTSGGQH--LYKTVSSSTGATSVTTHDYGVVL 316
           V++ALE+   +R LA+P L A+SG +ASF +GG+   L  T + +T AT      +GV L
Sbjct: 266 VINALEQKGLVRRLAQPNLIAMSGSTASFHAGGEVPILKTTNNGTTVATETDYRPFGVRL 325

Query: 317 HFTPTVLSPGRIGLRIQTEVSE--PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLL 374
            F P VL  G I L I+ EVSE  P I VN    P +  R A TTV L  G +  +AGLL
Sbjct: 326 TFKPVVLDDGVINLEIEPEVSELDPAINVNGN--PGFISRAASTTVALRDGQSFAMAGLL 383

Query: 375 KD----DIQQLKEGIPLLSKIPILGALFRN 400
           +     DIQQL    P L +IP+LGALFR+
Sbjct: 384 QSINAKDIQQL----PGLGQIPVLGALFRS 409


>gi|59711120|ref|YP_203896.1| general secretion pathway protein D [Vibrio fischeri ES114]
 gi|59479221|gb|AAW85008.1| general secretion pathway protein D [Vibrio fischeri ES114]
          Length = 436

 Score =  143 bits (360), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 110/379 (29%), Positives = 180/379 (47%), Gaps = 33/379 (8%)

Query: 65  DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
           ++  V +S+P  AD  +     + LFG+ VG +  I     G+++LN  I++ ++ + +E
Sbjct: 41  EIGSVFISNPKVADYKIIDKYKVVLFGREVGDSVFIAFDVQGRELLNKKIIVSKNYSGIE 100

Query: 125 MTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKK- 183
             ++     S+I +  +    V+ G V   +D  +  E+  T L     +  A     + 
Sbjct: 101 QQVKLRFPTSDIDIFAIGTNAVVSGTVLNEEDRDQIYEMVATLLFDDNADNNAQDDRTEL 160

Query: 184 ----------VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAAD 233
                     V+N + +A   QV +K+TIAEV    ++  G +    G +          
Sbjct: 161 TYMDKLNFEGVVNQIEVARTKQVNVKLTIAEVSHSFMQDFGIKVGSNGQA---------- 210

Query: 234 FGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQH 293
             G FV +   FS   ++      +V+ A+   +  + LAEP L+ ISG+ ASF  GG+ 
Sbjct: 211 --GIFVDQLVHFSASDIV------SVITAVGTDSVGQVLAEPNLSVISGEDASFLVGGE- 261

Query: 294 LYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGVNAGDMPSY 351
               V+   GAT+V   ++GV L  T  V    +I L +   VS  +     +  ++PS 
Sbjct: 262 -LPVVTVIDGATNVQYKEFGVKLDLTAKVERDDKIKLALAPSVSSLDTQYANDNYNLPSL 320

Query: 352 RVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIF 411
           + R A TTVEL  G + VL GLL  + ++    IP +  IPILGALFR++   R +TE+ 
Sbjct: 321 KTRSARTTVELGDGQSFVLGGLLNSEEKESLTRIPFVGDIPILGALFRHTGTERNKTELI 380

Query: 412 IAATPFLVKPVAMRDLSRP 430
           I AT  LV+PV    +  P
Sbjct: 381 IVATVNLVQPVKANQIQLP 399


>gi|260778162|ref|ZP_05887055.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio coralliilyticus ATCC BAA-450]
 gi|260606175|gb|EEX32460.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio coralliilyticus ATCC BAA-450]
          Length = 469

 Score =  142 bits (359), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 110/415 (26%), Positives = 201/415 (48%), Gaps = 34/415 (8%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           + + +N+  ++++    + + +S+   AD    +   + +FG   G A + ++    + +
Sbjct: 27  LEVNINEAKMIRLSEKAKSIFISNTHIADYQPMTNTKIMVFGMQAGTATITVLNEQERVI 86

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            +  I +  D   L+  ++    D+++  E +   + L G V T   +   V +++ +LS
Sbjct: 87  YSNKIRVVHDTQELDELIKAQFPDASVNSESLGGKLWLKGSVPTPVMAHSIVNVAKGYLS 146

Query: 170 QSGRNQYANSS--------------------SKKVMNLLNIAGEDQVTLKVTIAEVRRDI 209
                Q +N++                      +++N L +    QV +++ IAEV R++
Sbjct: 147 PIVAPQESNNNDSSKSSNSSESNSENQQNSNGDELINQLVVTMPTQVNIRIRIAEVSRNV 206

Query: 210 LKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAI 269
             ++G +    GS      +     G    ++  D S  G   + +   ++ AL     +
Sbjct: 207 SNKLGIKW---GSLVTNGSTVENTVGSFLYNKPWDVSSWG---KPNLSALVDALASTGDM 260

Query: 270 RTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIG 329
             LAEP LTA+SG+ A+F  GG+     +   T   +V    +GV L+F P VL P RI 
Sbjct: 261 SILAEPNLTAMSGEEANFLVGGEVPIPLIQGDTA--TVEYKPFGVNLNFKPVVLGPDRIS 318

Query: 330 LRIQTEVSEPVIG----VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD-DIQQLKEG 384
           L+++ EVS   +     +N   +PS+  R+A TT+EL SG +  L GLL+  +I+QL++ 
Sbjct: 319 LKVEPEVSSVSVDNQAVLNGNVLPSFTSRRASTTIELASGQSFALGGLLQSSEIEQLQK- 377

Query: 385 IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDD 439
           +P +  IPILG LFR++ + R ETE+ I AT +LV+P    +L  P D    + D
Sbjct: 378 LPGMGDIPILGGLFRSNEYQRRETELIIIATAYLVEPTRSDNLPIPTDALIPQSD 432


>gi|320158383|ref|YP_004190761.1| type II/IV secretion system secretin RcpA/CpaC, associated with Flp
           pilus assembly [Vibrio vulnificus MO6-24/O]
 gi|319933695|gb|ADV88558.1| type II/IV secretion system secretin RcpA/CpaC, associated with Flp
           pilus assembly [Vibrio vulnificus MO6-24/O]
          Length = 441

 Score =  142 bits (359), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 112/386 (29%), Positives = 186/386 (48%), Gaps = 41/386 (10%)

Query: 66  VQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEM 125
           +  V V DP  AD  +     + ++G   G  +VI+    G ++ N ++++ + +  ++ 
Sbjct: 42  ISTVFVGDPEIADYKIIDETKVVVYGVGQGATSVIVYDRAGNELYNAEVVVNKSLRLVKQ 101

Query: 126 TLRRFIADSNIRVEMVSDTVVLHGMV----------RTIQDSQRAVELSETFLSQSGRNQ 175
           TL     D +I +  V + VVL G+V          RT+ +  +     +TF  +     
Sbjct: 102 TLIARFPDESINITNVGEQVVLDGVVSSDEIKTQIYRTVGEMLKKNSTRDTFTLKDANGD 161

Query: 176 YANSSS-------KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK 228
             +S           ++N L +   +Q+ +K+T+AEV    L ++G  +S +G +     
Sbjct: 162 EVDSLDYTATYIYDNIINNLKVLTTEQINVKLTVAEVSSSFLSELGVSYSDSGQA----- 216

Query: 229 SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
                  G+FV++  DF+ + ++       V+ A       R LAEP L+ ISG++ASF 
Sbjct: 217 -------GRFVNKLLDFTAQDIV------AVITASGDDQIGRVLAEPNLSVISGETASFL 263

Query: 289 SGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS----EPVIGVN 344
            GG+ +   +    G T ++  +YGV L     V     I L +  EVS    E      
Sbjct: 264 VGGE-IPIAIRDEDGIT-ISYKEYGVKLSMVAKVTDSENIRLSLLPEVSSIDEENKTANG 321

Query: 345 AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFN 404
             ++P+ R RKA TTV+L  G + VLAGLL  + ++    IP+L  IPILGALF +++ N
Sbjct: 322 LINVPALRTRKAQTTVQLKDGQSFVLAGLLTSEERESLSKIPVLGDIPILGALFSHTKSN 381

Query: 405 REETEIFIAATPFLVKPVAMRDLSRP 430
           + +TE+ I AT  LV PV   D+  P
Sbjct: 382 QTKTELIIVATVNLVDPVKAEDIKLP 407


>gi|163801677|ref|ZP_02195575.1| hypothetical Flp pilus assembly protein [Vibrio sp. AND4]
 gi|159174594|gb|EDP59396.1| hypothetical Flp pilus assembly protein [Vibrio sp. AND4]
          Length = 456

 Score =  142 bits (358), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 111/407 (27%), Positives = 191/407 (46%), Gaps = 49/407 (12%)

Query: 51  SIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQML 110
           SI LN    + V   +  V +S+P  AD  V +  T+ +F K VG + +++ G +   +L
Sbjct: 34  SITLNDGKHISVKQPIGKVFISNPDIADYKVINDTTLVVFAKGVGHSRLLVYGANEDVLL 93

Query: 111 NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQ 170
           +  I+++ D+  +   L+    D+ + V+ V + V + G+V + +       L    L +
Sbjct: 94  SDRIIVDLDLTQIRRQLKFHFPDAKVTVQSVGEQVAVSGVVDSEETRDAIYRLVANLLGR 153

Query: 171 SGRNQYANSSSKK------------------------VMNLLNIAGEDQVTLKVTIAEVR 206
               ++ +SS +                         ++  + +A   QV +K+++A+V 
Sbjct: 154 EKTEKWESSSKRSFKSDHGTFEEPESMIFARNMTWEGIIEQIQVATTQQVNVKISVAQVT 213

Query: 207 RDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERA 266
               K +G   +  GSS G    F  D                  D  +  T++ AL   
Sbjct: 214 ESFGKTVGVDWNSVGSSVG---GFVFD----------------QFDAANLSTLITALGND 254

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
                LAEP LT +SG+SASF  GG+     + S    T+++  ++G+ L     VLS  
Sbjct: 255 QVAEVLAEPNLTVLSGESASFLVGGE--VPVIISDANGTNISFKEFGIKLDLAAKVLSQD 312

Query: 327 RIGLRIQTEVSEPVIGVNAG--DMPSYRVRKADTTVELPSGGTIVLAGLLKD-DIQQLKE 383
           +I +++  EVSE    V A    +P    R+A TTVEL  G + +L GL+   D++++++
Sbjct: 313 KIRMQLAPEVSEVESYVEAAGIKVPQLASRRALTTVELADGDSFILGGLMSSADLEKMQK 372

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
            IP +  IPILGA FR +   R+ TE+ I AT  LV+P+  +D+  P
Sbjct: 373 -IPFIGDIPILGAAFRRATTERKRTELIIVATVNLVEPIKPKDVHLP 418


>gi|27365651|ref|NP_761179.1| Flp pilus assembly protein, secretin CpaC [Vibrio vulnificus CMCP6]
 gi|27361799|gb|AAO10706.1| Flp pilus assembly protein, secretin CpaC [Vibrio vulnificus CMCP6]
          Length = 462

 Score =  142 bits (358), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 111/430 (25%), Positives = 203/430 (47%), Gaps = 35/430 (8%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
            K+I + + +  ++ +  +++ V + D T ADV   S R+  +FG  VG+ +++++G +G
Sbjct: 23  AKQIDLEVGQSRLIPLSKEMRSVYIVDSTVADVKTPSARSALVFGAKVGKTDLVIVGKEG 82

Query: 107 KQMLNLDILIERD-IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
           + + +  + ++   ++ LE  L        I ++ V D++ + G V + + +   + L  
Sbjct: 83  EAIAHYRLNVKNSGLSQLERHLETLYPSHRITLQSVGDSIAVAGTVASPEMAADILSLVN 142

Query: 166 TF----LSQSGRNQYANSSSKK-----------------VMNLLNIAGEDQVTLKVTIAE 204
            F    ++   R +  N+ + +                 V+N L I    QV + + + E
Sbjct: 143 NFAVGQVADKERLKEINADASRKSANPPEGPGGQSVLPLVINQLKITAAPQVNISIRMVE 202

Query: 205 VRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFS-VKGVLDRFSFETVLHAL 263
           + +   +++G    I   S  P+       G +F + G D +    ++   +F  ++ AL
Sbjct: 203 MAKSTSEELG----IRWQSVNPNWMLGVSPGNQFAT-GIDLTDPDNLIKESAFMGIIDAL 257

Query: 264 ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVL 323
              + +  LAEP LTA SG+ A F  GG+  + ++   +    V    +GV L  TPTVL
Sbjct: 258 ASKSLVNVLAEPNLTAKSGEKAEFLVGGEFPFPSIDGES--VGVEFKSFGVGLSVTPTVL 315

Query: 324 SPGRIGLRIQTEVS----EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQ 379
           S  RI L +   VS    +  I +N  D+P    R A TT+EL  G +  LAGLL+   +
Sbjct: 316 SENRISLTVTPVVSALSRQNSIKINGVDVPGLDKRTATTTIELADGQSFALAGLLRTSEE 375

Query: 380 QLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA-MRDLSRPDDHYSVED 438
              + IP L ++P +GALFR ++  + E E+ I AT  LV+P   +  +  P DH+    
Sbjct: 376 NSVDAIPFLGELPGVGALFRTNKNQQIERELVIIATASLVQPTGDIESIPTPLDHFRAPT 435

Query: 439 DAKAFFFNRV 448
             +   F  +
Sbjct: 436 RLERLLFGEL 445


>gi|37680194|ref|NP_934803.1| Flp pilus assembly protein, secretin CpaC [Vibrio vulnificus YJ016]
 gi|37198941|dbj|BAC94774.1| Flp pilus assembly protein, secretin CpaC [Vibrio vulnificus YJ016]
          Length = 462

 Score =  142 bits (358), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 111/430 (25%), Positives = 203/430 (47%), Gaps = 35/430 (8%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
            K+I + + +  ++ +  +++ V + D T ADV   S R+  +FG  VG+ +++++G +G
Sbjct: 23  AKQIDLEVGQSRLIPLSKEMRSVYIVDSTVADVKTPSARSALVFGAKVGKTDLVIVGKEG 82

Query: 107 KQMLNLDILIERD-IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
           + + +  + ++   ++ LE  L        I ++ V D++ + G V + + +   + L  
Sbjct: 83  EAIAHYRLNVKNSGLSQLEHHLETLYPSHRITLQSVGDSIAVAGTVASPEMAADILSLVN 142

Query: 166 TF----LSQSGRNQYANSSSKK-----------------VMNLLNIAGEDQVTLKVTIAE 204
            F    ++   R +  N+ + +                 V+N L I    QV + + + E
Sbjct: 143 NFAVGQVADKERLKEINADASRKSANPPEGPGGQSVLPLVINQLKITAAPQVNISIRMVE 202

Query: 205 VRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFS-VKGVLDRFSFETVLHAL 263
           + +   +++G    I   S  P+       G +F + G D +    ++   +F  ++ AL
Sbjct: 203 MAKSTSEELG----IRWQSVNPNWMLGVSPGNQFAT-GIDLTDPDNLIKESAFMGIIDAL 257

Query: 264 ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVL 323
              + +  LAEP LTA SG+ A F  GG+  + ++   +    V    +GV L  TPTVL
Sbjct: 258 ASKSLVNVLAEPNLTAKSGEKAEFLVGGEFPFPSIDGES--VGVEFKSFGVGLSVTPTVL 315

Query: 324 SPGRIGLRIQTEVS----EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQ 379
           S  RI L +   VS    +  I +N  D+P    R A TT+EL  G +  LAGLL+   +
Sbjct: 316 SENRISLTVTPVVSALSRQNSIKINGVDVPGLDKRTATTTIELADGQSFALAGLLRTSEE 375

Query: 380 QLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA-MRDLSRPDDHYSVED 438
              + IP L ++P +GALFR ++  + E E+ I AT  LV+P   +  +  P DH+    
Sbjct: 376 NSVDAIPFLGELPGVGALFRTNKNQQIERELVIIATASLVQPTGDIESIPTPLDHFRAPT 435

Query: 439 DAKAFFFNRV 448
             +   F  +
Sbjct: 436 RLERLLFGEL 445


>gi|251791991|ref|YP_003006711.1| RcpA [Aggregatibacter aphrophilus NJ8700]
 gi|247533378|gb|ACS96624.1| RcpA [Aggregatibacter aphrophilus NJ8700]
          Length = 460

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 111/395 (28%), Positives = 196/395 (49%), Gaps = 33/395 (8%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM----LNLDI 114
           ++Q    +  + VS P+ AD  +    T  ++ K+ G+A V   G DG+ +    +N+D 
Sbjct: 41  LVQTKEKIDTIFVSSPSVADYEILDDNTFIIYAKDEGKAEVTAFGADGRPLTSDTVNVDS 100

Query: 115 LIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDS---QRAV--------EL 163
           ++  +IA     L+    ++N+ V+ V    V+ G  RT ++S   +R V        ++
Sbjct: 101 VV-TNIADTNKQLKTHFPNTNLSVKKVGKAYVIEGKARTQEESDEVRRIVGEALGTGRKV 159

Query: 164 SETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS-ITGS 222
           +ET L           S + V++  NI    Q+ +K+T+ EV + + + +G   S I GS
Sbjct: 160 TETKLGNESVPFLDKYSYEGVVDHSNINDTTQINVKLTVVEVNKKLSEAMGINWSHIAGS 219

Query: 223 SSGPSKSFAADFGGKFVSEGGDFSVKGVL--DRFSFETVLHALERATAIRTLAEPTLTAI 280
             GP        GG F + GG    +GVL  D       ++AL+  +  + LAEP ++ +
Sbjct: 220 --GPL------LGGNFSAAGGFNGTQGVLRLDAKGISAFINALDNQSNGKILAEPNISML 271

Query: 281 SGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPV 340
           SG++A    GG+  +       G+ S+   ++GV L     +    RI L +   VS   
Sbjct: 272 SGETADILVGGEIPFAQ-RDKEGSPSIIYKEFGVKLAVAAKLQKNNRIRLVLDQSVSTLA 330

Query: 341 IGVN---AGDMPSYRVRKADTTVELPSGGTIVLAGLLK-DDIQQLKEGIPLLSKIPILGA 396
              N    G++P +  R+A +  E+ +G + ++ GL   +D++ + + +PLL  +PILG+
Sbjct: 331 GNYNFEGIGNIPYFDTRRAKSLFEVANGESFIIGGLFSSNDVEGINK-VPLLGDVPILGS 389

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
            FRN+  NRE+ E+ I AT  +VKPV  +++  PD
Sbjct: 390 FFRNASTNREKKELVIVATVNVVKPVEEKNIVYPD 424


>gi|320156053|ref|YP_004188432.1| flp pilus assembly protein, secretin CpaC [Vibrio vulnificus
           MO6-24/O]
 gi|319931365|gb|ADV86229.1| flp pilus assembly protein, secretin CpaC [Vibrio vulnificus
           MO6-24/O]
          Length = 462

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 111/430 (25%), Positives = 203/430 (47%), Gaps = 35/430 (8%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDG 106
            K+I + + +  ++ +  +++ V + D T ADV   S R+  +FG  VG+ +++++G +G
Sbjct: 23  AKQIDLEVGQSRLIPLSQEMRSVYIVDSTIADVKTPSARSALVFGAKVGKTDLVIVGKEG 82

Query: 107 KQMLNLDILIERD-IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
           + + +  + ++   ++ LE  L        I ++ V D++ + G V + + +   + L  
Sbjct: 83  EAIAHYRLNVKNSGLSQLERHLETLYPSHRIALQSVGDSIAVAGTVASPEMAADILSLVN 142

Query: 166 TF----LSQSGRNQYANSSSKK-----------------VMNLLNIAGEDQVTLKVTIAE 204
            F    ++   R +  N+ + +                 V+N L I    QV + + + E
Sbjct: 143 NFAVGQVADKERLKEINADASRKSANPPEGPGGQSVLPLVINQLKITAAPQVNISIRMVE 202

Query: 205 VRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFS-VKGVLDRFSFETVLHAL 263
           + +   +++G    I   S  P+       G +F + G D +    ++   +F  ++ AL
Sbjct: 203 MAKSTSEELG----IRWQSVNPNWMLGVSPGNQFAT-GIDLTDPDNLIKESAFMGIIDAL 257

Query: 264 ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVL 323
              + +  LAEP LTA SG+ A F  GG+  + ++   +    V    +GV L  TPTVL
Sbjct: 258 ASKSLVNVLAEPNLTAKSGEKAEFLVGGEFPFPSIDGES--VGVEFKSFGVGLSVTPTVL 315

Query: 324 SPGRIGLRIQTEVS----EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQ 379
           S  RI L +   VS    +  I +N  D+P    R A TT+EL  G +  LAGLL+   +
Sbjct: 316 SENRISLTVTPVVSALSRQNSIKINGVDVPGLDKRTATTTIELADGQSFALAGLLRTSEE 375

Query: 380 QLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA-MRDLSRPDDHYSVED 438
              + IP L ++P +GALFR ++  + E E+ I AT  LV+P   +  +  P DH+    
Sbjct: 376 NSVDAIPFLGELPGVGALFRTNKNQQIERELVIIATASLVQPTGDIESIPTPLDHFRAPT 435

Query: 439 DAKAFFFNRV 448
             +   F  +
Sbjct: 436 RLERLLFGEL 445


>gi|206559894|ref|YP_002230658.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
 gi|198035935|emb|CAR51827.1| flp type pilus assembly protein [Burkholderia cenocepacia J2315]
          Length = 443

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 136/425 (32%), Positives = 201/425 (47%), Gaps = 56/425 (13%)

Query: 22  SVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADV-V 80
           S   +PP+ +A      IS + IG  ++I+ G            +Q V V DP+ ADV V
Sbjct: 13  SALAMPPLSDAADTSGTIS-LAIGAQRQIATGR----------ALQRVAVGDPSVADVLV 61

Query: 81  VHSPRT-MYLFGKNVGQANVILI--GHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIR 137
           V   R  + L  KN G  NV++   G D   + N+++             R  +  ++  
Sbjct: 62  VKGGRGGVLLVAKNAGATNVMIWERGRDEPTVYNVNVT--------SGAARALLDGTSPS 113

Query: 138 VEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVT 197
           V     T V+ G   T+   QRAV  ++T   + G    A++          I+G++ V 
Sbjct: 114 VNTYGGTTVIGGAAGTLDGHQRAVHAAKTVGGKDGTTLDAST----------ISGKNVVQ 163

Query: 198 LKVTIAEVRRDILKQIG---FQHSITGSSSG---PS--KSFAADFGGKF-------VSEG 242
           + V + E  R +LKQ G   F+ S  G S G   P+   S +   GG         +S  
Sbjct: 164 VDVRVVEFSRSVLKQAGLNFFKQS-NGFSFGAFAPTGLTSISGTPGGSLTYNTSVPISSA 222

Query: 243 GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST 302
            +  V  V  R  F   L  LE     R LA+PTL A+SGQSA+F +GG+ +   V  S 
Sbjct: 223 FNLVVNSV-SRGLFAD-LSILEANNLARVLAQPTLVALSGQSANFLAGGE-IPVPVPQSL 279

Query: 303 GATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADT 358
           G  S+    YGV L  TPTVLSP RI L++  E S+      I +N+  +P+   R+ADT
Sbjct: 280 GTISIEWKPYGVGLTVTPTVLSPRRIALKVAPESSQLDFVHSITINSVQVPALTTRRADT 339

Query: 359 TVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFL 418
           TVEL  G + V+ GL+  +       +P L  +PI+GA F+N  + + + E+ I  TP L
Sbjct: 340 TVELGDGESFVIGGLIDRETTSNVNKVPFLGDLPIIGAFFKNLSYQQNDKELVIIVTPHL 399

Query: 419 VKPVA 423
           V P+A
Sbjct: 400 VAPIA 404


>gi|148975962|ref|ZP_01812751.1| hypothetical Flp pilus assembly protein [Vibrionales bacterium
           SWAT-3]
 gi|145964707|gb|EDK29960.1| hypothetical Flp pilus assembly protein [Vibrionales bacterium
           SWAT-3]
          Length = 456

 Score =  142 bits (357), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 109/407 (26%), Positives = 196/407 (48%), Gaps = 49/407 (12%)

Query: 51  SIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQML 110
           SI LN    +Q    +  V +++P+  D  + +  T+ +F  +VGQ+ +I+ G D   +L
Sbjct: 34  SITLNDGQHIQFKSPIGQVFINNPSIVDYKIINDNTLVVFANSVGQSRLIVYGVDDDVLL 93

Query: 111 NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQ 170
           +  I+++ ++  +   L+    D+ ++V+ V + V + G+V +         L  T L +
Sbjct: 94  SDRIIVDLNLTDIRRQLKFHFPDAKVKVQSVGEQVAVSGVVDSEATRDDIYRLVATLLGR 153

Query: 171 SGRNQY------------------------ANSSSKKVMNLLNIAGEDQVTLKVTIAEVR 206
               ++                         N + + ++  + +A   QV +K+++A+V 
Sbjct: 154 DKTEKWDKTQKLEFKSDSSDYEEPESMVFARNMTWEGIIERIEVATTQQVNVKISVAQVT 213

Query: 207 RDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERA 266
               + +G   S  GSS G           +FV +          D  +  T++ AL   
Sbjct: 214 ESFGQTVGVDWSTVGSSVG-----------EFVFDQ--------FDAANLSTLITALGND 254

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
                LAEP LT +SG+SASF  GG+     + S++   +++  ++G+ L  T  VLS  
Sbjct: 255 QIAEVLAEPNLTVLSGESASFLVGGE--VPVIVSTSSNVNISFKEFGIKLDLTAKVLSQD 312

Query: 327 RIGLRIQTEVSEPVIGVNAG--DMPSYRVRKADTTVELPSGGTIVLAGLLKD-DIQQLKE 383
           +I +++  EVSE    V A    +P    R+A TTVEL  G + VL GL+   D++++++
Sbjct: 313 KIRMQLAPEVSEVEGYVEAAGIKVPQLASRRAMTTVELADGDSFVLGGLMSSADLEKMQK 372

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
            IP +  IP+LGA FR +   R+ TE+ I AT  LV+P+  +D+  P
Sbjct: 373 -IPFVGDIPVLGAAFRKATTERKRTELIIVATVNLVEPMKPKDIQLP 418


>gi|119566857|gb|ABL84265.1| RcpA [Yersinia ruckeri]
          Length = 438

 Score =  141 bits (356), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 113/377 (29%), Positives = 188/377 (49%), Gaps = 33/377 (8%)

Query: 65  DVQDVLVSDPTK-ADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHL 123
           D  D + S  TK AD  +    ++ ++ K  G A   L     K +  + + +++ I+  
Sbjct: 49  DEIDTIFSSATKVADYELIGTNSIIIYAKEEGLAEFNLFDKKNKPIHKVAVFVDKIISKA 108

Query: 124 EMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVE--LSETFLSQSGRNQ---YAN 178
           +  +R    DS I +  + +  +L G  +T ++++  +E  ++    S   R +   Y  
Sbjct: 109 KKRIRIEYPDSQININKLGEGYILTGTAQT-EEARETIEKIVANAIGSVPVRQEKWGYTI 167

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKF 238
            S   + N + I   +QV +K+TIAEV +D    IG   S  G+ SG S  F     GK 
Sbjct: 168 HSHSNITNKITIPVTNQVNVKLTIAEVTKDFTDNIGLDWSTIGNVSG-SFHFTQFNAGKI 226

Query: 239 VSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV 298
                              T++ A+   +  R LAEP L+ +SG++ASF  GG+     V
Sbjct: 227 ------------------STLVQAINDESVARVLAEPNLSVLSGETASFLVGGE--LPIV 266

Query: 299 SSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGVNAGD-MPSYRVRK 355
           S++    +V+  ++G+ L+    V    RI +++  EVS  + +  V+ G   P+ R RK
Sbjct: 267 STTQNTINVSYKEFGIKLNIGAKVSESKRIRVKLDEEVSSLDKMFNVDGGSSYPALRTRK 326

Query: 356 ADTTVELPSGGTIVLAGLL-KDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAA 414
           A TTVEL  G + +L GL+ ++D + LK+ IPL+  IPILGALFR +    + +E+ + A
Sbjct: 327 AGTTVELGDGESFILGGLISREDKENLKK-IPLIGDIPILGALFRKTGTQTKRSELVVIA 385

Query: 415 TPFLVKPVAMRDLSRPD 431
           T  LVKP+  +D+  PD
Sbjct: 386 TVNLVKPMQSKDVGLPD 402


>gi|238755450|ref|ZP_04616790.1| Type II/III secretion system protein [Yersinia ruckeri ATCC 29473]
 gi|238706291|gb|EEP98668.1| Type II/III secretion system protein [Yersinia ruckeri ATCC 29473]
          Length = 430

 Score =  141 bits (356), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 113/377 (29%), Positives = 188/377 (49%), Gaps = 33/377 (8%)

Query: 65  DVQDVLVSDPTK-ADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHL 123
           D  D + S  TK AD  +    ++ ++ K  G A   L     K +  + + +++ I+  
Sbjct: 41  DEIDTIFSSATKVADYELIGTNSIIIYAKEEGLAEFNLFDKKNKPIHKVAVFVDKIISKA 100

Query: 124 EMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVE--LSETFLSQSGRNQ---YAN 178
           +  +R    DS I +  + +  +L G  +T ++++  +E  ++    S   R +   Y  
Sbjct: 101 KKRIRIEYPDSQININKLGEGYILTGTAQT-EEARETIEKIVANAIGSVPVRQEKWGYTI 159

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKF 238
            S   + N + I   +QV +K+TIAEV +D    IG   S  G+ SG S  F     GK 
Sbjct: 160 HSHSNITNKITIPVTNQVNVKLTIAEVTKDFTDNIGLDWSTIGNVSG-SFHFTQFNAGKI 218

Query: 239 VSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV 298
                              T++ A+   +  R LAEP L+ +SG++ASF  GG+     V
Sbjct: 219 ------------------STLVQAINDESVARVLAEPNLSVLSGETASFLVGGE--LPIV 258

Query: 299 SSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGVNAGD-MPSYRVRK 355
           S++    +V+  ++G+ L+    V    RI +++  EVS  + +  V+ G   P+ R RK
Sbjct: 259 STTQNTINVSYKEFGIKLNIGAKVSESKRIRVKLDEEVSSLDKMFNVDGGSSYPALRTRK 318

Query: 356 ADTTVELPSGGTIVLAGLL-KDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAA 414
           A TTVEL  G + +L GL+ ++D + LK+ IPL+  IPILGALFR +    + +E+ + A
Sbjct: 319 AGTTVELGDGESFILGGLISREDKENLKK-IPLIGDIPILGALFRKTGTQTKRSELVVIA 377

Query: 415 TPFLVKPVAMRDLSRPD 431
           T  LVKP+  +D+  PD
Sbjct: 378 TVNLVKPMQSKDVGLPD 394


>gi|107022594|ref|YP_620921.1| type II and III secretion system protein [Burkholderia cenocepacia
           AU 1054]
 gi|116689543|ref|YP_835166.1| type II and III secretion system protein [Burkholderia cenocepacia
           HI2424]
 gi|170732847|ref|YP_001764794.1| type II and III secretion system protein [Burkholderia cenocepacia
           MC0-3]
 gi|105892783|gb|ABF75948.1| type II and III secretion system protein [Burkholderia cenocepacia
           AU 1054]
 gi|116647632|gb|ABK08273.1| type II and III secretion system protein [Burkholderia cenocepacia
           HI2424]
 gi|169816089|gb|ACA90672.1| type II and III secretion system protein [Burkholderia cenocepacia
           MC0-3]
          Length = 443

 Score =  141 bits (356), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 133/428 (31%), Positives = 198/428 (46%), Gaps = 62/428 (14%)

Query: 22  SVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADV-V 80
           S   +PP+ +A      IS + IG  ++I+ G            +Q V V DP+ ADV V
Sbjct: 13  SALAMPPLSDAADTSGTIS-LAIGAQRQIATGR----------ALQRVAVGDPSVADVLV 61

Query: 81  VHSPRT-MYLFGKNVGQANVILI--GHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIR 137
           V   R  + L  KN G  NV++   G D   + N+++             R  +  ++  
Sbjct: 62  VKGGRGGVLLVAKNAGATNVMIWERGRDEPTVYNVNVT--------SGAARALLDGTSPS 113

Query: 138 VEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVT 197
           V     T V+ G   T+   QRAV  ++T   + G    A++          I+G++ V 
Sbjct: 114 VNTYGGTTVIGGAAGTLDGHQRAVHAAKTVGGKDGTTLDAST----------ISGKNVVQ 163

Query: 198 LKVTIAEVRRDILKQIGFQH------------------SITGSSSGPSKSFAADFGGKFV 239
           + V + E  R +LKQ G                     SITG+  G S ++        +
Sbjct: 164 VDVRVVEFSRSVLKQAGLNFFKQSNGFAFGAFAPTGLTSITGTPGG-SLTYNTSV---PI 219

Query: 240 SEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVS 299
           S   +  V  V  R  F   L  LE     R LA+PTL A+SGQSA+F +GG+ +   V 
Sbjct: 220 SSAFNLVVNSV-SRGLFAD-LSILEANNLARVLAQPTLVALSGQSANFLAGGE-IPVPVP 276

Query: 300 SSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRK 355
            S G  S+    YGV L  TPTVLSP RI L++  E S+      I +N+  +P+   R+
Sbjct: 277 QSLGTISIEWKPYGVGLTVTPTVLSPRRIALKVAPESSQLDFVHSITINSVQVPALTTRR 336

Query: 356 ADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAAT 415
           ADTTVEL  G + V+ GL+  +       +P L  +PI+GA F+N  + + + E+ I  T
Sbjct: 337 ADTTVELGDGESFVIGGLIDRETTSNVNKVPFLGDLPIIGAFFKNLSYQQNDKELVIIVT 396

Query: 416 PFLVKPVA 423
           P LV P+A
Sbjct: 397 PHLVAPIA 404


>gi|27378611|ref|NP_770140.1| hypothetical protein blr3500 [Bradyrhizobium japonicum USDA 110]
 gi|27351759|dbj|BAC48765.1| blr3500 [Bradyrhizobium japonicum USDA 110]
          Length = 550

 Score =  141 bits (355), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 137/512 (26%), Positives = 216/512 (42%), Gaps = 83/512 (16%)

Query: 2   RYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAA----------VINISDVEIGKGKKIS 51
           R   +T   +++  +     +VA   P   A AA          V  ++DV+     ++ 
Sbjct: 5   RVSGKTVARLLAFGVMGLGAAVALCGPADRAEAADRRGSSGGVFVSEMNDVQ-----RVR 59

Query: 52  IGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLN 111
           + +NK    +V      ++   P   DV   S   +Y+ GK  G  NVIL     KQ+  
Sbjct: 60  VVVNKSRTFKVDTAFATIIAGSPDIVDVKSLSDHMIYVQGKQTGTTNVILFDSAMKQIGV 119

Query: 112 LDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS 171
           LD+ +  D  +L+  +R       +RV      VVL G       ++RA+ ++ + +++ 
Sbjct: 120 LDVEVVIDTGNLQQNIRTGTGMQGVRVSASEGQVVLSGTAVDAVAAERAMAIATSTVAKG 179

Query: 172 GRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS------SG 225
           G           V+N +++A   QV L+V   EV R+  + +G   S   ++      SG
Sbjct: 180 G----------TVVNAMSVAAPQQVMLEVRFLEVSREAGRNLGVNLSAANANGTNIGNSG 229

Query: 226 PSKSFAAD---FGGKFVSEG--------------GDFSVKGVLDRF-------------- 254
             +  AA     GG   + G              G   V G L                 
Sbjct: 230 LGRVTAAGRTPIGGINTANGPLGAGGGPVGSAPTGSLPVLGTLGTLAGTAGGIAPAPFGT 289

Query: 255 ------------SFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST 302
                       S + ++ ALE     R LAEP LT +SG +A F +GG+      + +T
Sbjct: 290 LLTSLIRTSNGGSVDMLISALETKGLARRLAEPNLTTLSGDAARFLAGGEFPVPIPTQTT 349

Query: 303 GATSVTTHDY---GVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRK 355
                 T +Y   GV L F PTVLS G I LR++  VSE      + +    +P+   R 
Sbjct: 350 NGFPTITIEYKKFGVELAFVPTVLSRGVINLRVEPSVSELDFANAVTIQGTTVPALTRRD 409

Query: 356 ADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAAT 415
           A TTVEL  G +  +AGLL+   +Q    +P +  +P++G LF +  + +EET++ I  T
Sbjct: 410 ARTTVELRDGQSFAIAGLLQTRNRQDVSQLPWIGSVPVIGTLFSSKSYQQEETDLVIIVT 469

Query: 416 PFLVKPVAM-RDLSRPDDHYSVEDDAKAFFFN 446
           P LV P A  + L+ P D     +D   FF N
Sbjct: 470 PRLVAPAAPGQQLASPLDSRLPANDVD-FFLN 500


>gi|238897548|ref|YP_002923227.1| putative tight adherance operon protein [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
 gi|229465305|gb|ACQ67079.1| putative tight adherance operon protein [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 459

 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 115/460 (25%), Positives = 215/460 (46%), Gaps = 73/460 (15%)

Query: 3   YLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQV 62
           + QR    +  IF F + P          ANAA  N  D+ + +G+ +        +++ 
Sbjct: 6   FYQRCIKLIFFIFGFFTLPG--------SANAA--NTGDLFMSEGESL--------VIKK 47

Query: 63  PVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAH 122
             ++  V VS+P  AD  +    T+ ++ K  G++       +     +  ++++  I  
Sbjct: 48  KQNIDTVFVSNPAVADYKIVDHNTVIIYAKAEGKSEFTFFEPNQNISYHATVMVDNIIKV 107

Query: 123 LEMTLRRFIADSNIRVEMVSDTVVLHGM----------VRTIQDSQRA----------VE 162
           +   +R    +S +++E +  + +L GM          VR + +S ++          V 
Sbjct: 108 VSDKIRMLYPESQVQIEKIGKSYLLTGMAPTEEVRDNIVRMVGESIQSPKSNDKDTVSVR 167

Query: 163 L--------SETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
           L        SET  +++  +   N   ++++N + +   +QV +K++I EV ++    IG
Sbjct: 168 LDISDKGDASET--TENVNSSLTNKVYERLINQIQLPVSNQVNVKLSIVEVSKEFKDNIG 225

Query: 215 FQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAE 274
           F+ +  G+ S    +F AD                         +++AL+  +  R LAE
Sbjct: 226 FEWANLGTFSFHKFNFTAD---------------------RITHLVNALQDDSIARVLAE 264

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           P L+ +SG+SASF  GG+  Y     ++   S+   ++G+ L  T  V    R+ + +  
Sbjct: 265 PNLSVLSGESASFLVGGEIPYVKDRDASNRASIDFKEFGIKLSVTAKVNENKRVKVMLSE 324

Query: 335 EVSEPVIGVNAGD---MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKI 391
           E+S  VIG    +   MPS + R+A+TTVEL  G + VL GL+  + Q+  + +P +  I
Sbjct: 325 EISS-VIGNTKAEEFTMPSLKKRRANTTVELADGESFVLGGLMNQEEQEALQKVPFIGDI 383

Query: 392 PILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           PILG+ FR+++ N    E+ + AT  LVKP+  ++++ PD
Sbjct: 384 PILGSFFRHTKTNNRSIELIVVATVNLVKPIPSKEITLPD 423


>gi|84385684|ref|ZP_00988715.1| hypothetical Flp pilus assembly protein [Vibrio splendidus 12B01]
 gi|84379664|gb|EAP96516.1| hypothetical Flp pilus assembly protein [Vibrio splendidus 12B01]
          Length = 456

 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 107/407 (26%), Positives = 195/407 (47%), Gaps = 49/407 (12%)

Query: 51  SIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQML 110
           SI LN    +Q+   +  V +++P   D  + +  T+ +F   +GQ+ +I+ G DG  +L
Sbjct: 34  SITLNDGQHIQLKSPIGQVFINNPDIVDYKIINDNTIVVFANAIGQSRLIVYGIDGDVLL 93

Query: 111 NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQ 170
           +  I+++ D+  +   L+    ++ ++++ V + V + G+V +         L  T L +
Sbjct: 94  SDRIIVDLDLTDIRRQLKFHFPNAKVKIQSVGEQVAVSGLVDSEATRDDIYRLVATLLGR 153

Query: 171 SGRNQY------------------------ANSSSKKVMNLLNIAGEDQVTLKVTIAEVR 206
               ++                         N + + ++  + +A   QV +K+++A+V 
Sbjct: 154 EKTEKWDKTVKLEFKSDSSNYEEPESFVFARNMTWEGIIERIEVATTQQVNVKISVAQVT 213

Query: 207 RDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERA 266
               + +G   S  GSS G           +FV +          D  +  T++ AL   
Sbjct: 214 ESFGQTVGVDWSSVGSSVG-----------EFVFDQ--------FDAANLSTLITALGND 254

Query: 267 TAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPG 326
                LAEP LT +SG+SASF  GG+     + +++   +++  ++G+ L  T  VLS  
Sbjct: 255 QIAEVLAEPNLTVLSGESASFLVGGE--VPVIVTTSNNVNISFKEFGIKLDLTAKVLSQD 312

Query: 327 RIGLRIQTEVSE--PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD-DIQQLKE 383
           RI +++  EVSE    I      +P    R+A TTVEL  G + VL GL+   D++++++
Sbjct: 313 RIRMQLAPEVSEVEGYIETAGIKVPQLASRRAMTTVELADGDSFVLGGLMSSADLEKMQK 372

Query: 384 GIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
            IP +  IP+LGA FR +   R+ TE+ I AT  LV+P+  +D+  P
Sbjct: 373 -IPFVGDIPVLGAAFRKATTERKRTELIIVATVNLVEPMKPKDIQLP 418


>gi|294012239|ref|YP_003545699.1| Flp pilus assembly protein secretin CpaC [Sphingobium japonicum
           UT26S]
 gi|292675569|dbj|BAI97087.1| Flp pilus assembly protein secretin CpaC [Sphingobium japonicum
           UT26S]
          Length = 543

 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 120/213 (56%), Gaps = 10/213 (4%)

Query: 251 LDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV----SSSTGATS 306
           L      + L ALER   ++TLAEPTL A+SG++ASF +GG+           + +G+ S
Sbjct: 293 LGGLRISSALDALERKGLVKTLAEPTLVALSGETASFLAGGEFPIPVAQNGNGTGSGSNS 352

Query: 307 VTTH--DYGVVLHFTPTVLSPGRIGLRIQTEVS--EPV--IGVNAGDMPSYRVRKADTTV 360
           +T     +GV L FTPTVLS G I L ++ EVS  +P   + +N   +P    R+A T V
Sbjct: 353 ITVEFKPFGVSLGFTPTVLSDGIINLVVEPEVSSIDPSASVQINGLVIPGLLTRRAKTVV 412

Query: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           EL  G +  +AGLL++D Q     IP+L  +PI+GALFR+S F ++ETE+ +  TP LVK
Sbjct: 413 ELRDGQSFAIAGLLRNDFQDTIRQIPVLGSLPIIGALFRSSGFQKQETELVMIVTPRLVK 472

Query: 421 PVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYG 453
           P+   D+  P D      +   F   R +K  G
Sbjct: 473 PMRADDVRLPTDRVGNPHELDLFLMGRTDKAVG 505



 Score = 79.3 bits (194), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 107/227 (47%), Gaps = 28/227 (12%)

Query: 26  LPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPR 85
           LP   +A  A +N+S+       ++ + LNK  +L V       LV +   ADV+  + R
Sbjct: 15  LPMQAQAQVASLNVSNAN--HAGQLDVPLNKSQVLTVDRPFAKALVGNAEIADVLPMTNR 72

Query: 86  TMYLFGKNVGQANVILIGHDGKQML--NLDILIERDIAHLEMTLRRFIADSNIRVEMVSD 143
           ++Y+ GK +G  ++ L  +D + M+   +D+ +  D+  L+  L   I    I   + +D
Sbjct: 73  SVYVLGKKMGTTSLTL--YDSRNMMIAVVDVAVGPDVVTLKRQLSELIPGEQIGARISND 130

Query: 144 TVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIA 203
            ++L G V +     +AV ++ T+             S+K++N+L++    QV L+V  +
Sbjct: 131 ALILTGTVSSAAAVDQAVRIASTYA----------GGSEKIVNMLSVGASQQVMLEVRFS 180

Query: 204 EVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGV 250
           EV R   K++G  H+   +S            GKFV   G+  + GV
Sbjct: 181 EVNRQAAKELGLNHTFLNNS------------GKFVGGMGENGLAGV 215


>gi|296158794|ref|ZP_06841623.1| type II and III secretion system protein [Burkholderia sp. Ch1-1]
 gi|295890999|gb|EFG70788.1| type II and III secretion system protein [Burkholderia sp. Ch1-1]
          Length = 474

 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 114/378 (30%), Positives = 177/378 (46%), Gaps = 38/378 (10%)

Query: 66  VQDVLVSDPTKADVVV---HSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAH 122
           +Q V + DP+ ADV++        + L GK  G  N++L   D    L   + +    A 
Sbjct: 76  LQRVAIGDPSVADVLIIKGDKRGGVLLVGKAAGTTNLMLWARDRDAPLQYTVDVTTPAAA 135

Query: 123 LEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK 182
                   +      V+++  T V+ G   T++  QRAV  +E  L + G          
Sbjct: 136 ------SLLGPDTPAVKVLGGTAVVSGTSATMEAHQRAVVAAEGSLGKDG---------- 179

Query: 183 KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ-----HSITGSSSGPSK-SFAADFGG 236
            V +   +A    V + V + E  R +LK++GF      +  T  S  PS  S  +   G
Sbjct: 180 AVFDTSTVASRAVVQVDVRVVEFSRSVLKEVGFNFFKQNNGFTFGSFAPSALSSVSATAG 239

Query: 237 KFVSEGGDFSVKGVLDRFSFETVLHAL-------ERATAIRTLAEPTLTAISGQSASFTS 289
           +  S  G   +    +   F +  H L       E     R LAEPTL A+SGQSASF +
Sbjct: 240 QAPSMTGVTPISSAFNLI-FNSATHGLFANLSLLESNNLARVLAEPTLVALSGQSASFLA 298

Query: 290 GGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNA 345
           GG+ +   V  + G+TS+    YG+ L  TPTVLSP RI L++  E S+      + ++ 
Sbjct: 299 GGE-VPIPVPQALGSTSIEFKPYGIGLTLTPTVLSPQRIALKVAPEASQLDFANAVTISG 357

Query: 346 GDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNR 405
             +P++  R+ADTTVEL  G + V+ GL+  +       +PLL  +P++G  F+   + +
Sbjct: 358 VSVPAFITRRADTTVELGDGESFVIGGLIDRETASNVSKVPLLGDLPVIGTFFKQLNYQQ 417

Query: 406 EETEIFIAATPFLVKPVA 423
            E E+ I  TP LV P+A
Sbjct: 418 NEKELVIIVTPHLVSPLA 435


>gi|37676253|ref|NP_936649.1| rough colony protein RcpA [Vibrio vulnificus YJ016]
 gi|326424174|ref|NP_762071.2| type II/IV secretion system secretin RcpA/CpaC [Vibrio vulnificus
           CMCP6]
 gi|37200794|dbj|BAC96619.1| rough colony protein RcpA [Vibrio vulnificus YJ016]
 gi|319999557|gb|AAO07061.2| Type II/IV secretion system secretin RcpA/CpaC, associated with Flp
           pilus assembly [Vibrio vulnificus CMCP6]
          Length = 441

 Score =  140 bits (354), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 115/386 (29%), Positives = 189/386 (48%), Gaps = 41/386 (10%)

Query: 66  VQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEM 125
           +  V V  P  AD  +     + ++G  +G  +VI+    G ++ N ++++ + +  ++ 
Sbjct: 42  ISTVFVGAPEIADYKIIDETKVVVYGVGLGATSVIVYDRAGNELYNAEVVVNKSLRLVKQ 101

Query: 126 TLRRFIADSNIRVEMVSDTVVLHGMV----------RTIQD------SQRAVELSETFLS 169
           TL     D +I +  V + VVL G+V          RT+ +      ++  + L +T   
Sbjct: 102 TLIARFPDESINITNVGEQVVLDGVVSSEEVKTQIYRTVGEMLKKSVTRNTLTLQDTSGG 161

Query: 170 QSGRNQY-ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK 228
           Q     Y A      ++N L +   +Q+ +K+T+AEV    L ++G  +S +G +     
Sbjct: 162 QVDSLDYTATYIYDNIINNLKVLTTEQINVKLTVAEVSSSFLSELGVSYSDSGQA----- 216

Query: 229 SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
                  G+FV++  DF+ + ++       V+ A       R LAEP L+ ISG++ASF 
Sbjct: 217 -------GRFVNKLLDFTAQDIV------AVITASGDDQIGRVLAEPNLSVISGETASFL 263

Query: 289 SGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS----EPVIGVN 344
            GG+ L   +   +G  SV+  +YGV L     V     I L +  EVS    E      
Sbjct: 264 VGGE-LPIAIRDESG-ISVSYKEYGVKLSMVAKVTDSENIRLSLLPEVSSIDEENKTANG 321

Query: 345 AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFN 404
             ++P+ R RKA TTV+L  G + VLAGLL  + ++    IP+L  IPILGALF +++ N
Sbjct: 322 LINVPALRTRKAQTTVQLKDGQSFVLAGLLTSEERESLSKIPVLGDIPILGALFSHTKSN 381

Query: 405 REETEIFIAATPFLVKPVAMRDLSRP 430
           + +TE+ I AT  LV PV   D+  P
Sbjct: 382 QTKTELIIVATVNLVDPVKAEDIKLP 407


>gi|134295595|ref|YP_001119330.1| type II and III secretion system protein [Burkholderia
           vietnamiensis G4]
 gi|134138752|gb|ABO54495.1| type II and III secretion system protein [Burkholderia
           vietnamiensis G4]
          Length = 443

 Score =  140 bits (353), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 117/385 (30%), Positives = 179/385 (46%), Gaps = 50/385 (12%)

Query: 66  VQDVLVSDPTKADVVVHS---PRTMYLFGKNVGQANVILI--GHDGKQMLNLDILIERDI 120
           +Q V V DP  ADV++       ++ L  K  G  NV++   GHD   + N++++     
Sbjct: 43  LQRVAVGDPAIADVLIMKGSRAGSVLLTAKAPGTTNVMVWERGHDEPTVWNVEVVDAAAQ 102

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
           A L+         S  +V+    T VL G   ++   +RAV +++             S 
Sbjct: 103 AVLDA--------STPQVKAYGGTSVLRGTAGSLDAHERAVAVAKNM-----------SP 143

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH-------SITGSSSGPSKSFAAD 233
              V++   +AG++ V + V + E  R +LKQ+GF         S    S G  +S+   
Sbjct: 144 KGAVIDRSTLAGKNVVQVDVRVVEFSRSVLKQVGFNFFKQSNGFSFGSFSPGGVQSYN-- 201

Query: 234 FGGKFVSEGGDFSVKGVLDRFSFETVLHA-----------LERATAIRTLAEPTLTAISG 282
            GG            G     +F  V++A           LE     R LAEPTL A+SG
Sbjct: 202 -GGSGPGTAAYIPTLGAPVASAFNLVVNAAGHGIFADLSLLEANNLARVLAEPTLVALSG 260

Query: 283 QSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE---- 338
           QSASF +GG+    +     G+T++    YGV L  TPTVLSP RI L++  E S+    
Sbjct: 261 QSASFLAGGEIPVPS-PQGLGSTAIQWKQYGVGLSLTPTVLSPNRIALKVAPESSQLDFV 319

Query: 339 PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALF 398
             + ++   +P    R+ADTTVEL  G + V+ GL+          +PLL  +PI+G  F
Sbjct: 320 NSVTISGVAVPGITTRRADTTVELGDGESFVIGGLIDRQTMSNVSKVPLLGDLPIIGTFF 379

Query: 399 RNSRFNREETEIFIAATPFLVKPVA 423
           +N  + + + E+ I  TP LV P+A
Sbjct: 380 KNLNYQQNDKELLIIVTPHLVAPIA 404


>gi|327541686|gb|EGF28210.1| bacterial type II/III secretion system protein [Rhodopirellula
           baltica WH47]
          Length = 454

 Score =  140 bits (352), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 99/332 (29%), Positives = 160/332 (48%), Gaps = 33/332 (9%)

Query: 134 SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGE 193
           +++RV  + ++ ++ G V ++ D  +AV ++E F +              V+N + + G 
Sbjct: 8   ASLRVTPIGESAIISGYVTSVDDVDKAVAITEQFYT-------------TVINNIQVVGI 54

Query: 194 DQVTLKVTIAEVRRDILKQIGFQHSITGSS----SGPSKSFAADFGGKFVSEGGDFSVKG 249
            QV L   I EV R  L+++G   +I   +    +GPS     D G   V     F    
Sbjct: 55  QQVLLHTKIMEVSRTKLRELGVDLAILDDNFTLLNGPSGVL--DVGAGIVEGDAGFGPIP 112

Query: 250 VLD---RFS----FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST 302
           + D   RF+    FET+++AL      + LAEPT+ A  G+ A FT GG+ +   V    
Sbjct: 113 LGDTNLRFNVNGNFETLINALHEQRLTKLLAEPTVVATHGRPARFTVGGR-IPTIVPGQN 171

Query: 303 GATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP----VIGVNAGDMPSYRVRKADT 358
           G   +T  DYG  + F P V+ PGRI L ++ EVSEP     + VN  ++ ++  R  +T
Sbjct: 172 GQVQITYEDYGTSIDFLPFVVGPGRIRLEVRPEVSEPDPSRAVTVNGTNVTAFTTRYVET 231

Query: 359 TVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFL 418
            VE+ +G T  LAGLL+   +      P    +P +G LFR  +  R E E+ I  TP L
Sbjct: 232 AVEMQAGQTFALAGLLQSRTESTTSRTPFFGSLPYVGTLFRKMQERRNEIELLILVTPEL 291

Query: 419 VKPVAMRDLSR--PDDHYSVEDDAKAFFFNRV 448
           V+ +   ++ R  P  +    DD + + +  +
Sbjct: 292 VEAMDPHEVPRGGPGMNSHSPDDKEFYLYGHI 323


>gi|283779855|ref|YP_003370610.1| type II and III secretion system protein [Pirellula staleyi DSM
           6068]
 gi|283438308|gb|ADB16750.1| type II and III secretion system protein [Pirellula staleyi DSM
           6068]
          Length = 585

 Score =  140 bits (352), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 106/382 (27%), Positives = 179/382 (46%), Gaps = 30/382 (7%)

Query: 45  GKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGH 104
           G  +K+ + +N   +++ P DV  +LV++P    +   SP ++ L     G   + +   
Sbjct: 56  GPAEKLEMTVNTSRVVEFPFDVPKMLVNNPDLVRITPISPNSIQLSAVKGGVTQLNVWNA 115

Query: 105 DGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELS 164
           D  Q+  LD+++  D+  LEM L+    D+ IR+  ++ ++ + G V   +       ++
Sbjct: 116 D-DQVTTLDLIVIPDVQELEMILKHEFPDAAIRLRPLASSLYISGFVPKAEMVASITRVA 174

Query: 165 ETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS------ 218
           E +               K++N + + G  +V L V + EV R  L+ +GF  +      
Sbjct: 175 EDYF-------------PKIINNMTVGGVQKVLLHVKVMEVSRTKLRTMGFDWAQLNGDD 221

Query: 219 -ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVL-DRFSFETVLHALERATAIRTLAEPT 276
            +T S SG  ++      G      G     G+L D   F   L AL +    + LAEPT
Sbjct: 222 FVTQSVSGLLQT-----PGTLTGNTGATVRFGILTDNNQFYGFLEALRQNDLAKLLAEPT 276

Query: 277 LTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
           L  +SG+ A F  GG+ +   +  S G T+V    +G  + F P VL  G I L ++ EV
Sbjct: 277 LVTMSGRPAYFNVGGE-VPIPMQQSLGVTTVQYKQFGTRIDFVPIVLGNGSIRLEVRPEV 335

Query: 337 SE--PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPIL 394
           +E  P +      +P +R R ADT VE+ +G T+ +AGL+ + ++    G+P L+ +P  
Sbjct: 336 TEIDPSLRDAVTGVPGFRQRGADTAVEIKAGQTMAIAGLVYNRVEASNRGVPFLADLPWA 395

Query: 395 GALFRNSRFNREETEIFIAATP 416
           G  FR       E E+ I  TP
Sbjct: 396 GGAFRRVSEKVNEVELVIMVTP 417


>gi|172060495|ref|YP_001808147.1| type II and III secretion system protein [Burkholderia ambifaria
           MC40-6]
 gi|171993012|gb|ACB63931.1| type II and III secretion system protein [Burkholderia ambifaria
           MC40-6]
          Length = 461

 Score =  140 bits (352), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 117/385 (30%), Positives = 179/385 (46%), Gaps = 50/385 (12%)

Query: 66  VQDVLVSDPTKADVVVHSPR---TMYLFGKNVGQANVILI--GHDGKQMLNLDILIERDI 120
           +Q V V DPT ADV++       ++ L  K  G  NV+L   GHD   + +++++     
Sbjct: 61  LQRVAVGDPTIADVLIMKGSRSGSVLLTAKAPGATNVMLWERGHDEPTVWSIEVVDAAAH 120

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
           A L+ ++ +        V+    T VL G   T+   +RA  +++             S 
Sbjct: 121 AVLDGSMPQ--------VKAYGGTSVLRGTSATLDAHERAATVAKNM-----------SP 161

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH-------SITGSSSGPSKSFAAD 233
              V++   +AG+  V + V + E  R +LKQ+GF         S    S G  +S+   
Sbjct: 162 KGTVIDRSTLAGKSVVQVDVRVVEFSRSVLKQVGFNFFKQSNGFSFGSFSPGGVQSYN-- 219

Query: 234 FGGKFVSEGGDFSVKGVLDRFSFETVLHA-----------LERATAIRTLAEPTLTAISG 282
            GG      G     G     +F  V++A           LE     R LAEPTL A+SG
Sbjct: 220 -GGSGPGTAGYIPALGAPVASAFNLVVNAAGRGIFADLSLLEANNMARVLAEPTLVALSG 278

Query: 283 QSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE---- 338
           QSASF +GG+    +     G+T++    YGV L  TPTVL P RI L++  E S+    
Sbjct: 279 QSASFLAGGEIPVPS-PQGLGSTAIQWKQYGVGLSLTPTVLGPNRIALKVAPESSQLDFV 337

Query: 339 PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALF 398
             + ++   +P    R+ADTTVEL  G + V+ GL+          +PLL  +PI+G  F
Sbjct: 338 NSVTISGVAVPGITTRRADTTVELGDGESFVIGGLIDRQTMSNVSKVPLLGDLPIIGTFF 397

Query: 399 RNSRFNREETEIFIAATPFLVKPVA 423
           +N  + + + E+ I  TP LV P+A
Sbjct: 398 KNLNYQQNDKELLIIVTPHLVAPIA 422


>gi|170724970|ref|YP_001758996.1| type II and III secretion system protein [Shewanella woodyi ATCC
           51908]
 gi|169810317|gb|ACA84901.1| type II and III secretion system protein [Shewanella woodyi ATCC
           51908]
          Length = 446

 Score =  139 bits (351), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 105/402 (26%), Positives = 194/402 (48%), Gaps = 44/402 (10%)

Query: 52  IGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLN 111
           + LN    +++  ++  V +S P  AD  +     + ++G+ +GQA + +     + +L+
Sbjct: 29  VTLNDASSIELKQEIGTVFISQPEVADYKITGNNKLVIYGRQLGQARLFVYNKANEVILS 88

Query: 112 LDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ---------------- 155
             + ++ +++ +   L+ F  D ++ +  V D V + G+V + +                
Sbjct: 89  QLLHVDINLSQIRRQLKLFYPDLDLTLTSVGDKVAVRGIVYSEEQRNDIYRQVATFLGRE 148

Query: 156 -----DSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDIL 210
                D    VE  ++F   +      N   + ++  L ++   QV +K+++A+V ++  
Sbjct: 149 KVERFDESELVEFKDSFTEANWLAYERNFIWQGIIEGLRLSQTQQVNVKISVAQVTKEFN 208

Query: 211 KQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIR 270
           + +G   S  G S G   SF  DF      +  D S           T+++AL + +   
Sbjct: 209 ETLGVSWSTVGRSVGEF-SFL-DF------KASDLS-----------TIINALGKDSIAE 249

Query: 271 TLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGL 330
            LAEP L+ +SG+SASF  GG+     + S+   T++T  ++G+ L  +  VL+  +I L
Sbjct: 250 VLAEPNLSVMSGESASFLVGGE--IPVIFSNNNTTNITYKEFGIRLDLSAKVLNNEKIKL 307

Query: 331 RIQTEVS--EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
           ++  EVS  E  +      +P    R+A TT+EL  G + +L GL+  D  +    IPLL
Sbjct: 308 QMMPEVSAVEGFVEAAGIKIPQLTTRRAMTTIELGDGDSFLLGGLMSSDELENVSKIPLL 367

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
             IP+ GALFR +   R++TE+ I AT  LVKP++  ++  P
Sbjct: 368 GDIPVFGALFRQAGTTRKKTELVIVATVNLVKPLSPTEVRLP 409


>gi|91783011|ref|YP_558217.1| putative outer membrane channel signal peptide protein, CpaC like
           [Burkholderia xenovorans LB400]
 gi|91686965|gb|ABE30165.1| Putative outer membrane channel signal peptide protein, CpaC like
           protein [Burkholderia xenovorans LB400]
          Length = 454

 Score =  139 bits (351), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 113/378 (29%), Positives = 176/378 (46%), Gaps = 38/378 (10%)

Query: 66  VQDVLVSDPTKADVVV---HSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAH 122
           +Q + + DP+ ADV++        + L GK  G  N++L   D    L   + +    A 
Sbjct: 56  LQRIAIGDPSVADVLIIKGDKRGGVLLVGKAAGTTNLMLWARDRDAPLQYTVDVTTPAAA 115

Query: 123 LEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK 182
                   +      V+++  T V+ G   T++  QRAV  +E  L + G          
Sbjct: 116 ------SLLGPDTPAVKVLGGTAVVSGTSATMEAHQRAVVAAEGSLGKDG---------- 159

Query: 183 KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ-----HSITGSSSGPSK-SFAADFGG 236
            V +   +A    V + V + E  R +LK++GF      +  T  S  PS  S  +   G
Sbjct: 160 AVFDTSTVASRAVVQVDVRVVEFSRSVLKEVGFNFFKQNNGFTFGSFAPSALSSVSATAG 219

Query: 237 KFVSEGGDFSVKGVLDRFSFETVLHAL-------ERATAIRTLAEPTLTAISGQSASFTS 289
           +  S  G   +    +   F +  H L       E     R LAEPTL A+SGQSASF +
Sbjct: 220 QAPSMTGVTPISSAFNLI-FNSATHGLFANLSLLESNNLARVLAEPTLVALSGQSASFLA 278

Query: 290 GGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNA 345
           GG+ +   V  + G TS+    YG+ L  TPTVLSP RI L++  E S+      + ++ 
Sbjct: 279 GGE-VPIPVPQALGTTSIEFKPYGIGLTLTPTVLSPQRIALKVAPEASQLDFANAVTISG 337

Query: 346 GDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNR 405
             +P++  R+ADTTVEL  G + V+ GL+  +       +PLL  +P++G  F+   + +
Sbjct: 338 VSVPAFITRRADTTVELGDGESFVIGGLIDRETASNVSKVPLLGDLPVIGTFFKQLNYQQ 397

Query: 406 EETEIFIAATPFLVKPVA 423
            E E+ I  TP LV P+A
Sbjct: 398 NEKELVIIVTPHLVSPLA 415


>gi|330882201|gb|EGH16350.1| type III secretion component [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 216

 Score =  139 bits (350), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 78/192 (40%), Positives = 115/192 (59%), Gaps = 5/192 (2%)

Query: 255 SFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGV 314
           + + +L AL+    +  LAEP +TA++GQ+ASF +GG+ +   V  +     +    YGV
Sbjct: 13  NIDAMLEALQSNGVLEVLAEPNITAMTGQTASFLAGGE-VAVPVPVNREVVGIEYKPYGV 71

Query: 315 VLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVL 370
            L F+PT+L  GRI L+++ EVS       + VN   +PS+RVR+ADT VE+ SG T  +
Sbjct: 72  SLLFSPTLLPNGRIALQVRPEVSSLMSTTTLDVNGYQVPSFRVRRADTRVEVGSGQTFAI 131

Query: 371 AGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           AGL + +  Q  + +P+L  +PILG LFR+ RF R ETE+ I  TP+LV+PV  R ++ P
Sbjct: 132 AGLFQHESSQDMDKVPMLGDMPILGNLFRSKRFQRNETELVILITPYLVEPVKDRVVATP 191

Query: 431 DDHYSVEDDAKA 442
            D       A A
Sbjct: 192 LDKQRAASTASA 203


>gi|218676249|ref|YP_002395068.1| Flp pilus assembly protein [Vibrio splendidus LGP32]
 gi|218324517|emb|CAV25991.1| Flp pilus assembly protein [Vibrio splendidus LGP32]
          Length = 446

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 117/388 (30%), Positives = 186/388 (47%), Gaps = 45/388 (11%)

Query: 66  VQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEM 125
           +  V V++   AD  +     + ++G   G  +VI+    G ++ N ++++ + +  L+ 
Sbjct: 47  ISTVFVANQEVADYKIIDENKVVVYGVGQGATSVIVYDRGGNEIYNAELVVNQSLRLLKQ 106

Query: 126 TLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRN----------- 174
           TL     D N+ V  V D VVL G+V + +  Q+   L    L +  R            
Sbjct: 107 TLIARFPDENVVVSNVGDQVVLDGIVGSEEIKQKINRLVGEMLKKDRRRAAYELKDADGE 166

Query: 175 -----QY-ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK 228
                +Y A  +  +V+N L +   +Q+ +K+T+AEV    L ++G  +S +G       
Sbjct: 167 ALDELEYTAKYNYDQVINNLKVLTTEQINVKLTVAEVSSSFLTELGVTYSDSGQP----- 221

Query: 229 SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
                  G FV++  DF+ + ++      +V+ A       R LAEP L+ ISG+ ASF 
Sbjct: 222 -------GTFVNKLLDFTAQDIV------SVISASGDDKIGRVLAEPNLSVISGEQASFL 268

Query: 289 SGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS------EPVIG 342
           +GG+ +   V    G T ++  +YGV L     V     I L +  EVS      +   G
Sbjct: 269 AGGE-IPIAVRDQDGIT-ISYKEYGVKLAMVAKVTDTENIRLTLIPEVSSIDESNKTTTG 326

Query: 343 VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
           + +  +PS R R+A TTV L  G + VLAGLL  + ++    IP+L  IPILGALF +S 
Sbjct: 327 LIS--VPSLRTRRAQTTVHLKDGQSFVLAGLLTSEERESLTKIPILGDIPILGALFSHSS 384

Query: 403 FNREETEIFIAATPFLVKPVAMRDLSRP 430
            NR +TE+ I AT  LV PV    +  P
Sbjct: 385 TNRSKTELIIVATVNLVDPVEQEQVKLP 412


>gi|145299828|ref|YP_001142669.1| flp pilus assembly protein FlpC [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142852600|gb|ABO90921.1| flp pilus assembly protein FlpC [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 461

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 121/444 (27%), Positives = 195/444 (43%), Gaps = 52/444 (11%)

Query: 66  VQDVLVSDPTKADVVVHSP--RTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHL 123
           V+D  V++     V VHSP  + + ++G+ VG+ ++++   DG+ + +  + +  D+A L
Sbjct: 34  VRDAFVAN--SELVRVHSPSDQQLLIYGRKVGRTDLVVTAQDGRTLGHYRVQVVADLAPL 91

Query: 124 EMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS-------------- 169
           +   R+    S +        +V+ G V +   +   + + E F                
Sbjct: 92  KQLARQHFPQSRLTFSESGGAIVVAGEVTSPLQAHEILAMVEAFAKGIQPQGVPSGPVAP 151

Query: 170 ---QSGRN------------QYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
              QSG              QYAN     V+N L +AG DQ+ + V I E++R   +Q+G
Sbjct: 152 AQPQSGNQDEGAAVAGGGSGQYAN-----VINQLRLAGSDQINISVRIVEMQRTTSEQLG 206

Query: 215 FQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAE 274
            + S  G             G +F       S  G  D      ++ AL   + +  LAE
Sbjct: 207 LRWSAMGE----YLQLGVSPGNRFPKPAERGSWGGKKDVVYINAIIDALVENSLVNVLAE 262

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           P LTA SG++A+F SGG+  +   +   G   +    +G+ L  TPT+L   RI L +  
Sbjct: 263 PNLTAKSGEAATFMSGGEFPFPVGNGDNGP-EIEFKKFGISLELTPTLLDNNRISLTVSP 321

Query: 335 EVS----EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSK 390
           EVS    E  + +    +P    R+  TT+EL  G +  LAGL++    Q  E +P L +
Sbjct: 322 EVSTLSRENSVSIAGVVVPGIETRRTTTTIELADGQSFALAGLVRTHRNQSSEALPFLGE 381

Query: 391 IPILGALFRNSRFNREETEIFIAATPFLVKPVA-MRDLSRPDDHYSVEDDAKAFFFNRVN 449
           IP L   F ++ F  +E+E+ I AT  LV+P +    LS P DHY      +  FF  + 
Sbjct: 382 IPGLAPFFGSNSFKNQESELVIIATARLVQPTSDPLSLSTPLDHYRAPSRFERRFFTDM- 440

Query: 450 KIYGPKEASEVEGQNYKGAIGFIY 473
              G  E    +     G  G+ Y
Sbjct: 441 ---GSTERPGAQATRLFGNYGYSY 461


>gi|88866586|gb|ABD57354.1| FlpC [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 479

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 121/444 (27%), Positives = 195/444 (43%), Gaps = 52/444 (11%)

Query: 66  VQDVLVSDPTKADVVVHSP--RTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHL 123
           V+D  V++     V VHSP  + + ++G+ VG+ ++++   DG+ + +  + +  D+A L
Sbjct: 52  VRDAFVAN--SELVRVHSPSDQQLLIYGRKVGRTDLVVTAQDGRTLGHYRVQVVADLAPL 109

Query: 124 EMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS-------------- 169
           +   R+    S +        +V+ G V +   +   + + E F                
Sbjct: 110 KQLARQHFPQSRLTFSESGGAIVVAGEVTSPLQAHEILAMVEAFAKGIQPQGVPSGPVAP 169

Query: 170 ---QSGRN------------QYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
              QSG              QYAN     V+N L +AG DQ+ + V I E++R   +Q+G
Sbjct: 170 AQPQSGNQDEGAAVAGGGSGQYAN-----VINQLRLAGSDQINISVRIVEMQRTTSEQLG 224

Query: 215 FQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAE 274
            + S  G             G +F       S  G  D      ++ AL   + +  LAE
Sbjct: 225 LRWSAMGE----YLQLGVSPGNRFPKPAERGSWGGKKDVVYINAIIDALVENSLVNVLAE 280

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           P LTA SG++A+F SGG+  +   +   G   +    +G+ L  TPT+L   RI L +  
Sbjct: 281 PNLTAKSGEAATFMSGGEFPFPVGNGDNGP-EIEFKKFGISLELTPTLLDNNRISLTVSP 339

Query: 335 EVS----EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSK 390
           EVS    E  + +    +P    R+  TT+EL  G +  LAGL++    Q  E +P L +
Sbjct: 340 EVSTLSRENSVSIAGVVVPGIETRRTTTTIELADGQSFALAGLVRTHRNQSSEALPFLGE 399

Query: 391 IPILGALFRNSRFNREETEIFIAATPFLVKPVA-MRDLSRPDDHYSVEDDAKAFFFNRVN 449
           IP L   F ++ F  +E+E+ I AT  LV+P +    LS P DHY      +  FF  + 
Sbjct: 400 IPGLAPFFGSNSFKNQESELVIIATARLVQPTSDPLSLSTPLDHYRAPSRFERRFFTDM- 458

Query: 450 KIYGPKEASEVEGQNYKGAIGFIY 473
              G  E    +     G  G+ Y
Sbjct: 459 ---GSTERPGAQATRLFGNYGYSY 479


>gi|86144318|ref|ZP_01062650.1| Flp pilus assembly protein [Vibrio sp. MED222]
 gi|85837217|gb|EAQ55329.1| Flp pilus assembly protein [Vibrio sp. MED222]
          Length = 441

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 116/388 (29%), Positives = 186/388 (47%), Gaps = 45/388 (11%)

Query: 66  VQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEM 125
           +  V V++   AD  +     + ++G   G  +VI+    G ++ N ++++ + +  L+ 
Sbjct: 42  ISTVFVANQEIADYKIIDENKVVVYGVGQGTTSVIVYDRGGNEIYNAELVVNQSLRLLKQ 101

Query: 126 TLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRN----------- 174
           TL     D N+ V  V D VVL G+V + +  Q+   L    L +  R            
Sbjct: 102 TLIARFPDENVVVSNVGDQVVLDGIVGSEEIKQKINRLVGEMLKKDRRRAAYELKDADGE 161

Query: 175 -----QY-ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK 228
                +Y A  +  +V+N L +   +Q+ +K+T+AEV    L ++G  +S +G       
Sbjct: 162 ALDELEYTAKYNYDQVINNLKVLTTEQINVKLTVAEVSSSFLTELGVTYSDSGDP----- 216

Query: 229 SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
                  G FV++  DF+ + ++      +V+ A       R LAEP L+ ISG+ ASF 
Sbjct: 217 -------GTFVNKLLDFTAQDIV------SVISASGDDKIGRVLAEPNLSVISGEQASFL 263

Query: 289 SGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS------EPVIG 342
           +GG+ +   +    G T ++  +YGV L     V     I L +  EVS      +   G
Sbjct: 264 AGGE-IPIAIRDEDGIT-ISYKEYGVKLAMVAKVTDTENIRLTLIPEVSSIDESNKTTTG 321

Query: 343 VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
           + +  +PS R R+A TTV L  G + VLAGLL  + ++    IP+L  IPILGALF +S 
Sbjct: 322 LIS--VPSLRTRRAQTTVHLKDGQSFVLAGLLTSEERESLTKIPILGDIPILGALFSHSS 379

Query: 403 FNREETEIFIAATPFLVKPVAMRDLSRP 430
            NR +TE+ I AT  LV PV    +  P
Sbjct: 380 TNRSKTELIIVATVNLVDPVEQEQVKLP 407


>gi|238790280|ref|ZP_04634054.1| Flp pilus assembly protein, secretin CpaC [Yersinia frederiksenii
           ATCC 33641]
 gi|238721630|gb|EEQ13296.1| Flp pilus assembly protein, secretin CpaC [Yersinia frederiksenii
           ATCC 33641]
          Length = 463

 Score =  137 bits (346), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 108/401 (26%), Positives = 190/401 (47%), Gaps = 50/401 (12%)

Query: 60  LQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ-MLNLDILIER 118
           L+V   V  V +S+P  AD  V   + + +F +  G+A++ + G D    ++ + I+++ 
Sbjct: 48  LKVNAAVDTVFISNPDVADYEVIDEKQVVIFARENGRASLEIYGGDNNATLMTMSIIVDP 107

Query: 119 DIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL------------SET 166
            + +++  +      S+I ++   +  VL G V   +D++  + +            +E 
Sbjct: 108 LLGNIKKEMAEEYPGSDIDIKKYGEGYVLTGTVPD-EDAREGIYMTVGQALGLKRKETEL 166

Query: 167 FLSQSGRNQYANSSSKK-------------VMNLLNIAGEDQVTLKVTIAEVRRDILKQI 213
            +     N      S               ++N L +   +QV +K+T+ EV +  +  +
Sbjct: 167 KIKPGSVNSIGGDDSNDTPIDFMQKVVFEGLVNRLKLPTTNQVNVKLTVVEVTKTFMDNV 226

Query: 214 GFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSV-KGVLDRFSFETVLHALERATAIRTL 272
           G   S  G  +                  G F++ K   D  S  ++++A++  +  R L
Sbjct: 227 GVDWSNAGLGA------------------GQFNLTKFRFDANSLNSLIYAIKNDSIARIL 268

Query: 273 AEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRI 332
           AEP L+ +SG++A F  GG+     V++S   +++T  ++GV L     V S  +I L +
Sbjct: 269 AEPNLSVLSGETADFLVGGE--IPIVTTSMAGSTITYKEFGVKLVIAAKVESNNKIKLNL 326

Query: 333 QTEVSEPVIGVNAGDM--PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSK 390
             E+S        GD+  P  R RKA TTVEL  G + VL GLL ++ ++   GIP +S 
Sbjct: 327 SEEISSLDGQYALGDLNIPKLRSRKARTTVELGDGDSFVLGGLLNENEKESLSGIPFISD 386

Query: 391 IPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           IPILGALFR +   RE TE+ + AT  LVKP++   +  P+
Sbjct: 387 IPILGALFRRTGAERERTELVVVATVNLVKPISFNKVVLPN 427


>gi|325518465|gb|EGC98164.1| pilus assembly protein [Burkholderia sp. TJI49]
          Length = 429

 Score =  137 bits (345), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 123/423 (29%), Positives = 189/423 (44%), Gaps = 86/423 (20%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPR---TMYLFGKNVGQA 97
           ++ +G  ++IS G +          +Q V V DP  ADV++       ++ L  K  G  
Sbjct: 14  ELAVGTQRQISAGRS----------LQRVAVGDPAIADVLIMKGSRSGSVLLTAKAPGAT 63

Query: 98  NVILI--GHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
           NV+L   G D   + +++++     A L+        DS  RV     T VL G   ++ 
Sbjct: 64  NVMLWERGRDEPTVWSVEVVDAAAHAVLD--------DSTPRVNAYGGTAVLRGTSASLD 115

Query: 156 DSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
             +RAV +        G+N     +   V++   +AG++ V + V + E  R +LKQ+GF
Sbjct: 116 AHERAVAV--------GKNMAGKGA---VIDRSTLAGKNVVQVDVRVVEFSRSVLKQVGF 164

Query: 216 QHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRF--------------------S 255
                         F    G  F    G FS  GV                        +
Sbjct: 165 NF------------FKQSNGFSF----GSFSPGGVQSYGGGSGPGTAGYIPTLGSPVASA 208

Query: 256 FETVLHA-----------LERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGA 304
           F  V++A           LE     R LAEPTL A+SGQSASF +GG+  + +     G+
Sbjct: 209 FNLVVNAAGHGIFGDLSLLEANNLARVLAEPTLVALSGQSASFLAGGEIPFPS-PQGLGS 267

Query: 305 TSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTV 360
           T++    YG+ L  TPTVLSP RI L++  E S+      + ++   +P    R+ADTTV
Sbjct: 268 TAIQWKQYGIGLSLTPTVLSPQRIALKVAPESSQLDYVNSVTISGVSVPGITTRRADTTV 327

Query: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           EL  G + V+ GL+          +PLL  +PI+G  F+N  + + + E+ I  TP LV 
Sbjct: 328 ELGDGESFVIGGLIDRQTMSNVSKVPLLGDLPIIGTFFKNLNYQQNDKELLIIVTPHLVA 387

Query: 421 PVA 423
           P+A
Sbjct: 388 PIA 390


>gi|330830432|ref|YP_004393384.1| protein transporter, outer membrane secretin (secretin) family
           [Aeromonas veronii B565]
 gi|328805568|gb|AEB50767.1| Protein transporter, outer bacterial membrane secretin (Secretin)
           family [Aeromonas veronii B565]
          Length = 465

 Score =  137 bits (344), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 114/412 (27%), Positives = 182/412 (44%), Gaps = 46/412 (11%)

Query: 79  VVVHSP--RTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNI 136
           V VHSP  + + ++G+ VG  ++++   DG+ + +  + +  D+A LE   R+    S +
Sbjct: 49  VRVHSPSDQQLLIYGRKVGHTDLVVTALDGRTLGHYRVTVVADLAPLEQLARQHFPQSRL 108

Query: 137 RVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS-----------------QSGRN----- 174
                   +V+ G V +   +   + + E F                   Q+G       
Sbjct: 109 TFSESGGAIVVAGEVTSPLQAHEILSMVEGFAKGLQPQSVAQSTVMAPSPQAGNQDEGAA 168

Query: 175 -------QYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
                  QYAN     V+N L +AG DQ+ + V I E++R   +Q+G + S  G      
Sbjct: 169 VAGGGSGQYAN-----VINQLRLAGSDQINISVRIVEMQRTTSEQLGLRWSAMGE----Y 219

Query: 228 KSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASF 287
                  G +F       S  G  D      ++ AL   + +  LAEP LTA SG++A+F
Sbjct: 220 LQLGVSPGNRFPKPLERGSWTGKKDVVYINAIIDALVENSLVNVLAEPNLTAKSGEAATF 279

Query: 288 TSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS----EPVIGV 343
            SGG+  +   +   G   +    +G+ L  TPT+L   RI L +  EVS    E  + +
Sbjct: 280 MSGGEFPFPVGNGDNGP-EIEFKKFGISLELTPTLLDNNRISLTVSPEVSTLSRENSVTI 338

Query: 344 NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRF 403
               +P    R+  TT+EL  G +  LAGL++    Q  E +P L +IP L   F ++ F
Sbjct: 339 AGVVVPGIETRRTTTTIELADGQSFALAGLVRSHRNQNNEALPFLGEIPGLAPFFGSNSF 398

Query: 404 NREETEIFIAATPFLVKPVA-MRDLSRPDDHYSVEDDAKAFFFNRVNKIYGP 454
             +E+E+ I AT  LV+P +    LS P DHY      +  FF  +     P
Sbjct: 399 KNQESELVIIATARLVQPTSDPLSLSTPLDHYRAPSRFERLFFTDMGSTQSP 450


>gi|148974885|ref|ZP_01811865.1| rough colony protein RcpA [Vibrionales bacterium SWAT-3]
 gi|145965394|gb|EDK30643.1| rough colony protein RcpA [Vibrionales bacterium SWAT-3]
          Length = 441

 Score =  136 bits (343), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 115/388 (29%), Positives = 186/388 (47%), Gaps = 45/388 (11%)

Query: 66  VQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEM 125
           +  V V++   AD  +     + ++G   G  +VI+    G ++ N ++++ + +  L+ 
Sbjct: 42  ISTVFVANQEIADYKIIDENKVVVYGVGQGTTSVIVYDRGGNEIYNAELVVNQSLRLLKQ 101

Query: 126 TLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRN----------- 174
           TL     D N+ V  + D VVL G+V + +  Q+   L    L++  R            
Sbjct: 102 TLIARFPDENVVVSNIGDQVVLDGIVGSEEIKQKINRLVGEMLNKERRRAAYELKDADGE 161

Query: 175 -----QY-ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK 228
                +Y A  +  +V+N L +   +Q+ +K+T+AEV    L ++G  +S +G       
Sbjct: 162 ALDEIEYTAQYNYDQVINNLKVLTTEQINVKLTVAEVSSSFLTELGVTYSDSGEP----- 216

Query: 229 SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
                  G FV++  DF+ + ++       V+ A       R LAEP L+ ISG+ ASF 
Sbjct: 217 -------GTFVNKLLDFTAQDIV------AVISASGDDKIGRVLAEPNLSVISGEQASFL 263

Query: 289 SGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS------EPVIG 342
           +GG+ +   V    G T ++  +YGV L     V     I L +  EVS      +   G
Sbjct: 264 AGGE-IPIAVRDEDGIT-ISYKEYGVKLAMVAKVTDTENIRLTLIPEVSSIDESNKTTTG 321

Query: 343 VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
           + +  +PS R R+A TTV L  G + VLAGLL  + ++    IP+L  IPILGALF ++ 
Sbjct: 322 LIS--VPSLRTRRAQTTVHLKDGQSFVLAGLLTSEERESLTKIPILGDIPILGALFSHTS 379

Query: 403 FNREETEIFIAATPFLVKPVAMRDLSRP 430
            NR +TE+ I AT  LV PV    +  P
Sbjct: 380 TNRSKTELIIVATVNLVDPVEQEQVKLP 407


>gi|261251281|ref|ZP_05943855.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio orientalis CIP 102891]
 gi|260938154|gb|EEX94142.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio orientalis CIP 102891]
          Length = 441

 Score =  136 bits (343), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 113/383 (29%), Positives = 184/383 (48%), Gaps = 41/383 (10%)

Query: 69  VLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLR 128
           V V++   AD  +     + ++G   G  +VI+    G ++ N ++++ + +  L+ T+ 
Sbjct: 45  VFVANQQIADYKIIDDNKVVVYGVGQGSTSVIVYDRGGNEIYNAELVVNQSLRLLKQTII 104

Query: 129 RFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL-SETFLSQSGRNQY----------- 176
               D N+ V  V D VVL G+V + +  Q+   L  E    +  R+ Y           
Sbjct: 105 ARFPDENVVVSNVGDQVVLDGIVSSEEVKQKVYRLVGEMLKKERRRHTYELRDADGEEYD 164

Query: 177 -----ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFA 231
                +  +  +V+N L +   +Q+ +K+T+AEV    L ++G  +S +G          
Sbjct: 165 ELDYTSRFTYDQVINHLKVLTTEQINVKLTVAEVSSSFLSELGVSYSDSGEP-------- 216

Query: 232 ADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGG 291
               GKFV++  DF+ + ++      +V+ A       + LAEP L+ ISG+ ASF +GG
Sbjct: 217 ----GKFVNKLLDFTAQDIV------SVISASGDDKIGQVLAEPNLSVISGEQASFLAGG 266

Query: 292 QHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGVNAG--D 347
           + +   V    G  S++  +YGV L     V     I L +  EVS  +     + G   
Sbjct: 267 E-IPIAVRDEDG-ISISYKEYGVKLAMVAKVTDSENIRLTLIPEVSSIDESNKTSTGLIS 324

Query: 348 MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREE 407
           +P+ R R+A TTV L  G + VLAGLL  + ++    IP L  IPILGALF ++  NR +
Sbjct: 325 VPTLRTRRAQTTVHLKDGQSFVLAGLLTSEEREALTKIPFLGDIPILGALFSHTTTNRSK 384

Query: 408 TEIFIAATPFLVKPVAMRDLSRP 430
           TE+ I AT  LV PV    +  P
Sbjct: 385 TELIIVATVNLVDPVESEQVKLP 407


>gi|262275469|ref|ZP_06053279.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Grimontia hollisae CIP 101886]
 gi|262220714|gb|EEY72029.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Grimontia hollisae CIP 101886]
          Length = 454

 Score =  136 bits (343), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 116/419 (27%), Positives = 197/419 (47%), Gaps = 52/419 (12%)

Query: 34  AAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKN 93
           A VIN+     G G   S+  N VI          V +SDP  AD  V     + +FG+ 
Sbjct: 29  AGVINL-----GTGDARSLEFNAVI--------GTVFISDPDIADYQVIDSNKLVVFGRK 75

Query: 94  VGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRT 153
           +G   +I+   D + + +  I++ + +  +E  L     D ++ V  + + VVL G+V T
Sbjct: 76  LGTTTLIVFDEDSQTLSHRKIVVNQSLTKIEQILAIRYPDVDVSVLNMGEQVVLTGVVPT 135

Query: 154 IQDSQRAVELSETFLSQ---SGRNQYANSSSKK-------------VMNLLNIAGEDQVT 197
            ++      +    LS+     R Q+  S  ++             ++N L +    QV 
Sbjct: 136 QKEKNEIYAVVGELLSKKFVERRTQWKTSFDEEFDIDFMARRTYEGLVNNLEVTVTKQVN 195

Query: 198 LKVTIAEVRRDILKQIGFQHS--ITGSSSGPSKSFAA--DFGGKFVSEGGDFSVKGVLDR 253
           +K+TIAEV   ++ ++G +    +    +G  + F     FGG+  +             
Sbjct: 196 VKLTIAEVNSSLINELGIKWGTILEDGFAGNGQFFKGITGFGGRTTN------------- 242

Query: 254 FSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYG 313
                 + A+      + L+EP ++ ISG++ASF  GG+ +  T     G   +   ++G
Sbjct: 243 --VAAYISAINDDNVGQVLSEPNVSVISGETASFLVGGE-IPITYRIDDGY-RIEYKEFG 298

Query: 314 VVLHFTPTVLSPGRIGLRIQTEVS--EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLA 371
           + L     VL   +I L +  +VS  +   G    D+PS++VR+A TT+EL  G + VLA
Sbjct: 299 IGLDLAAEVLRDDKIKLSVMPQVSSVDNQYGDTLLDIPSFKVRRARTTLELGDGDSFVLA 358

Query: 372 GLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           GLL  + ++    IP +  +PILGALFRN+   R +TE+ I AT  LV+PV+  +++ P
Sbjct: 359 GLLSSEDEEALSKIPFIGDVPILGALFRNTSTTRRKTELVIVATVSLVEPVSSANITIP 417


>gi|328952514|ref|YP_004369848.1| type II and III secretion system protein [Desulfobacca acetoxidans
           DSM 11109]
 gi|328452838|gb|AEB08667.1| type II and III secretion system protein [Desulfobacca acetoxidans
           DSM 11109]
          Length = 536

 Score =  136 bits (342), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 129/508 (25%), Positives = 221/508 (43%), Gaps = 65/508 (12%)

Query: 3   YLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQV 62
           YL R    ++  FL +S  +V     + E      N SD    K  +I I  +   + + 
Sbjct: 53  YLSRWLSIVLLFFLLTSGRAV-----LAE------NESDFA-SKAGRIVIAPHMSFVKRT 100

Query: 63  PVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERD--- 119
              +  V++++P+ AD  + +P  +++ GK       + + H        +I++  D   
Sbjct: 101 QRPITRVVLANPSLADAELLTPTQLFIVGKVKQGVTSLTLWHGDNYAETYEIVVSFDDKV 160

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANS 179
              ++  +RR +  + ++VE + + V+L G V +  D  +  ++++ F  +         
Sbjct: 161 WNDVQAAIRRLVPRARVKVERLPEGVMLDGAVESQGDLDKVDKIAKFFFGE--------- 211

Query: 180 SSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGS---SSGPSKSFAADFGG 236
                 N++ + G  QV L+V +AEV R  +KQ+G    +      +  PS + A    G
Sbjct: 212 ----CTNMITVMGSQQVQLEVKVAEVSRSGIKQLGLGFLLDKDYKVAVFPSGTAAGAMAG 267

Query: 237 ------KFVSEGGD------FSVKGVLDRFS--FETVLHA-----------LERATAIRT 271
                 ++ +   D       SV  +   +S  F+ ++H            L+     R 
Sbjct: 268 DRTTVSQWPTGSSDTKTSSLASVAALASPYSSAFQALVHGLNDDILGIVSLLQGQGLTRL 327

Query: 272 LAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           LA PTL  +SGQ A F  GG+  Y+TV  STG        +GV+L FTP VL    I + 
Sbjct: 328 LASPTLVTMSGQEAHFLVGGEIPYQTV-GSTGTPGTDFKKFGVMLKFTPYVLGDETITIS 386

Query: 332 IQTEVSEP-----VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIP 386
           +  EVS P         +   +P    R   +T++L  G    +AGLL+DD +   + IP
Sbjct: 387 VDPEVSAPDYTLGTTTSSGTTVPGLITRTGHSTLQLKDGQVFAMAGLLRDDFRSTVKKIP 446

Query: 387 LLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDL-SRPDDHYSVE-DDAKAFF 444
            L  +PILG LF +  F R ETE+ I   P +V+ +  +++ + P  +   +  D   F 
Sbjct: 447 FLGNLPILGTLFTSKEFQRSETELMIIVKPKIVRALNPQEVPALPGSNMERDVSDLDFFI 506

Query: 445 FNRVNKIYGPKEA-SEVEGQNYKGAIGF 471
            NR     G   A    +  ++ G IGF
Sbjct: 507 LNRGWPKTGASSAPPPAKAPSFVGEIGF 534


>gi|238759122|ref|ZP_04620291.1| Type II/III secretion system protein [Yersinia aldovae ATCC 35236]
 gi|238702670|gb|EEP95218.1| Type II/III secretion system protein [Yersinia aldovae ATCC 35236]
          Length = 354

 Score =  136 bits (342), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 111/374 (29%), Positives = 185/374 (49%), Gaps = 44/374 (11%)

Query: 101 LIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
           +   + + M+   +L+   I  +   ++    DSNI +  + D+ +L G      +S+ A
Sbjct: 1   MFNRNNQPMIKTVVLVNNIINLVYQRIKVEYPDSNIEINKIGDSYILTGQA----ESEEA 56

Query: 161 VELSETFLSQSGRN--------QYANSSSK-KVMNLLNIAGEDQVTLKVTIAEVRRDILK 211
            +   + + ++  N        QY N+ +   ++N + +   +QV +K+TIAEV +D  +
Sbjct: 57  KDTIASMVGEAVNNRREIKHKDQYLNNHNYLGIINKIKLPRPNQVNVKLTIAEVTKDFSE 116

Query: 212 QIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRT 271
            IG   S  G S G   SF      +F+     F+  G+       T++HA+   +  R 
Sbjct: 117 NIGIDWSSIGESVG---SF------QFLK----FNASGI------STLVHAINDDSIARI 157

Query: 272 LAEPTLTAISGQSASFTSGGQ-HLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGL 330
           LAEP L+ +SG+SASF  GG+  LY T  +ST    +    YG+ L  +  V    +I +
Sbjct: 158 LAEPNLSVLSGESASFLVGGEIPLYNTTQNST---IIKYKPYGIKLSISAKVNEHSKIRI 214

Query: 331 RIQTEVSE-----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGI 385
           ++  EVS       V G NA   P+   RKA TT+EL  G + +L GL+    ++  + I
Sbjct: 215 KVDEEVSNIGKRFNVEGGNA--YPTLETRKAATTLELADGESFILGGLITKSERESLKKI 272

Query: 386 PLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFF 445
           P +  IPILGA FRN++   ++TE+ + AT  LVKP+A  ++  P D  +     + F F
Sbjct: 273 PFIGDIPILGAFFRNAQTENKQTELVVVATVSLVKPLAGTEVELP-DFMNTSTLERLFNF 331

Query: 446 NRVNKIYGPKEASE 459
            R+ ++   K A E
Sbjct: 332 TRIIEVKRKKVAKE 345


>gi|323493934|ref|ZP_08099051.1| Flp pilus assembly protein [Vibrio brasiliensis LMG 20546]
 gi|323311875|gb|EGA65022.1| Flp pilus assembly protein [Vibrio brasiliensis LMG 20546]
          Length = 441

 Score =  136 bits (342), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 113/383 (29%), Positives = 184/383 (48%), Gaps = 41/383 (10%)

Query: 69  VLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLR 128
           V V++   AD  +     + ++G   G  +VI+    G ++ N ++++ + +  L+ T+ 
Sbjct: 45  VFVANQQIADYKIIDENKVVVYGVGQGSTSVIVYDRGGNEIYNAELVVNQSLRLLKQTII 104

Query: 129 RFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL-SETFLSQSGRNQY----------- 176
               D N+ V  V D VVL G+V + +  Q+   L  E    +  R+ Y           
Sbjct: 105 ARFPDENVVVSNVGDQVVLDGIVSSEEVKQKVYRLVGEMLKKERRRHTYELRDADGEEYD 164

Query: 177 -----ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFA 231
                +  +  +V+N L +   +Q+ +K+T+AEV    L ++G  +S +G          
Sbjct: 165 ELDYTSRFTYDQVINNLKVLTTEQINVKLTVAEVSSSFLTELGVTYSDSGEP-------- 216

Query: 232 ADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGG 291
               GKFV++  DF+ + ++      +V+ A       + LAEP L+ ISG+ ASF +GG
Sbjct: 217 ----GKFVNKLLDFTAQDIV------SVISASGDDKIGQVLAEPNLSVISGEQASFLAGG 266

Query: 292 QHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGVNAG--D 347
           + +   V    G  S++  +YGV L     V     I L +  EVS  +     + G   
Sbjct: 267 E-IPIAVRDEDG-ISISYKEYGVKLAMVAKVTDSENIRLTLIPEVSSIDESNKTSTGLIS 324

Query: 348 MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREE 407
           +P+ R R+A TTV L  G + VLAGLL  + ++    IP L  IPILGALF ++  NR +
Sbjct: 325 VPTLRTRRAQTTVHLKDGQSFVLAGLLTSEEREALTKIPFLGDIPILGALFSHTTTNRSK 384

Query: 408 TEIFIAATPFLVKPVAMRDLSRP 430
           TE+ I AT  LV PV    +  P
Sbjct: 385 TELIIVATVNLVDPVESEQVKLP 407


>gi|258620803|ref|ZP_05715838.1| Flp pilus assembly protein [Vibrio mimicus VM573]
 gi|258587001|gb|EEW11715.1| Flp pilus assembly protein [Vibrio mimicus VM573]
          Length = 444

 Score =  136 bits (342), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 121/401 (30%), Positives = 188/401 (46%), Gaps = 44/401 (10%)

Query: 53  GLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNL 112
           G  K I L+  +D   V V+D T AD  +     + ++G   G  +VI+    G ++ N 
Sbjct: 31  GAAKTINLKRQIDT--VFVADNTVADYRIVDQNKVVVYGVGQGATSVIVYDRGGNEIYNS 88

Query: 113 DILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS--- 169
           ++++ + +  L+ TL     D +I V  V D VVL G V + +   +   L    L    
Sbjct: 89  EVVVNQSLRLLKQTLIARFPDESISVSNVGDQVVLDGTVSSEEVKYKIYRLVGEMLKKNV 148

Query: 170 --------QSGRN------QY-ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
                   ++G N      QY A      V+N L +   +Q+ +K+TIAEV    L ++G
Sbjct: 149 SKVNNHVIETGENNREETLQYTATYVYDGVINNLKVLTTEQINVKLTIAEVSSSFLSELG 208

Query: 215 FQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAE 274
             +   G           D G KF ++  DF+ + ++       ++ A       + LAE
Sbjct: 209 VSYGDIG---------GGDVG-KFYNKLLDFTAQDIV------AIIAASGNDDIGQVLAE 252

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           P L+ ISG++ASF  GG+         T   ++   +YG+ L     V     I L +  
Sbjct: 253 PNLSVISGETASFLVGGEIPLAIKEDDT--YTIHYKEYGIKLSMVAKVTDSENIRLSLLP 310

Query: 335 EVSEPVIGVNAGD-----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLS 389
           EVS  +  VN  D      PS + RKA TTV+L  G + VLAGLL  + ++    IP+L 
Sbjct: 311 EVS-SLDSVNRSDNSSYNFPSLKTRKAQTTVQLKDGQSFVLAGLLTTEERESLRKIPILG 369

Query: 390 KIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
            IPILGALF +++ +R++TE+ I AT  LV PV    +  P
Sbjct: 370 DIPILGALFSSTKSDRKKTELIIVATVNLVDPVKTEQVKLP 410


>gi|121534343|ref|ZP_01666167.1| type II and III secretion system protein [Thermosinus
           carboxydivorans Nor1]
 gi|121307113|gb|EAX48031.1| type II and III secretion system protein [Thermosinus
           carboxydivorans Nor1]
          Length = 408

 Score =  136 bits (342), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 110/365 (30%), Positives = 182/365 (49%), Gaps = 32/365 (8%)

Query: 66  VQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEM 125
           VQ V V++P  ADV+V S   + + GK  G   + +    G+    +++ +  D A +  
Sbjct: 44  VQRVAVANPEIADVLVVSGTEVLVVGKAPGLTTMHVWTEAGRATYEVEVGV--DDAKVAG 101

Query: 126 TLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVM 185
            ++  +    IRV  V+ TV+L G V T Q   RA +L+  +               KV+
Sbjct: 102 EIKSILGYDGIRVSKVNRTVILEGAVDTQQQKARAEKLAAVY-------------GDKVV 148

Query: 186 NLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFV-SEGGD 244
           +LL +    QV ++  + E+ R  +K++G +    G+S+    +F   FG   + S+ GD
Sbjct: 149 SLLEVLRPVQVKIEAKVIEINRQKIKELGIKW---GNSADTPGTFI--FGQSALNSKVGD 203

Query: 245 FSVKGVLDRFS-FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTG 303
             V G L  ++     L AL ++ A + L++P +  +SG  AS   GGQ +   V+    
Sbjct: 204 --VFGDLGGYADINAQLSALVKSGAAKVLSQPNVVTLSGDKASIMIGGQ-IPVPVAQDNN 260

Query: 304 ATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE------PVIGVNAG-DMPSYRVRKA 356
             ++   DYG+ L   P V   G I  R++ EVS         I + AG ++P  R+RKA
Sbjct: 261 KITIEWKDYGIKLDIAPEVNGDGLIQSRVKAEVSSLDYNSANSIKLGAGMEIPPVRLRKA 320

Query: 357 DTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATP 416
           +T + L SG T+ + GL+  +  +    +P+L  +P+LG LFR++ F R ETE+ +  TP
Sbjct: 321 ETAIALSSGQTMAIGGLIATETSKDVVKVPMLGDLPVLGHLFRSTSFRRGETELLVLITP 380

Query: 417 FLVKP 421
            LV P
Sbjct: 381 SLVNP 385


>gi|262173894|ref|ZP_06041571.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio mimicus MB-451]
 gi|261891252|gb|EEY37239.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio mimicus MB-451]
          Length = 419

 Score =  136 bits (342), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 121/401 (30%), Positives = 188/401 (46%), Gaps = 44/401 (10%)

Query: 53  GLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNL 112
           G  K I L+  +D   V V+D T AD  +     + ++G   G  +VI+    G ++ N 
Sbjct: 6   GAAKTINLKRQIDT--VFVADNTVADYRIVDQNKVVVYGVGQGATSVIVYDRGGNEIYNS 63

Query: 113 DILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS--- 169
           ++++ + +  L+ TL     D +I V  V D VVL G V + +   +   L    L    
Sbjct: 64  EVVVNQSLRLLKQTLIARFPDESISVSNVGDQVVLDGTVSSEEVKYKIYRLVGEMLKKNV 123

Query: 170 --------QSGRN------QY-ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
                   ++G N      QY A      V+N L +   +Q+ +K+TIAEV    L ++G
Sbjct: 124 SKVNNHVIETGENNREETLQYTATYVYDGVINNLKVLTTEQINVKLTIAEVSSSFLSELG 183

Query: 215 FQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAE 274
             +   G           D G KF ++  DF+ + ++       ++ A       + LAE
Sbjct: 184 VSYGDIG---------GGDVG-KFYNKLLDFTAQDIV------AIIAASGNDDIGQVLAE 227

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           P L+ ISG++ASF  GG+         T   ++   +YG+ L     V     I L +  
Sbjct: 228 PNLSVISGETASFLVGGEIPLAIKEDDT--YTIHYKEYGIKLSMVAKVTDSENIRLSLLP 285

Query: 335 EVSEPVIGVNAGD-----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLS 389
           EVS  +  VN  D      PS + RKA TTV+L  G + VLAGLL  + ++    IP+L 
Sbjct: 286 EVS-SLDSVNRSDNSSYNFPSLKTRKAQTTVQLKDGQSFVLAGLLTTEERESLRKIPILG 344

Query: 390 KIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
            IPILGALF +++ +R++TE+ I AT  LV PV    +  P
Sbjct: 345 DIPILGALFSSTKSDRKKTELIIVATVNLVDPVKTEQVKLP 385


>gi|262164949|ref|ZP_06032687.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio mimicus VM223]
 gi|262027329|gb|EEY45996.1| type II/IV secretion system secretin RcpA/CpaC associated with Flp
           pilus assembly [Vibrio mimicus VM223]
          Length = 444

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 121/401 (30%), Positives = 188/401 (46%), Gaps = 44/401 (10%)

Query: 53  GLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNL 112
           G  K I L+  +D   V V+D T AD  +     + ++G   G  +VI+    G ++ N 
Sbjct: 31  GAAKTINLKRQIDT--VFVADNTVADYRIVDQNKVVVYGVGQGATSVIVYDRGGNEIYNS 88

Query: 113 DILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS--- 169
           ++++ + +  L+ TL     D +I V  V D VVL G V + +   +   L    L    
Sbjct: 89  EVVVNQSLRLLKQTLIARFPDESISVSNVGDQVVLDGTVSSEEVKYKIYRLVGEMLKKNV 148

Query: 170 --------QSGRN------QY-ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG 214
                   ++G N      QY A      V+N L +   +Q+ +K+TIAEV    L ++G
Sbjct: 149 SKVNNHVIETGENNREETLQYTATYVYDGVINNLKVLTTEQINVKLTIAEVSSSFLSELG 208

Query: 215 FQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAE 274
             +   G           D G KF ++  DF+ + ++       ++ A       + LAE
Sbjct: 209 VSYGDIG---------GGDVG-KFYNKLLDFTAQDIV------AIIAASGNDDIGQVLAE 252

Query: 275 PTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQT 334
           P L+ ISG++ASF  GG+         T   ++   +YG+ L     V     I L +  
Sbjct: 253 PNLSVISGETASFLVGGEIPLAIKEDDT--YTIHYKEYGIKLSMVAKVTDSENIRLSLLP 310

Query: 335 EVSEPVIGVNAGD-----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLS 389
           EVS  +  VN  D      PS + RKA TTV+L  G + VLAGLL  + ++    IP+L 
Sbjct: 311 EVS-SLDSVNRSDNSSYNFPSLKTRKAQTTVQLKDGQSFVLAGLLTTEERESLRKIPILG 369

Query: 390 KIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
            IPILGALF +++ +R++TE+ I AT  LV PV    +  P
Sbjct: 370 DIPILGALFSSTKSDRKKTELIIVATVNLVDPVKTEQVKLP 410


>gi|312882144|ref|ZP_07741893.1| pilus assembly protein CpaC [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309370190|gb|EFP97693.1| pilus assembly protein CpaC [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 456

 Score =  135 bits (340), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 107/394 (27%), Positives = 195/394 (49%), Gaps = 23/394 (5%)

Query: 51  SIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQML 110
           SI LN    +QV + +  V +S+P  AD  V +  T+ ++   VGQ+ +I+ G D   +L
Sbjct: 34  SITLNDGQHIQVNMPIGKVFISNPEVADYKVINENTLVVYANEVGQSRLIVYGTDSSVLL 93

Query: 111 NLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQ 170
           +  I+++ +++ +   L+    D  ++V+ +   V + G+V + +       L  T L +
Sbjct: 94  SDRIVVDLNLSEVRRQLKFHYPDVQVKVQSIGTQVAVSGVVDSEETRDDIYRLVATLLGR 153

Query: 171 SGRNQYANSSSKKVMNLLNIAGED--------QVTLKVTIAEVRRDILKQIGFQHSITGS 222
               ++ N   K      N   E+         +T +  I  ++    +Q+  + SI   
Sbjct: 154 EKTEKW-NQVEKLTFESENTRYEEPESMVFARNMTWEGIIERIKVTTTQQVNVKISIAHV 212

Query: 223 SSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFS---FETVLHALERATAIRTLAEPTLTA 279
           +    ++   D+G    +  G F    V D+F+     T++ AL      + LAEP LT 
Sbjct: 213 TESFGQTVGIDWGS-IGARVGSF----VFDQFNAANLGTIISALGNDEIAQVLAEPNLTV 267

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE- 338
           +SG+SASF +GG+     +  +    +V+   +G+ L+ T  VLS  +I +++   VSE 
Sbjct: 268 LSGESASFLAGGE--VPVIVLNDRNLTVSFKQFGIGLNLTAKVLSRDKIQMQLAPSVSEV 325

Query: 339 -PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD-DIQQLKEGIPLLSKIPILGA 396
              +      +P + +RKA TTVEL  G + +L GL+   D +++++ +P++  IP+ GA
Sbjct: 326 EGFVEFEGLKVPQFTLRKALTTVELSDGDSFILGGLMSSADFEEMQK-VPVIGDIPLFGA 384

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
            FR ++  R+ TE+ I AT  LV+PV   D+  P
Sbjct: 385 AFRKAKTERKRTELIIVATVNLVEPVRPNDIQVP 418


>gi|197118220|ref|YP_002138647.1| Flp pilus assembly secretin CpaC [Geobacter bemidjiensis Bem]
 gi|197087580|gb|ACH38851.1| Flp pilus assembly secretin CpaC [Geobacter bemidjiensis Bem]
          Length = 494

 Score =  134 bits (338), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 121/428 (28%), Positives = 200/428 (46%), Gaps = 63/428 (14%)

Query: 54  LNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLD 113
           +N+ +++ +    + V ++ P  A++VV SP  + + GK VG   +I+    GK     D
Sbjct: 36  VNRSVLVDLHTKSERVSIASPDVAELVVISPTQLQINGKKVGSTTLIVWDTAGKTSF-FD 94

Query: 114 ILIERD-------IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSET 166
           + ++R+       I  L+  +++     NI+V+  +DT+VL G     Q   +A++L++ 
Sbjct: 95  VRVKRNESVLESQIEALQDQIQQMAPKDNIKVDYANDTIVLSGTAANEQTVAKALQLAQA 154

Query: 167 FLSQSG---------------RNQYANSSSK------------KVMNLLNIAGEDQVTLK 199
           + + +G               R+ Y  S ++             V+N + I    QV L+
Sbjct: 155 YTAGNGSKAGAPATDPPLDTSRSSYQLSETQTGRQGGDADTVITVLNHVEIVEPQQVLLE 214

Query: 200 VTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVK----GV----- 250
           V +A+V +  LK +G    I G+S+    +      G+   +  D SV+    G+     
Sbjct: 215 VKVAQVDKTALKSLGISAFIRGASAEGFSNLVGAPVGELAIKNPDGSVRSQATGIAGPIP 274

Query: 251 -------LDRF-----SFE----TVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHL 294
                  +D +     SF+     VL AL      + LAEP L   SGQ   F +G +  
Sbjct: 275 GLANFTPIDSYQLGVSSFKAGIGAVLRALVTKNLAKVLAEPNLMVQSGQVGKFLAGSKIP 334

Query: 295 YKTVS--SSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNA-GDMPSY 351
           Y  VS   +  ATS+   D GV L+F P VL  G I L+I       + GV A    P  
Sbjct: 335 YSIVSGVGALSATSIQFIDVGVKLNFKPEVLENGLISLKIDPAEVSSITGVLAVNGYPII 394

Query: 352 RVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIF 411
             R+  T V+L  G +++LAGLL+++  +    IP+L  IPILGALFR+++ + +E E+ 
Sbjct: 395 DTREVRTRVKLKDGESLILAGLLQEEAIKAMSKIPILGDIPILGALFRSTQDDIKEKELV 454

Query: 412 IAATPFLV 419
              TP LV
Sbjct: 455 FFITPKLV 462


>gi|78066131|ref|YP_368900.1| Flp pilus assembly protein secretin CpaC [Burkholderia sp. 383]
 gi|77966876|gb|ABB08256.1| Flp pilus assembly protein secretin CpaC [Burkholderia sp. 383]
          Length = 443

 Score =  134 bits (338), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 119/384 (30%), Positives = 178/384 (46%), Gaps = 51/384 (13%)

Query: 66  VQDVLVSDPTKADV-VVHSPRT-MYLFGKNVGQANVILI--GHDGKQMLNLDILIERDIA 121
           +Q V V DP+ ADV VV   R  + L  K+ G  NV++   GHD   + N+ +       
Sbjct: 46  LQRVAVGDPSVADVMVVKGGRGGVLLIAKSAGATNVMIWERGHDEPTVYNVSVT------ 99

Query: 122 HLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSS 181
                 R  +      V     T V+ G   ++   QRAV  ++T   + G    A++  
Sbjct: 100 --SGAARALLDGGTSSVNTYGGTTVIGGASGSLDGHQRAVHAAKTVSGKDGTTIDAST-- 155

Query: 182 KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH------------------SITGSS 223
                   I+G++ V + V + E  R +LKQ G                     SITGS 
Sbjct: 156 --------ISGKNVVQVDVRVVEFSRSVLKQAGLNFFKQSNGFSFGAFAPTGLTSITGSP 207

Query: 224 SGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQ 283
            G + ++  +     +S   +  V  V      +  L  LE     R LA+PTL A+SGQ
Sbjct: 208 GG-ALTYNTNV---PISSAFNLVVNSVSHGLFAD--LSILEANNLARVLAQPTLVALSGQ 261

Query: 284 SASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----P 339
           SA+F +GG+ +   V  S G  S+    YGV L  TPTVL+P RI L++  E S+     
Sbjct: 262 SANFLAGGE-IPVPVPQSLGTISIEWKPYGVGLTVTPTVLNPRRIALKVAPESSQLDFVH 320

Query: 340 VIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFR 399
            I +N   +P+   R+ADTTVEL  G + V+ GL+  +       +P L  +PI+GA F+
Sbjct: 321 SITINGVQVPALTTRRADTTVELGDGESFVIGGLIDRETTSNVNKVPFLGDLPIIGAFFK 380

Query: 400 NSRFNREETEIFIAATPFLVKPVA 423
           N  + + + E+ I  TP LV P+A
Sbjct: 381 NLSYQQSDKELVIIVTPHLVAPIA 404


>gi|152981036|ref|YP_001355006.1| pilus assembly protein CpaC [Janthinobacterium sp. Marseille]
 gi|151281113|gb|ABR89523.1| pilus assembly protein CpaC [Janthinobacterium sp. Marseille]
          Length = 429

 Score =  134 bits (338), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 109/392 (27%), Positives = 183/392 (46%), Gaps = 34/392 (8%)

Query: 60  LQVPVDVQDVLVSDPTKADVVV-----HSPRTMYLFGKNVGQANVILIGHDGKQMLNLDI 114
           L+ P D++ + V+DP  AD+++       P ++ L GK  G  +V     +G   +    
Sbjct: 35  LKTPADLERIAVADPEVADILIIKGSNKRPGSIMLVGKKPGSTSVTAWQRNGPTKVWQ-- 92

Query: 115 LIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRN 174
                   ++  L+  + +    +++ SD+  L G   ++      V      +   G+ 
Sbjct: 93  ------VSVQSALQGLLPEEGAELQINSDSASLRGQSPSLLSHANTVAAGTQAV---GKE 143

Query: 175 QYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADF 234
           ++ ++S+        +A    V + V I E  R++LK+ GF   I   + G + SF  + 
Sbjct: 144 KFLDTST--------VATSGMVQIDVQIVEFSRNVLKEAGFDF-IFNQNRGATFSFGLNN 194

Query: 235 GGKFVSEGGDFSVK---GVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGG 291
               +S      V     +L   S    +  +E+    R LA P+L A+SGQSASF +GG
Sbjct: 195 FSTILSSTVQTPVSQAFNLLGSTSVNARVKLIEQNGLARVLARPSLIALSGQSASFLAGG 254

Query: 292 QHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGD 347
           + L    S   G T++    +G+ L  TPTVLS  RI L++  E S+      I  N   
Sbjct: 255 E-LPVPQSGGLGTTTIIYKAFGIGLTVTPTVLSANRIALKVAPEASDLDYANAIVTNNMM 313

Query: 348 MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREE 407
           +P+   R+ +TT+EL  G + V+ GL+    +     +P L  +PILG  FR+ +++++E
Sbjct: 314 IPAISTRRTETTLELGDGESFVIGGLVSRTTKSNVNKVPFLGDLPILGPFFRSMQYSQDE 373

Query: 408 TEIFIAATPFLVKPVAM-RDLSRPDDHYSVED 438
            E+ I ATP LVKP+A    L  P D     D
Sbjct: 374 KELVIIATPHLVKPIAKGAQLPLPGDDKERRD 405


>gi|167562915|ref|ZP_02355831.1| type II/III secretion system protein [Burkholderia oklahomensis
           EO147]
          Length = 432

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 126/425 (29%), Positives = 197/425 (46%), Gaps = 62/425 (14%)

Query: 32  ANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADV-VVHSPR-TMYL 89
           A AA +   ++  G  +++S+G N          VQ V V DP  ADV VV   R ++ L
Sbjct: 11  ARAAEMGTIELATGAQRQVSVGRN----------VQRVAVGDPNVADVLVVKGGRGSVLL 60

Query: 90  FGKNVGQANVILI--GHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVL 147
             K  G  ++++   G D   +  ++++            R  +   +  V+    T V+
Sbjct: 61  VAKAAGSTSLMVWERGRDEPAVYTVNVV--------SGAARALLDGGSPSVKAYGGTAVV 112

Query: 148 HGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRR 207
            G   T+    RA+ L +    + G           V++   + G++ V + V + E  R
Sbjct: 113 SGSAATLDAHARALALGKGMAGKDG----------GVVDASTVGGKNVVQVDVRVVEFSR 162

Query: 208 DILKQIGFQH------------------SITGSSSGPSKSFAADFGGKFVSEGGDFSVKG 249
            +LKQ G                     S+TG ++ PS S +A+     +S   +  V G
Sbjct: 163 SVLKQAGLNFFKQNNGFTFGAFAPSGLASVTGGAT-PSMSVSANI---PISSAFNL-VVG 217

Query: 250 VLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT 309
              R  F   L  LE     R LA+PTL A+SGQSASF +GG+ +   V  S G  S+  
Sbjct: 218 SATRGLFAD-LSILEANNLARVLAQPTLVALSGQSASFLAGGE-IPVPVPQSLGTISIDW 275

Query: 310 HDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSG 365
             YGV L  TPTVLSP RI L++  E S+      I +N   +P+   R+ADTTVEL  G
Sbjct: 276 KPYGVGLTLTPTVLSPRRIALKVAPESSQLDFVHSITINGVTVPALTTRRADTTVELGDG 335

Query: 366 GTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMR 425
            + V+ GL+  +     + +P L  +PI+G  F++  + + + E+ I  TP LV P+A +
Sbjct: 336 ESFVIGGLIDRETTSNVDKVPFLGDLPIIGTFFKHLSYQQNDKELVIIVTPHLVAPIA-K 394

Query: 426 DLSRP 430
           + S P
Sbjct: 395 NASLP 399


>gi|167570105|ref|ZP_02362979.1| type II/III secretion system protein [Burkholderia oklahomensis
           C6786]
          Length = 434

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 126/425 (29%), Positives = 197/425 (46%), Gaps = 62/425 (14%)

Query: 32  ANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADV-VVHSPR-TMYL 89
           A AA +   ++  G  +++S+G N          VQ V V DP  ADV VV   R ++ L
Sbjct: 13  ARAAEMGTIELATGAQRQVSVGRN----------VQRVAVGDPNVADVLVVKGGRGSVLL 62

Query: 90  FGKNVGQANVILI--GHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVL 147
             K  G  ++++   G D   +  ++++            R  +   +  V+    T V+
Sbjct: 63  VAKAAGSTSLMVWERGRDEPAVYTVNVV--------SGAARALLDGGSPSVKAYGGTAVV 114

Query: 148 HGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRR 207
            G   T+    RA+ L +    + G           V++   + G++ V + V + E  R
Sbjct: 115 SGSAATLDAHARALALGKGMAGKDG----------GVVDASTVGGKNVVQVDVRVVEFSR 164

Query: 208 DILKQIGFQH------------------SITGSSSGPSKSFAADFGGKFVSEGGDFSVKG 249
            +LKQ G                     S+TG ++ PS S +A+     +S   +  V G
Sbjct: 165 SVLKQAGLNFFKQNNGFTFGAFAPSGLASVTGGAT-PSMSVSANIP---ISSAFNL-VVG 219

Query: 250 VLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT 309
              R  F   L  LE     R LA+PTL A+SGQSASF +GG+ +   V  S G  S+  
Sbjct: 220 SATRGLFAD-LSILEANNLARVLAQPTLVALSGQSASFLAGGE-IPVPVPQSLGTISIDW 277

Query: 310 HDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSG 365
             YGV L  TPTVLSP RI L++  E S+      I +N   +P+   R+ADTTVEL  G
Sbjct: 278 KPYGVGLTLTPTVLSPRRIALKVAPESSQLDFVHSITINGVTVPALTTRRADTTVELGDG 337

Query: 366 GTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMR 425
            + V+ GL+  +     + +P L  +PI+G  F++  + + + E+ I  TP LV P+A +
Sbjct: 338 ESFVIGGLIDRETTSNVDKVPFLGDLPIIGTFFKHLSYQQNDKELVIIVTPHLVAPIA-K 396

Query: 426 DLSRP 430
           + S P
Sbjct: 397 NASLP 401


>gi|161524905|ref|YP_001579917.1| type II and III secretion system protein [Burkholderia multivorans
           ATCC 17616]
 gi|189350345|ref|YP_001945973.1| pilus assembly protein [Burkholderia multivorans ATCC 17616]
 gi|160342334|gb|ABX15420.1| type II and III secretion system protein [Burkholderia multivorans
           ATCC 17616]
 gi|189334367|dbj|BAG43437.1| pilus assembly protein [Burkholderia multivorans ATCC 17616]
          Length = 443

 Score =  133 bits (335), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 121/405 (29%), Positives = 185/405 (45%), Gaps = 58/405 (14%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHS---PRTMYLFGKNVGQANVILI--G 103
           ++++G  + I    P+  Q V V DP  ADV++       ++ L  K  G  NV+L   G
Sbjct: 28  ELAVGAQRQISAGRPL--QRVAVGDPAIADVLIMKGSRSSSVLLIAKAPGATNVMLWERG 85

Query: 104 HDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL 163
            D   + +++++     A L+        DS  RV     T VL G   ++   +RAV +
Sbjct: 86  RDEPTVWSVEVVDAAAHAVLD--------DSAPRVNAYGGTAVLRGTSASLDAHERAVAV 137

Query: 164 SETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ--HSITG 221
                   G+N     +   V++   +AG+  V + V + E  R +LKQ+GF       G
Sbjct: 138 --------GKNMAGKGA---VIDRSTLAGKSVVQVDVRVVEFSRSVLKQVGFNFFKQSNG 186

Query: 222 SSSG---PS-------------KSFAADFGGKFVSEGG---DFSVKGVLDRFSFETVLHA 262
            S G   PS               +    G    S      + + +G+    S       
Sbjct: 187 FSFGSFLPSGVQSFGGGSGPGSAGYIPTLGSPVASAFNLVVNAAGRGIFGDLSL------ 240

Query: 263 LERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTV 322
           LE     R LAEPTL A+SGQSASF +GG+    +     G+T++    YGV L  TPTV
Sbjct: 241 LEANNLARVLAEPTLVALSGQSASFLAGGEIPVPS-PQGLGSTAIQWKQYGVGLSLTPTV 299

Query: 323 LSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDI 378
           LSP RI L++  E S+      + ++   +P    R+ADTTVEL  G + V+ GL+    
Sbjct: 300 LSPQRIALKVAPESSQLDFVNSVTISGVAVPGITTRRADTTVELGDGESFVIGGLIDRQT 359

Query: 379 QQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA 423
                 +PLL  +PI+G  F+N  + + + E+ I  TP LV P+A
Sbjct: 360 MSNVSKVPLLGDLPIIGTFFKNLNYQQNDKELLIIVTPHLVAPIA 404


>gi|33593025|ref|NP_880669.1| putative type II secretion system protein [Bordetella pertussis
           Tohama I]
 gi|33563400|emb|CAE42276.1| putative type II secretion system protein [Bordetella pertussis
           Tohama I]
 gi|332382437|gb|AEE67284.1| putative type II secretion system protein [Bordetella pertussis CS]
          Length = 449

 Score =  133 bits (335), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 125/412 (30%), Positives = 194/412 (47%), Gaps = 44/412 (10%)

Query: 69  VLVSDPTKADVVVHSPRT-----MYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHL 123
           V ++DP  ADV V +P       + L G+  G   + +     +   +  +   R +  +
Sbjct: 61  VAIADPQVADVKVLAPGVGRPGEVLLIGRQAGTTELRVWSRGSR---DPQVWTVRVLPQV 117

Query: 124 EMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKK 183
           +  L R       +V+M  D+ V+ GM  + +  + A E +            A   + K
Sbjct: 118 QAALARRGVGGGAQVDMAGDSGVVTGMAPSAEAHRGAAEAAAA----------AAGGNDK 167

Query: 184 VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK---SFAADFGGKFVS 240
           V+++  I     V ++V + E+ R ++K +G       + SGP     S   D      +
Sbjct: 168 VVDMSQINTSGVVQVEVKVVELARSVMKDVGINFR---ADSGPWSGGVSLLPDL-----A 219

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
            GG F +     R  F   L  L+     R LAEPTL A+SGQSASF +GG+ +   VS+
Sbjct: 220 SGGMFGMLSYTSR-DFSASLALLQNNGMARVLAEPTLLAMSGQSASFLAGGE-IPIPVSA 277

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP--VIGVNAGD-------MPSY 351
             G TSV    +G+ L  TPTV+S  RI L++  E SE     G+++ D       +P+ 
Sbjct: 278 GLGTTSVQFKPFGIGLTVTPTVISRERIALKVAPEASELDYANGISSIDSNNRITVIPAL 337

Query: 352 RVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIF 411
           R RKADT VEL  G T V++GL+    +     +PLL  +PI+GA FRN ++++E+ E+ 
Sbjct: 338 RTRKADTMVELGDGETFVISGLVSRQTKASVNKVPLLGDLPIIGAFFRNVQYSQEDRELV 397

Query: 412 IAATPFLVKPVAMR-DLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEG 462
           I  TP LV+P+A    L  P     V D   A F      + GP    ++ G
Sbjct: 398 IVVTPRLVRPIARGVTLPLPGARQEVSD---AGFNAWGYYLLGPMSGQQMPG 446


>gi|33596969|ref|NP_884612.1| putative type II secretion system protein [Bordetella parapertussis
           12822]
 gi|33600811|ref|NP_888371.1| putative type II secretion system protein [Bordetella
           bronchiseptica RB50]
 gi|33566420|emb|CAE37673.1| putative type II secretion system protein [Bordetella
           parapertussis]
 gi|33568411|emb|CAE32323.1| putative type II secretion system protein [Bordetella
           bronchiseptica RB50]
          Length = 448

 Score =  133 bits (335), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 125/412 (30%), Positives = 194/412 (47%), Gaps = 44/412 (10%)

Query: 69  VLVSDPTKADVVVHSPRT-----MYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHL 123
           V ++DP  ADV V +P       + L G+  G   + +     +   +  +   R +  +
Sbjct: 60  VAIADPQVADVKVLAPGVGRPGEVLLIGRQAGTTELRVWSRGSR---DPQVWTVRVLPQV 116

Query: 124 EMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKK 183
           +  L R       +V+M  D+ V+ GM  + +  + A E +            A   + K
Sbjct: 117 QAALARRGVGGGAQVDMAGDSGVVTGMAPSAEAHRGAAEAAAA----------AAGGNDK 166

Query: 184 VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK---SFAADFGGKFVS 240
           V+++  I     V ++V + E+ R ++K +G       + SGP     S   D      +
Sbjct: 167 VVDMSQINTSGVVQVEVKVVELARSVMKDVGINFR---ADSGPWSGGVSLLPDL-----A 218

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
            GG F +     R  F   L  L+     R LAEPTL A+SGQSASF +GG+ +   VS+
Sbjct: 219 SGGMFGMLSYTSR-DFSASLALLQNNGMARVLAEPTLLAMSGQSASFLAGGE-IPIPVSA 276

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP--VIGVNAGD-------MPSY 351
             G TSV    +G+ L  TPTV+S  RI L++  E SE     G+++ D       +P+ 
Sbjct: 277 GLGTTSVQFKPFGIGLTVTPTVISRERIALKVAPEASELDYANGISSIDSNNRITVIPAL 336

Query: 352 RVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIF 411
           R RKADT VEL  G T V++GL+    +     +PLL  +PI+GA FRN ++++E+ E+ 
Sbjct: 337 RTRKADTMVELGDGETFVISGLVSRQTKASVNKVPLLGDLPIIGAFFRNVQYSQEDRELV 396

Query: 412 IAATPFLVKPVAMR-DLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEG 462
           I  TP LV+P+A    L  P     V D   A F      + GP    ++ G
Sbjct: 397 IVVTPRLVRPIARGVTLPLPGARQEVSD---AGFNAWGYYLLGPMSGQQMPG 445


>gi|87308911|ref|ZP_01091049.1| probable type II secretion system protein [Blastopirellula marina
           DSM 3645]
 gi|87288254|gb|EAQ80150.1| probable type II secretion system protein [Blastopirellula marina
           DSM 3645]
          Length = 540

 Score =  133 bits (335), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 110/386 (28%), Positives = 173/386 (44%), Gaps = 46/386 (11%)

Query: 69  VLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI--GHDGK-QMLNLDILIERD------ 119
           V +++P   +V   SP  M + G  VGQ  + L     DG    L   I++  D      
Sbjct: 84  VAITNPAVVEVNEFSPTEMEVIGSAVGQTTMTLWFNNADGTVSTLRYLIIVSNDDNRADL 143

Query: 120 -IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYAN 178
               L+  +      S +++  ++D +++ G  R   DS+ A E+      Q+  NQ  N
Sbjct: 144 EYGKLQAHINEMFPYSRVQLFPIADKLIVRGQAR---DSKEAAEILAVIGDQA-VNQNGN 199

Query: 179 SS--------------------SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS 218
            S                    +  ++NLL + GE QV LKV +AE+ R   +++G   S
Sbjct: 200 ISGSGTVNVGSVARLPDAEDLETTSLINLLEVPGEQQVMLKVRVAELSRQAARELGMDFS 259

Query: 219 ITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLT 278
           +   S          F       GG  ++  +LD    E  + A     + + LAEPTL 
Sbjct: 260 VMEES----------FSIAHTIMGGAGNLSAILDGGDVELFIRAFSSNGSAKILAEPTLM 309

Query: 279 AISGQSASFTSGGQHLYKTVSS--STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEV 336
            +SGQSASF +GG+    T       GA S +   +G  + F PTV+    I L +   V
Sbjct: 310 TLSGQSASFIAGGEFAVPTAVGVGGIGAVSTSFRGFGTQVQFMPTVMDKDMIRLSVAPSV 369

Query: 337 SEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
           S     ++   +P   +R A TTV+L  G  + +AGL++D+ +  +  +PLL  IP +GA
Sbjct: 370 SSINQSLSVDGVPGLDIRGAVTTVDLREGQWLAIAGLIQDEQEASRSRLPLLGDIPYVGA 429

Query: 397 LFRNSRFNREETEIFIAATPFLVKPV 422
            F +    R ETE+ I  +P LV P+
Sbjct: 430 AFGSQTTKRIETELVILVSPELVHPM 455


>gi|117618977|ref|YP_855991.1| protein transporter, outer bacterial membrane secretin (secretin)
           family protein [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|117560384|gb|ABK37332.1| protein transporter, outer bacterial membrane secretin (secretin)
           family [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 465

 Score =  133 bits (335), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 117/431 (27%), Positives = 189/431 (43%), Gaps = 50/431 (11%)

Query: 79  VVVHSP--RTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNI 136
           V VHSP  + + ++G+ VG+ ++++   DG+ + +  + +  D+A L+   R+    S +
Sbjct: 49  VRVHSPSDQQLLIYGRKVGRTDLVVTALDGRTLGHYRVQVVADLAPLKQLARQHFPQSRL 108

Query: 137 RVEMVSDTVVLHGMV-----------------RTIQDSQRAVELSETFLSQSGRN----- 174
                   +V+ G V                 + IQ    A+  +     Q+G       
Sbjct: 109 SFSESGGAIVVAGEVTSPLQAHEILTMVEGFAKGIQPQGSALGTTAPVPPQTGSQDEGAA 168

Query: 175 -------QYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
                  QYA+     V+N L +AG DQ+ + V I E++R   +Q+G + S  G      
Sbjct: 169 VAGGGSGQYAH-----VINQLRLAGSDQINISVRIVEMQRTTSEQLGLRWSAMGEY---- 219

Query: 228 KSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASF 287
                  G +F       S  G  D      ++ AL   + +  LAEP LTA SG++A+F
Sbjct: 220 LQLGVSPGNRFPKPAERGSWGGKKDVVYINAIIDALVENSLVNVLAEPNLTAKSGEAATF 279

Query: 288 TSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS----EPVIGV 343
            SGG+  +   +   G   +    +G+ L  TPT+L   RI L +  EVS    E  + +
Sbjct: 280 MSGGEFPFPVGNGDNGP-EIEFKKFGISLELTPTLLDNNRISLTVSPEVSTLSRENSVSI 338

Query: 344 NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRF 403
               +P    R+  TT+EL  G +  LAGL++    Q  E +P L +IP L   F ++ F
Sbjct: 339 AGVVVPGIETRRTTTTIELADGQSFALAGLVRTHRNQSSEALPFLGEIPGLAPFFGSNGF 398

Query: 404 NREETEIFIAATPFLVKPVA-MRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEG 462
             +E+E+ I AT  LV+P +    LS P DHY      +  FF  +    G  E    + 
Sbjct: 399 KNQESELVIIATARLVQPTSDPLSLSTPLDHYRAPSRFERLFFTDM----GSTERPGAQA 454

Query: 463 QNYKGAIGFIY 473
               G  G+ Y
Sbjct: 455 TRLFGNYGYSY 465


>gi|323495637|ref|ZP_08100708.1| type ii/iv secretion system secretin rcpa/cpac,associated with flp
           pilus assembly [Vibrio sinaloensis DSM 21326]
 gi|323319272|gb|EGA72212.1| type ii/iv secretion system secretin rcpa/cpac,associated with flp
           pilus assembly [Vibrio sinaloensis DSM 21326]
          Length = 440

 Score =  133 bits (334), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 122/449 (27%), Positives = 207/449 (46%), Gaps = 70/449 (15%)

Query: 4   LQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVP 63
           L+R FFT   I ++SS  S   L               V +G+G+  +I   +       
Sbjct: 3   LKRIFFTF-CIAVWSSLASSQVL---------------VNLGEGEAKAITTKQ------- 39

Query: 64  VDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHL 123
            ++  V +S+P  AD  V     + +FGK VG  +++    +   +++  +++ + + H+
Sbjct: 40  -EIASVFISNPEIADYQVVDKNKLVVFGKKVGSVSLLAFDDNSNTIVSRKLVVNKSLIHI 98

Query: 124 EMTLRRFIADSNIRVEMVSDTVVLHGMV--RTIQDS--------------QRAVEL---S 164
           +  ++    + +I +  + + VVL G V    I+D                  +E    +
Sbjct: 99  QQQIQLRYPNISISLYNLEEQVVLAGKVPSEKIRDEINILVGELLEKEYEDHKIEWKIGT 158

Query: 165 ETF-LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS 223
           ET+ +    R  Y       ++N + +A   QV +K++IAEV +  L++ G Q+  +G  
Sbjct: 159 ETYEMEFMTRRHYLG-----IVNNIEVATTKQVNVKLSIAEVSQSFLEEFGVQYGSSGQG 213

Query: 224 SGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQ 283
           +G            FV +  +FS   ++      +V+ AL   T  + LAEP L+ ISG+
Sbjct: 214 AGT-----------FVDQLVNFSASDIV------SVITALGDDTVGQVLAEPNLSVISGE 256

Query: 284 SASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVI 341
           SA F  GG+     V+   G T+V   ++G+ L     VL   +I L +  EVS  +   
Sbjct: 257 SAHFLVGGE--LPVVTIIDGGTNVLYKEFGIRLEMMAKVLEDDKIKLSLLPEVSSIDSQY 314

Query: 342 GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNS 401
                 +P+ + R+A TTVEL  G + VL GLL  + ++    +P +  +PILGALFR+S
Sbjct: 315 QNERYSLPALKTRRARTTVELGDGQSFVLGGLLSTEDRESLRRVPFIGDVPILGALFRHS 374

Query: 402 RFNREETEIFIAATPFLVKPVAMRDLSRP 430
              R  TE+ I AT  LV PV    +  P
Sbjct: 375 ETVRNRTELVIVATVNLVNPVNPSQIQLP 403


>gi|149178342|ref|ZP_01856934.1| probable type II secretion system protein [Planctomyces maris DSM
           8797]
 gi|148842868|gb|EDL57239.1| probable type II secretion system protein [Planctomyces maris DSM
           8797]
          Length = 546

 Score =  132 bits (333), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 115/437 (26%), Positives = 194/437 (44%), Gaps = 60/437 (13%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD--GKQMLNLDILI 116
           IL++ +DV  V ++DP+K +VV    + + + GK+ G   + L   D    Q+L++ + +
Sbjct: 77  ILKMKMDVFRVAIADPSKIEVVAFGSQEVEVIGKDTGTTTMTLWLGDEANPQILSVQVKV 136

Query: 117 ERD----------IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVEL--- 163
           E D              +  +  F  +S I++   +D +++ G  R   D Q AV++   
Sbjct: 137 EGDNSIEDLRRMEYGEFQKMINEFFPNSKIQLVPFADKLIVRGQAR---DEQEAVQIITI 193

Query: 164 -----------------SETFLSQSGRNQYANSS---SKKVMNLLNIAGEDQVTLKVTIA 203
                               F   +  + +   +      V+++L + GE Q+ LKV IA
Sbjct: 194 IRARSGSGGGQGGGGGGGSLFADGAAADPFPGGAMLPEATVIDMLKVPGEKQIMLKVRIA 253

Query: 204 EVRRDILKQIGFQHSITGSSSGPSKSFAADFG--------GKFVSEGGDFSVKGVLDRFS 255
           ++ R   +        T S++  ++S   DFG         + +  GG   V        
Sbjct: 254 QIDRSAAR--------TASTNIIAQS--GDFGWAQLFTGVAQQLGNGGTGLVTASFTSSD 303

Query: 256 FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT--HDYG 313
            +  + AL +    + LAEP L  ISG++A+F SGG+    TV    GA + TT    +G
Sbjct: 304 VDVFISALAQNGYAKILAEPNLVTISGRTANFISGGEFAVPTVVGVGGAQAATTTFKGFG 363

Query: 314 VVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGL 373
             L F PTVL   RI L++    S     + +G +    V+   TTV+L  G  + +AGL
Sbjct: 364 TQLSFLPTVLDKDRIRLQVSPSFSTVNPALTSGGVLGVNVQAVTTTVDLREGQVLAIAGL 423

Query: 374 LKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSR--PD 431
           L++  +     +P +  IP++G LF N   +R+ETE+ I  +P LV P+   D     P 
Sbjct: 424 LQEQQRGDLNRVPFIGDIPLVGPLFSNKGVSRDETELIILISPELVHPMEPEDAPTVLPG 483

Query: 432 DHYSVEDDAKAFFFNRV 448
              +   D   FF N +
Sbjct: 484 MEVTEPGDVDFFFMNNI 500


>gi|302391029|ref|YP_003826849.1| type II and III secretion system protein [Acetohalobium arabaticum
           DSM 5501]
 gi|302203106|gb|ADL11784.1| type II and III secretion system protein [Acetohalobium arabaticum
           DSM 5501]
          Length = 414

 Score =  132 bits (333), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 108/381 (28%), Positives = 180/381 (47%), Gaps = 35/381 (9%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGK 107
           K + +G  K  +L+V VD++   V+DP  AD+V  S   + + GK+ G   + L    G 
Sbjct: 32  KILQLGTGKSELLKV-VDLERAAVADPEVADIVTISQEELLINGKSEGTTTLHLWDQKGH 90

Query: 108 QMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
           +   +++  E   A +   ++  I    ++V  V + ++L G VR     QR  +++  F
Sbjct: 91  RSYQVEVYKEE--ARVIKQIKELIGTDTVKVAKVEENIILSGKVRDQTQLQRVKKIAGVF 148

Query: 168 LSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
                         +KV+N L +    QV L   + E+ + + +++GF    T  +SG  
Sbjct: 149 -------------GEKVINELQVTNSLQVLLAAQVFEIDKAVSEELGFDWYST--NSGGV 193

Query: 228 KSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASF 287
           +S  A  G    S    F +      +   T L AL      + LA+P L   SGQ ASF
Sbjct: 194 ESGTATLGETTTSR---FGIGHYERLYQLRTKLKALIEDGKAKLLAKPKLVTKSGQKASF 250

Query: 288 TSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE-----PVIG 342
             GG+    T  SS G  +V   +YGV     PTV   G++   +  +VS+      V  
Sbjct: 251 NVGGEIPVVTADSS-GEQTVVWKNYGVQFEVEPTVTPTGKLETYLHPKVSQLDWANAVDY 309

Query: 343 VNAGDMPSYRVRKADTTVELPSGGTIVLAGLLK----DDIQQLKEGIPLLSKIPILGALF 398
            N+G +P+ +  +  T V +  G  + + GLL+    +DI++    IPLLS++PILG LF
Sbjct: 310 GNSGQLPAIKSSEVKTQVVIKDGAALAIGGLLQQYRSEDIKR----IPLLSQLPILGELF 365

Query: 399 RNSRFNREETEIFIAATPFLV 419
           ++  F  E++E+ I  TP ++
Sbjct: 366 KSKSFREEKSELIILVTPKII 386


>gi|91775995|ref|YP_545751.1| type II and III secretion system protein [Methylobacillus
           flagellatus KT]
 gi|91709982|gb|ABE49910.1| type II and III secretion system protein [Methylobacillus
           flagellatus KT]
          Length = 453

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 122/435 (28%), Positives = 201/435 (46%), Gaps = 53/435 (12%)

Query: 46  KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD 105
           + ++I + + +  + +  V +Q V V++P    V + SP+TM +  K VG   + L    
Sbjct: 26  QAEEIMVSMGQQRLYEHTVTLQRVAVANPEVLAVTLTSPKTMMIVPKAVGATEISLWDSQ 85

Query: 106 GKQMLN-LDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELS 164
             Q    L + +   +A LE    +    + ++VE   + + L G  R++++  RA+E  
Sbjct: 86  SVQPSRVLQVSVTPSLA-LEGQGLKAADAAGLQVEAAGNGLALSGEARSLEEHARALE-- 142

Query: 165 ETFLSQSGRNQYANSSSKKVMNLLNIAGED---QVTLKVTIAEVRRDILKQIGFQHSITG 221
                         S  K+    L++   +    V + + + EV R    + GF      
Sbjct: 143 --------------SLQKERQGALDVTSSEFDSHVQIDIKVVEVSRQNAMRFGFLMGKNN 188

Query: 222 SSSGPSKSFAAD---FGGKFVSEGG-DFSVKG----VLDRFS---------FETVLHALE 264
           S+S       A    F G     GG DFS       VL+ F+             L  LE
Sbjct: 189 SASRDGFGIVASPNSFSGVEAGSGGFDFSSTSGFLPVLNAFNVVFGNHGSGLLGTLSILE 248

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLY--KTVSSSTGATSVTTHDYGVVLHFTPTV 322
                 TLAEP+L+AISGQ+A+F +GG+     +T   S  A ++   +YGV L  TPT+
Sbjct: 249 GNGFAYTLAEPSLSAISGQTATFLAGGEFPVPIRTGGGSDSAITIRYKEYGVRLMLTPTI 308

Query: 323 LSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDI 378
           LS  RI L++  EVSE      +      +P  +VR+ +T+V L +G + V++G++  + 
Sbjct: 309 LSGERIFLKVAPEVSELDFANAVQTGGVAVPGLKVRRTETSVSLGNGESFVISGMVSRNT 368

Query: 379 QQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD------D 432
               + +P L  IPI+GA F + RF+RE+ E+ +  TP LV+P+A R+   P        
Sbjct: 369 INNIDKVPGLGNIPIIGAFFSSKRFDREDKELLMVVTPRLVRPIA-RNAELPALPGSELK 427

Query: 433 HYSVEDDAKAFFFNR 447
           HY  +     FF +R
Sbjct: 428 HY--KPSFSEFFLSR 440


>gi|253701800|ref|YP_003022989.1| type II and III secretion system protein [Geobacter sp. M21]
 gi|251776650|gb|ACT19231.1| type II and III secretion system protein [Geobacter sp. M21]
          Length = 451

 Score =  132 bits (331), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 119/406 (29%), Positives = 187/406 (46%), Gaps = 44/406 (10%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLF-GKNVGQANVILIGHD 105
           G   ++ +N+ ++L +    + V ++D    DV     R   L  GK +G  N+I+   +
Sbjct: 29  GVPTTVIVNRGVVLNLKNPARYVNITDKDVIDVPDPLRRNQLLINGKKIGSTNLIVWEEN 88

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
            +     D+ +  D   +E  +R +  + +I V+   DTVVL G V      ++A E+++
Sbjct: 89  NENPTFFDVRVVGDREAIESQIRDYAPNDDISVQYAQDTVVLSGKVANEMTGKKAEEIAK 148

Query: 166 TFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS- 224
            +             S KV+N + +    QV L+V +A+V R  LK++G    + G ++ 
Sbjct: 149 AY-------------SAKVLNHITVDEPQQVLLQVKVAQVDRTSLKRLGISAMVKGRTAE 195

Query: 225 -------GPS--KSFAADFGGKFVS---EGGDFSVKGV-----LDRFS---------FET 258
                   PS   S       +F S    G   S+ G+     LD F+            
Sbjct: 196 GFMNLVGAPSGTSSVTNSSATRFTSTEASGIAGSIPGLGSFDPLDAFNVGVSYFPAGIGA 255

Query: 259 VLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGAT--SVTTHDYGVVL 316
           VL AL      + LAEP L   SG+  +F +G +  Y  + S+ GA+  S+     GV L
Sbjct: 256 VLQALSSKGLAKILAEPNLLVKSGEEGNFLAGSRIPYSVLISTGGASTSSIIFETVGVKL 315

Query: 317 HFTPTVLSPGRIGLRIQ-TEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLK 375
            F P VL  G I L+I   EVS     +     P    R   T VEL  G +++LAGLL+
Sbjct: 316 KFKPQVLQNGLINLKIDPAEVSSIAGTLAVNGYPIIDTRDVRTDVELRDGESLILAGLLQ 375

Query: 376 DDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
           ++  +    IPLL  IPILGALFR+S+ +  E ++    TP +VKP
Sbjct: 376 EEQIKTMSKIPLLGDIPILGALFRSSQKDIREKDLVFFITPKIVKP 421


>gi|171317113|ref|ZP_02906316.1| type II and III secretion system protein [Burkholderia ambifaria
           MEX-5]
 gi|171097747|gb|EDT42574.1| type II and III secretion system protein [Burkholderia ambifaria
           MEX-5]
          Length = 443

 Score =  132 bits (331), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 120/409 (29%), Positives = 186/409 (45%), Gaps = 58/409 (14%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPR---TMYLFGKNVGQA 97
           ++ +G  ++IS G            +Q V V DP  ADV++       ++ L  K  G  
Sbjct: 28  ELAVGAQRQISAGRT----------LQRVAVGDPAVADVLIMKGSRSGSVLLTAKAPGAT 77

Query: 98  NVILI--GHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
           NV+L   G D   + +++++        +   +  +  S  RV     T VL G   ++ 
Sbjct: 78  NVMLWARGRDEPTVWSVEVV--------DAAAQAVLDGSTPRVNAYGGTAVLQGTAASLD 129

Query: 156 DSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
              RA        S  G+N    S+   V++   + G++ V + V + E  R +LKQ+GF
Sbjct: 130 AHARA--------SAVGKNM---SAKGNVIDRSTVVGKNVVQVDVRVVEFSRSVLKQVGF 178

Query: 216 QH-------SITGSSSGPSKSFAADFG----------GKFVSEGGDFSVKGVLDRFSFET 258
                    S    S G  +S++   G          G  V+   +  V     R  F  
Sbjct: 179 NFFKQSNGFSFGSFSPGGVQSYSGGAGPGTGGYVPTLGSPVASAFNLVVNAA-GRGIFAD 237

Query: 259 VLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHF 318
            L  LE     R LAEPTL A+SGQSASF +GG+ +        G+T++    YGV L  
Sbjct: 238 -LSLLEANNLARVLAEPTLVALSGQSASFLAGGE-IPVPAPQGLGSTAIQWKQYGVGLTL 295

Query: 319 TPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLL 374
           TPTVL+P RI L++  E S+      + ++   +P    R+ADTTVEL  G + V+ GL+
Sbjct: 296 TPTVLNPNRIALKVAPESSQLDFVNSVTISGVAVPGITTRRADTTVELGDGESFVIGGLI 355

Query: 375 KDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA 423
                     +PLL  +PI+G  F+N  + + + E+ I  TP LV P+A
Sbjct: 356 DRQTMSNVSKVPLLGDLPIIGTFFKNLSYQQNDKELLIIVTPHLVAPIA 404


>gi|254245567|ref|ZP_04938888.1| Flp pilus assembly protein, secretin CpaC [Burkholderia cenocepacia
           PC184]
 gi|124870343|gb|EAY62059.1| Flp pilus assembly protein, secretin CpaC [Burkholderia cenocepacia
           PC184]
          Length = 443

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 120/423 (28%), Positives = 183/423 (43%), Gaps = 86/423 (20%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPR---TMYLFGKNVGQA 97
           ++ +G  ++IS G            +Q V V DP  ADV++       ++ L  K  G  
Sbjct: 28  ELAVGAQRQISAGRT----------LQRVAVGDPAIADVLIMKGSRSGSVLLTAKAPGAT 77

Query: 98  NVILI--GHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
           NV+L   G D   + N++++        +   +  +  +  RV     T VL G   +++
Sbjct: 78  NVMLWERGRDEPTIWNVEVV--------DAAAQAVLDGAAPRVNAYGGTAVLQGSAASLE 129

Query: 156 DSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGF 215
              RA  +        G+N    S    V++   + G+  V + V + E  R +LKQ+GF
Sbjct: 130 AHSRAAAV--------GKNM---SGKGVVIDRSTVPGKSVVQVDVRVVEFSRSVLKQVGF 178

Query: 216 QHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRF--------------------S 255
                         F    G  F    G FS  GV                        +
Sbjct: 179 NF------------FKQSNGFSF----GSFSPGGVQSYSGGSGPGTGGYVPTLGSPVASA 222

Query: 256 FETVLHA-----------LERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGA 304
           F  V++A           LE     R LAEPTL A+SGQSASF +GG+    +     G+
Sbjct: 223 FNLVVNAAGRGIFADLSLLEANNLARVLAEPTLVALSGQSASFLAGGEIPVPS-PQGLGS 281

Query: 305 TSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTV 360
           T++    YGV L  TPTVLSP RI L++  E S+      + ++   +P    R+ADTTV
Sbjct: 282 TAIQWKQYGVGLSLTPTVLSPSRIALKVAPESSQLDFVNSVTISGVAVPGITTRRADTTV 341

Query: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           EL  G + V+ GL+          +PLL  +PI+G  F+N  + + + E+ I  TP LV 
Sbjct: 342 ELGDGESFVIGGLIDRQTMSNVSKVPLLGDLPIIGTFFKNLSYQQNDKELLIIVTPHLVA 401

Query: 421 PVA 423
           P+A
Sbjct: 402 PIA 404


>gi|325108090|ref|YP_004269158.1| type II and III secretion system protein [Planctomyces brasiliensis
           DSM 5305]
 gi|324968358|gb|ADY59136.1| type II and III secretion system protein [Planctomyces brasiliensis
           DSM 5305]
          Length = 714

 Score =  131 bits (329), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 115/394 (29%), Positives = 184/394 (46%), Gaps = 48/394 (12%)

Query: 73  DPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIA 132
           DP    V   +P  + +   + G   ++L+    K    +++ +E D+ +L+  + RF  
Sbjct: 95  DPAVLTVSALTPHRVRIQAVSAGVTTLVLVDEFDK-TYTIEVFVEGDVRYLQSYIDRFFP 153

Query: 133 DSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAG 192
           DS+++   V D+VVL G+V       +  E++E F               KV+N +    
Sbjct: 154 DSSVKAVKVKDSVVLRGVVADPSHISQITEVAEQFF-------------PKVINHMQFGA 200

Query: 193 EDQVTLKVTIAEVRRDILKQIGFQHS-ITGS---SSGPSKSFAADFGGKF-------VSE 241
            +QV L+V I E +R  ++Q+GF  S + GS   SS P  S ++  G          +S 
Sbjct: 201 ANQVRLQVRIMEAQRSRIRQLGFNWSFLNGSGYVSSNPG-SLSSPLGANLTPGQTPGLSY 259

Query: 242 GG----DFSVK-GVLDRFS-FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLY 295
           GG    D S+  GV++  S F   L AL++   +R L E ++ A SG+ AS  SGG+   
Sbjct: 260 GGAGLSDSSISFGVVNANSVFRGFLEALKQEGLLRILVETSVVADSGRPASLLSGGE-FP 318

Query: 296 KTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDM-----PS 350
             V  + G  SV   ++GV L   P VL  G++ L I  E SE     NA  +     P+
Sbjct: 319 ILVPQALGTLSVEWKEFGVKLEAVPIVLGQGQVILEIAPEFSERDFA-NAAQLDNTTVPA 377

Query: 351 YRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEI 410
              R+A+T V +  G T+++ GL+        + +P L ++P +GA FR  R++  ETE+
Sbjct: 378 ITTRRANTQVRMKFGQTLMIGGLIATRYTAETDKVPFLGELPGIGAAFRRVRYDENETEL 437

Query: 411 FIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFF 444
            I  TP  V P+         D + V D     F
Sbjct: 438 IILVTPEYVAPL---------DPHQVPDGGPGQF 462


>gi|163857691|ref|YP_001631989.1| putative Flp pilus assembly secretin [Bordetella petrii DSM 12804]
 gi|163261419|emb|CAP43721.1| putative Flp pilus assembly secretin [Bordetella petrii]
          Length = 464

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 124/444 (27%), Positives = 201/444 (45%), Gaps = 58/444 (13%)

Query: 48  KKISIGLNKVIILQVPVDVQDVLVSDPTKADVVV-----HSPRTMYLFGKNVGQANVILI 102
           + IS+ +    +L +P     + V+DP  ADV V       P  + L GK+ G   V + 
Sbjct: 47  QDISLAVKGQQLLPLPGTPTRIAVADPDVADVKVLPAAAGRPAAVMLIGKSAGTTQVQVW 106

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVE 162
             + +      + +   +   +  L+R        V++     V+ G   +    Q +V 
Sbjct: 107 ARNSRSPATWTVHVTGPV---QAELQRRGQAGGANVDVAGTHAVVSGHAPSALSHQNSVA 163

Query: 163 LSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGS 222
            +             +   K V+++        V ++V + EV R ++KQ+G   S+TG+
Sbjct: 164 AAAA-----------SVGDKNVVDVATAGSGGVVQVEVKVVEVSRSVMKQVGL--SMTGN 210

Query: 223 SSGPSKSFAADFGGKFVSEG----GDFSVKGVL--------DRFSFETVLHALERATAIR 270
           + G        FG +   +G    G  + +GVL        D   F   L  L+     R
Sbjct: 211 AGG------WGFGSRTSPDGFSTPGTLNPRGVLSDGFNLLFDSNHFGATLRMLQSNGMAR 264

Query: 271 TLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGL 330
            LAEPTL A+SGQSASF +GG+ +    S   G  +V    +G+ L  TPTVLS  RI L
Sbjct: 265 VLAEPTLVALSGQSASFLAGGE-IPIPESGGLGTQNVVFKPFGIGLTVTPTVLSRDRIAL 323

Query: 331 RIQTEVSE-------PVI-GVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLK 382
           ++  E SE       P++ G  A  +P+ R R+ADT +EL  G + V++GL+    +   
Sbjct: 324 KVAPEASELDYVNGIPILNGETATLIPALRTRRADTMIELGDGESFVISGLVSRQTKASV 383

Query: 383 EGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMR-DLSRPDDHYSVED--- 438
             +P L ++PI+GA FR   +++EE E+ I  TP LV+P+A    L  P +     D   
Sbjct: 384 NKVPFLGELPIIGAFFRGIEYSQEEHELVIVVTPRLVRPIARGVALPLPGERQERPDSIT 443

Query: 439 DAKAFFFNRVNKIYGPKEASEVEG 462
           +A  ++      + GP    +V G
Sbjct: 444 NAWGYY------LMGPAGGQQVPG 461


>gi|116626779|ref|YP_828935.1| type II and III secretion system protein [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116229941|gb|ABJ88650.1| type II and III secretion system protein [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 471

 Score =  130 bits (328), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 106/393 (26%), Positives = 189/393 (48%), Gaps = 44/393 (11%)

Query: 65  DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
           D+  V +S+P  AD VV SPR + +  K  G+A ++ +   G   +  +I + +D    +
Sbjct: 48  DITKVAISEPKIADAVVISPREVMVNAKGPGRATLV-VWETGLDPVRYEIAVTKDTTEWD 106

Query: 125 MTLRRFIADSNIRVEMVS--DTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK 182
           M  +  I  + + + +    DT+VL G+V++  D++R   +++T              +K
Sbjct: 107 MFTKSMIDSAGVPIHITGSGDTIVLSGVVKSADDAKRLAGMAQT-------------RAK 153

Query: 183 KVMNLLNI---AGEDQVTLKVTIAEVRRDILKQIGFQ-----HSITGSSSGPSKSFAADF 234
            V+NLL     A   Q+ L+V  A + R  L QIGF          G+SS  ++ F++  
Sbjct: 154 TVINLLQAPPPAEPRQILLQVKFAAIDRVALTQIGFNLFSTNDKFIGASS--TEQFSSPR 211

Query: 235 GGKFVSEGGDFSVK--GVLDRFSFETVLH------ALERATAIRTLAEPTLTAISGQSAS 286
             +    G   +V    +L+ F+F   L+      ALE    ++ LAEP L  + G+ A+
Sbjct: 212 FSQLQPTGTGQTVNFSDLLNLFAFRPDLNIGATIKALEERNLLQILAEPNLLCLDGKEAT 271

Query: 287 FTSGGQHLYKTVSSSTGAT------SVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE-- 338
           F +GG   Y T++++          +V    +GV L F PTV   G I L++Q EVS   
Sbjct: 272 FLAGGTFPYPTITTTPTGGATAPVITVQFKPFGVKLDFQPTVTPQGSIDLKVQPEVSSLD 331

Query: 339 --PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
               + +    +P+   R+A+T + L  G +  +AGL+ + + +    +P L  +P+LG 
Sbjct: 332 YANAVTLQGFVIPALSQRRAETEIILKDGESFAIAGLIDNRVIETLSKVPGLGDLPVLGK 391

Query: 397 LFRNSRFNREETEIFIAATPFLVKPVAMRDLSR 429
           +FR+    +   E+ +  TP  VKP+   + ++
Sbjct: 392 IFRSRSTQKSADELLVVVTPHFVKPLTPEERAK 424


>gi|197117446|ref|YP_002137873.1| Flp pilus assembly secretin CpaC [Geobacter bemidjiensis Bem]
 gi|197086806|gb|ACH38077.1| Flp pilus assembly secretin CpaC [Geobacter bemidjiensis Bem]
          Length = 451

 Score =  130 bits (327), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 122/437 (27%), Positives = 199/437 (45%), Gaps = 47/437 (10%)

Query: 47  GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLF-GKNVGQANVILIGHD 105
           G   ++ +N+ ++L +    + V ++D    DV     R   L  GK +G  N+I+   +
Sbjct: 29  GVPTTVIVNRGVVLNLKNPARYVNITDKDVIDVPDPLRRNQLLINGKKIGSTNLIVWEEN 88

Query: 106 GKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSE 165
             +    D+ +  D   +E  +R +    +I V+   DTV+L G V      ++A E+++
Sbjct: 89  NDKPTFFDVRVVGDREAIESQIRDYAPKDDISVQYAQDTVILSGKVANEMTGKKAEEIAK 148

Query: 166 TFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH-------- 217
            +             S KV+N + +    QV L+V +A+V R  LK++G           
Sbjct: 149 AY-------------SAKVLNHITVDEPQQVLLQVKVAQVDRTSLKRLGLSAIVKGRTAE 195

Query: 218 ---SITGSSSGPSKSFAADFGGKFVSEGGDFSVKGV--------LDRFS---------FE 257
              ++ G+ SG S++  +    +F S  G+  V  +        L+ F+           
Sbjct: 196 GFTNLVGAPSGTSRNTEST-PTRFTSTEGNGIVGNIPGIGGFDPLNAFNVGVSYFPAGIG 254

Query: 258 TVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGAT--SVTTHDYGVV 315
            VL AL      + LAEP L   SG+  +F +G +  Y  + S+ GA+  S+     GV 
Sbjct: 255 AVLQALSSKGLAKILAEPNLLVKSGEEGNFLAGSRIPYSVLISTGGASTSSIVFETVGVK 314

Query: 316 LHFTPTVLSPGRIGLRIQ-TEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLL 374
           L F P VL  G I L+I   EVS     +     P    R   T VEL  G ++VLAGLL
Sbjct: 315 LKFKPQVLQNGLINLKIDPAEVSSIAGTLAVNGYPIIDTRDVRTDVELRDGESLVLAGLL 374

Query: 375 KDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSR-PDDH 433
           +++  +    IPLL  IPILGALFR+S+ +  E ++    TP +VKP      ++ P D 
Sbjct: 375 QEEQIKNMSKIPLLGDIPILGALFRSSQKDIREKDLVFFITPKIVKPTPAGVATKLPTDA 434

Query: 434 YSVEDDAKAFFFNRVNK 450
            + E++    +  R  K
Sbjct: 435 VTPEEEKGYDWIPRGGK 451


>gi|330816715|ref|YP_004360420.1| Type II and III secretion system protein [Burkholderia gladioli
           BSR3]
 gi|327369108|gb|AEA60464.1| Type II and III secretion system protein [Burkholderia gladioli
           BSR3]
          Length = 477

 Score =  130 bits (326), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 121/429 (28%), Positives = 188/429 (43%), Gaps = 67/429 (15%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADV-VVHSPRTMYLFGKNVGQANV 99
           D+ +G  ++I+ G N          +Q V V DP  AD+ ++     + L GK+ G  NV
Sbjct: 31  DLAVGAQRQIASGRN----------LQRVAVGDPAVADILIIKGGGGVMLIGKSAGTTNV 80

Query: 100 ILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQR 159
           +L      +     + +    AH        + D+  RV+   DT V+ G   T++  QR
Sbjct: 81  MLWERGRSEPTVYTVHVTSGAAH------ALLNDATPRVDTYGDTTVISGSANTLEAHQR 134

Query: 160 AVELSETFLSQSGRNQYA-------------------------NSSSKKVMNLLNIAGED 194
           AV+++    +     Q +                         +S+   V++   I+G +
Sbjct: 135 AVDVANAAAAARAAAQQSSSAGGGQGKGQAVGRGGGNGGGGGGDSAGPNVVDASTISGRN 194

Query: 195 QVTLKVTIAEVRRDILKQIGFQ---------------HSITGSSSGPSKSFAADFGGKFV 239
            V + V + E  R  +KQ G                  S+  SS  PS            
Sbjct: 195 VVQVDVRVVEFSRSAIKQAGLNLFKSNNGFSFGSFAPSSLQSSSYNPSAGLTVTAVSPIT 254

Query: 240 SEGGDFS-VKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV 298
           S    F+ V G   R      L  LE+    R LA+PTL A+SGQSASF +GG+ +   V
Sbjct: 255 SA---FNLVVGSTSR-GIAGNLSVLEQNNLARILAQPTLVALSGQSASFLAGGE-IPVPV 309

Query: 299 SSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVR 354
             S G  S+    YG+ L  TPTVL P RI L++  E S+      I +N+  +P+   R
Sbjct: 310 PQSLGTISIEYKPYGIGLTVTPTVLGPNRIALKVAPEASQLDFLNAITINSITVPALTTR 369

Query: 355 KADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAA 414
           +ADTTVEL  G + V+ GL+  +       +P L  +PI+GA F++  + + + E+    
Sbjct: 370 RADTTVELGDGESYVIGGLVDRETTSNVSKVPFLGDLPIIGAFFKSLNYQQNDKELVFVV 429

Query: 415 TPFLVKPVA 423
           TP LV P+A
Sbjct: 430 TPHLVSPIA 438


>gi|154250526|ref|YP_001411350.1| type II and III secretion system protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154154476|gb|ABS61693.1| type II and III secretion system protein [Parvibaculum
           lavamentivorans DS-1]
          Length = 461

 Score =  129 bits (325), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 115/393 (29%), Positives = 188/393 (47%), Gaps = 37/393 (9%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           ISIG  +++ L   VD   + +++P+  DV V S R + + G++ G  + + I   G   
Sbjct: 46  ISIGGQRILKLGQTVD--RIAIANPSIVDVKVISSRELRILGQSEGTTD-LDIWFAGGAS 102

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS 169
            +  +++  DI  L+  L R  A ++++       VVL G V +++  QRA E++ ++L 
Sbjct: 103 KSYYVVVGADITGLQSELARDPALADVKATETGKGVVLKGQVYSLEAQQRAREIARSYLG 162

Query: 170 QSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG--FQ---HSITGSSS 224
                       K   ++L +A    V ++V  A V    LK +G  FQ   +S   ++ 
Sbjct: 163 ------------KDAGDMLTVADRRMVAVEVRFAAVSTSTLKALGLNFQSLDNSFQFAAI 210

Query: 225 GPSKSFAADFG---GKFVSEGGDFSVKGVLDRF------SFETVLHALERATAIRTLAEP 275
           GP+ S  + FG   G  +       +    + F      +   V+ AL  A   + LAEP
Sbjct: 211 GPNAS--SSFGYTPGAGLDPDTSLPLSQAFNLFLAWPGSNLLGVISALSSANLAQLLAEP 268

Query: 276 TLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTH--DYGVVLHFTPTVLSPGRIGLRIQ 333
           TL   SG+ A F +GG+       S  G  +VT     +GV L    TVL   RI L++ 
Sbjct: 269 TLLVRSGEDADFLAGGEIPIPVPQSGVGNGTVTIEYKKFGVQLGVAATVLDNDRIVLKVS 328

Query: 334 TEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLS 389
            EVSE      + V    +P+ R R   TT+EL  G + VLAGL+      +++ IP + 
Sbjct: 329 PEVSELDYTNALVVQGFRIPALRTRSTRTTIELGDGQSFVLAGLMYSTSGNIEDRIPGIG 388

Query: 390 KIPILGALFRNSRFNREETEIFIAATPFLVKPV 422
           ++P++G  F+ ++  RE  E+ I ATP LV P+
Sbjct: 389 ELPVIGTFFKRTQNARERQELIIVATPRLVSPM 421


>gi|167587316|ref|ZP_02379704.1| type II and III secretion system protein [Burkholderia ubonensis
           Bu]
          Length = 477

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 120/434 (27%), Positives = 192/434 (44%), Gaps = 77/434 (17%)

Query: 41  DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHS---PRTMYLFGKNVGQA 97
           D+ +G  ++I+ G            +Q V V DP+ ADV++        + L  K  G  
Sbjct: 31  DLAVGSQRQIAAGRA----------LQRVAVGDPSVADVLIMKGSRAGAVLLVAKAPGST 80

Query: 98  NVILI--GHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQ 155
           NV+L   G D   + N++++     A L+         S    +   D  VL G   ++ 
Sbjct: 81  NVMLWERGRDEPMVWNVNVVDAAAHAVLD--------SSTPDAKAYGDVAVLSGSAASLD 132

Query: 156 DSQRAVELSETFLSQ----------------SGRNQYANSSS-------KKVMNLLNIAG 192
             +RA  + +    +                +G+     S +         V++   + G
Sbjct: 133 AHERAAAIGQHMADKGGAAAGGNWGAGDAGATGKRGGGASGTLGKAGKGGAVIDASTVGG 192

Query: 193 EDQVTLKVTIAEVRRDILKQIGFQ------------------HSITGSSSGPSKSFAADF 234
            + V + V + E  R +LK+ G                     SITG+++    +F A  
Sbjct: 193 RNTVQVDVRVVEFSRSVLKEAGLNFFKQSNGFAFGAFTAGGLQSITGAAT---SAFQATA 249

Query: 235 GGKFVSEGGDFS-VKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQH 293
           G    S    F+ V     R  F   L  LE     R LA+PTL A+SGQSASF +GG+ 
Sbjct: 250 GIPVASA---FNLVANSAGRGIFAN-LSILEANNLARVLAQPTLVALSGQSASFLAGGE- 304

Query: 294 LYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMP 349
           +   V  + G+T++    YGV L  TPTVLSP RI L++  E S+      + +N+  +P
Sbjct: 305 IPVPVPQALGSTAIQWKQYGVGLTLTPTVLSPRRIALKVAPESSQLDFLHGVTINSVAVP 364

Query: 350 SYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETE 409
           +   R+ADTTVEL  G + V+ GL+  +       +P+L  +PI+GA F+   + + + E
Sbjct: 365 AITTRRADTTVELGDGESFVIGGLIDRETMSNVNKVPVLGDLPIIGAFFKTLNYQQNDKE 424

Query: 410 IFIAATPFLVKPVA 423
           + I  TP LV P+A
Sbjct: 425 LVIIVTPHLVAPIA 438


>gi|83718419|ref|YP_443059.1| type II/III secretion system protein [Burkholderia thailandensis
           E264]
 gi|167582062|ref|ZP_02374936.1| type II/III secretion system protein [Burkholderia thailandensis
           TXDOH]
 gi|167620224|ref|ZP_02388855.1| type II/III secretion system protein [Burkholderia thailandensis
           Bt4]
 gi|257139289|ref|ZP_05587551.1| type II/III secretion system protein [Burkholderia thailandensis
           E264]
 gi|83652244|gb|ABC36307.1| type II/III secretion system protein [Burkholderia thailandensis
           E264]
          Length = 441

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 127/425 (29%), Positives = 195/425 (45%), Gaps = 62/425 (14%)

Query: 32  ANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVV--HSPRTMYL 89
           A AA +   ++  G  ++I++G            VQ V + DP+ ADVVV       + L
Sbjct: 20  ARAAEMGTIELATGAQRQIAVGRG----------VQRVAIGDPSVADVVVIKGGRGGVLL 69

Query: 90  FGKNVGQANVILI--GHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVL 147
             K  G  N+++   G D   +  +++             R  +   +  V+  + T V+
Sbjct: 70  VAKAAGSTNLMVWERGRDEPSVYTVNVA--------SGAARALLDGGSPSVKAYNGTAVV 121

Query: 148 HGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRR 207
            G   T+    RA+ + +    + G           V++   + G++ V + V + E  R
Sbjct: 122 SGSAATLDAHARALAVGKGMAGKDG----------GVVDASTVGGKNVVQVDVRVVEFSR 171

Query: 208 DILKQIG---FQHSITGSSSGPSKSFAADFGGKFVSEGGDFS---------------VKG 249
            +LKQ G   F+ S  G + G   SFA   G   V+ GG  S               V G
Sbjct: 172 SVLKQAGLNFFKQS-NGFTFG---SFAPA-GLASVTGGGTSSMSVSANIPIASAFNLVVG 226

Query: 250 VLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT 309
              R  F   L  LE     R LA+PTL A+SGQSASF +GG+ +   V  S G  S+  
Sbjct: 227 SATRGLFAD-LSILEANNLARVLAQPTLVALSGQSASFLAGGE-IPVPVPQSLGTISIDW 284

Query: 310 HDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSG 365
             YGV L  TPTVLSP RI L++  E S+      I +N   +P+   R+ADTTVEL  G
Sbjct: 285 KPYGVGLTLTPTVLSPRRIALKVAPESSQLDFVHSITINGVTVPALTTRRADTTVELGDG 344

Query: 366 GTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMR 425
            + V+ GL+  +     + +P L  +PI+G  F++  + + + E+ I  TP LV P+A +
Sbjct: 345 ESFVIGGLIDRETTSNVDKVPFLGDLPIIGTFFKHLSYQQNDKELVIIVTPHLVAPIA-K 403

Query: 426 DLSRP 430
           + S P
Sbjct: 404 NASLP 408


>gi|311107631|ref|YP_003980484.1| type II and III secretion system family protein 2 [Achromobacter
           xylosoxidans A8]
 gi|310762320|gb|ADP17769.1| bacterial type II and III secretion system family protein 2
           [Achromobacter xylosoxidans A8]
          Length = 453

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 89/247 (36%), Positives = 132/247 (53%), Gaps = 17/247 (6%)

Query: 207 RDILKQIGFQHSIT-GSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
           R ++K  G   + + G  SG S +  A  GG   S    FS+    D  +F   L  L+ 
Sbjct: 193 RSVMKAAGISFTASNGPWSGGSSTMPASLGGALAS---GFSL--FYDSNNFSARLRLLQT 247

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSP 325
               R LAEPTL A++GQSASF +GG+ L    +   G  +VT   +G+ L  TPTVLS 
Sbjct: 248 NGMARVLAEPTLVALTGQSASFLAGGE-LPIPQAGGLGTVNVTFKPFGIGLTVTPTVLSR 306

Query: 326 GRIGLRIQTEVSE----PVIGVNAGD-----MPSYRVRKADTTVELPSGGTIVLAGLLKD 376
            RI L++  E SE      I +N        +P+ R R+ADTTVEL  G + V++GL+  
Sbjct: 307 DRISLKVAPEASELDYTNGIAINTSADTSTIIPALRTRRADTTVELGDGESFVISGLVSR 366

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSV 436
             + +   +P+L  +PI+G+ FR+  +++E+TE+ I  TP LV+P+A R ++ P      
Sbjct: 367 QTKAMVNKVPMLGDLPIIGSFFRSVDYSQEDTELVIVVTPRLVRPIA-RGVALPLPGAKQ 425

Query: 437 EDDAKAF 443
           E    AF
Sbjct: 426 EQTDTAF 432


>gi|283779187|ref|YP_003369942.1| type II and III secretion system protein [Pirellula staleyi DSM
           6068]
 gi|283437640|gb|ADB16082.1| type II and III secretion system protein [Pirellula staleyi DSM
           6068]
          Length = 940

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 120/429 (27%), Positives = 189/429 (44%), Gaps = 63/429 (14%)

Query: 64  VDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD-GKQMLNLDILIERDIAH 122
           VD+    V D +  DVV  +PR + + GK+ G  +V     D   Q L   + +E D   
Sbjct: 487 VDIYRTAVVDESICDVVQFTPREVSIIGKSQGATHVTFWFDDPNSQPLTWLVKVEPDAEE 546

Query: 123 ----------LEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS- 171
                     L+  +     DS I + +V+  +++ G  +   DS+ A ++     +Q+ 
Sbjct: 547 VKKEEQTYKLLQDVINEMFPDSKIELVVVASKLIVRGQAK---DSEEAAQIISIIRAQTG 603

Query: 172 -----------------------GRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVR 206
                                    +   NSS  +  V+N+L + G  QV LKV IAE+ 
Sbjct: 604 GQGQNGLGGGQNGLGEGAAADVLSDSATGNSSRSRLQVINMLRVPGVHQVALKVKIAELN 663

Query: 207 R--------DILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFET 258
           R        D+   I F  S  GSS    +S     GG+  +      +   +D    + 
Sbjct: 664 RTAARGFGVDLKTDISFSESEKGSSLL-LESILNMAGGQAPA------LLTQIDGDEIQI 716

Query: 259 VLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT--HDYGVVL 316
            +  L++   ++ LAEPTL  +SG+ A+F +GG+    TV  S G  +VTT    +G ++
Sbjct: 717 GIRYLQQHGVVKLLAEPTLVTLSGRPATFIAGGEFAVPTVVGSAGLNAVTTDFRAFGAII 776

Query: 317 HFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD 376
            F PTV+   RI L +  E S+    +N G  P  RVR A TTVE+  G T+ +AGLL+D
Sbjct: 777 SFMPTVVDKDRIRLEVAPEFSQINQDLNVGGTPGLRVRAATTTVEMREGQTLAIAGLLED 836

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSV 436
           ++     G      +P L  +F      R ETE+ I  +P LV P+   ++  P   + V
Sbjct: 837 NMNGTTIG-----DLPFLAKIFGRRGMQRNETELLILVSPELVHPMEPEEVP-PLPGFDV 890

Query: 437 EDDAKAFFF 445
            +     FF
Sbjct: 891 TEPTNGQFF 899


>gi|283781350|ref|YP_003372105.1| type II and III secretion system protein [Pirellula staleyi DSM
           6068]
 gi|283439803|gb|ADB18245.1| type II and III secretion system protein [Pirellula staleyi DSM
           6068]
          Length = 940

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 125/454 (27%), Positives = 198/454 (43%), Gaps = 79/454 (17%)

Query: 64  VDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHD-GKQMLNLDILIERDIAH 122
           VD+    V D +  DVV  +PR + + GK+ G  +V     D   Q L   + +E D   
Sbjct: 487 VDIYRTAVVDESICDVVQFTPREVSIIGKSQGATHVTFWFDDPNSQPLTWLVKVEPDAEE 546

Query: 123 ----------LEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQS- 171
                     L+  +     DS I + +V+  +++ G  +   DS+ A ++     +Q+ 
Sbjct: 547 VKKEEQTYKLLQDVINEMFPDSKIELVVVASKLIVRGQAK---DSEEAAQIISIIRAQTG 603

Query: 172 -----------------------GRNQYANSSSKK--VMNLLNIAGEDQVTLKVTIAEVR 206
                                    +   NSS  +  V+N+L + G  QV LKV IAE+ 
Sbjct: 604 GQGQNGLGGGQNGLGEGAAADVLSDSATGNSSRSRLQVINMLRVPGVHQVALKVKIAELN 663

Query: 207 R--------DILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFET 258
           R        D+   I F  S  GSS    +S     GG+  +      +   +D    + 
Sbjct: 664 RTAARGFGVDLKTDISFSESEKGSSLL-LESILNMAGGQAPA------LLTQIDGDEIQI 716

Query: 259 VLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT--HDYGVVL 316
            +  L++   ++ LAEPTL  +SG+ A+F +GG+    TV  S G  +VTT    +G ++
Sbjct: 717 GIRYLQQHGVVKLLAEPTLVTLSGRPATFIAGGEFAVPTVVGSAGLNAVTTDFRAFGAII 776

Query: 317 HFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKD 376
            F PTV+   RI L +  E S+    +N G  P  RVR A TTVE+  G T+ +AGLL+D
Sbjct: 777 SFMPTVVDKDRIRLEVAPEFSQINQDLNVGGTPGLRVRAATTTVEMREGQTLAIAGLLED 836

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMR--------DLS 428
           ++     G      +P L  +F      R ETE+ I  +P LV P+           D++
Sbjct: 837 NMNGTTIG-----DLPFLAKIFGRRGMQRNETELLILVSPELVHPMEPEEVPPLPGFDVT 891

Query: 429 RPDD-----HYSVE----DDAKAFFFNRVNKIYG 453
            P +     H  +E     D ++  + R+ K YG
Sbjct: 892 EPTNGQFFLHGDLEGNPTQDYRSTVWPRLRKRYG 925


>gi|170701752|ref|ZP_02892688.1| type II and III secretion system protein [Burkholderia ambifaria
           IOP40-10]
 gi|170133335|gb|EDT01727.1| type II and III secretion system protein [Burkholderia ambifaria
           IOP40-10]
          Length = 444

 Score =  128 bits (321), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 121/423 (28%), Positives = 195/423 (46%), Gaps = 73/423 (17%)

Query: 34  AAVINIS-DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVV----HSPRTMY 88
           AA  N S D+ +G  ++I+ G            +Q + V DP   DV+V    H+  ++ 
Sbjct: 23  AAGTNASIDLAVGSQRQIAAGRT----------LQRIAVGDPAVVDVLVMKGSHA-GSVL 71

Query: 89  LFGKNVGQANVILI--GHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVV 146
           L  K  G  NV+L   G D   + N++++     A L+ T          +V+      V
Sbjct: 72  LVAKAPGSTNVLLWERGRDEPTVWNVNVVDAAAQAALDGT--------GPKVKAYGGAAV 123

Query: 147 LHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVR 206
           L G   ++   +RAV + +    + G           V++   +     V + V + E  
Sbjct: 124 LSGSSASLDAHERAVAVGKRMGGKDG----------TVIDASTVGNRSVVQVDVRVVEFS 173

Query: 207 RDILKQIGFQ------------------HSITGSSSGPSKSFAADFGGKFVSEGGDFSV- 247
           R +LK+ G                     S+TG   G + +FAA  GG  ++   +  V 
Sbjct: 174 RSVLKEAGLNFFKQSNGFAFGAFSPGGLQSVTG---GATSAFAAT-GGIPIASAFNLVVN 229

Query: 248 ---KGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGA 304
              +G+    S       LE     R LA+PTL A+SGQSASF +GG+ +   V  + G+
Sbjct: 230 SAGRGIFGNISI------LEANNLARVLAQPTLVALSGQSASFLAGGE-IPVPVPQALGS 282

Query: 305 TSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTV 360
           T++    YGV L  TPTVLS  RI L++  E S+      + +N+  +P+   R+ADTTV
Sbjct: 283 TAIDWKQYGVGLTLTPTVLSQRRIALKVAPESSQLDFQHGVTINSVSVPAITTRRADTTV 342

Query: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           EL  G + V+ GL+  +       +P+L  +PI+GA F++  + + + E+ I  TP LV 
Sbjct: 343 ELGDGESFVIGGLIDRETMSNISKVPVLGDLPIIGAFFKSLNYQQNDKELVIIVTPHLVA 402

Query: 421 PVA 423
           P+A
Sbjct: 403 PIA 405


>gi|170696786|ref|ZP_02887895.1| type II and III secretion system protein [Burkholderia graminis
           C4D1M]
 gi|170138302|gb|EDT06521.1| type II and III secretion system protein [Burkholderia graminis
           C4D1M]
          Length = 479

 Score =  127 bits (319), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 116/412 (28%), Positives = 185/412 (44%), Gaps = 75/412 (18%)

Query: 66  VQDVLVSDPTKADV-VVHSPRT--MYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAH 122
           ++ V + DP+ ADV ++   +T  + L GK+ G  NV+L        L+  + +    A 
Sbjct: 50  LRRVAIGDPSVADVLIIKGDKTGGVLLIGKSPGTTNVMLWEQGKDAPLSYVVNVSSPAA- 108

Query: 123 LEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQ------------ 170
                +  +      V+++ DT ++ G   T++   RA   +E    Q            
Sbjct: 109 -----KSLLGPGTPSVKVLGDTALITGAAPTMEAHHRAAAAAEIEAHQRAALGGAGGIGT 163

Query: 171 ---------SGRNQYANSSSK--KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ--- 216
                     G N  ANS+S   ++ +   IA    V + V + E  R +LKQ+G     
Sbjct: 164 ADGAKSGANGGPNGSANSASNNAQIYDTSTIATRSVVQVDVRVVEFSRTVLKQVGLNILK 223

Query: 217 ------------HSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFS--FETVLHA 262
                        ++T ++ GP+ SF+              SV  +   F+  F +  H 
Sbjct: 224 QNNGFTFGSFAPSALTSATYGPTPSFS--------------SVAPISSAFNLVFNSATHG 269

Query: 263 L-------ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVV 315
           L       E     R LAEPTL A+SGQSASF +GG+ +   +    G TS+    YGV 
Sbjct: 270 LFADLSLMESNNLARILAEPTLVALSGQSASFLAGGE-IPVPIPQGLGTTSIEYKPYGVG 328

Query: 316 LHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLA 371
           L  TPTVLSP RI L++  E S+      + ++   +P+   R+ DTTVEL  G + V+ 
Sbjct: 329 LTLTPTVLSPQRIALKVAPEASQLDFANAVTISGVSVPAITTRRTDTTVELGDGESFVIG 388

Query: 372 GLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA 423
           GL+  +       +PLL  +P++GA F+   + + + E+ I  TP LV P+A
Sbjct: 389 GLIDRETISNVAKVPLLGDLPVIGAFFKQLNYQQNDKELVIIVTPHLVSPLA 440


>gi|323525746|ref|YP_004227899.1| type II and III secretion system protein [Burkholderia sp.
           CCGE1001]
 gi|323382748|gb|ADX54839.1| type II and III secretion system protein [Burkholderia sp.
           CCGE1001]
          Length = 474

 Score =  127 bits (319), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 114/403 (28%), Positives = 176/403 (43%), Gaps = 59/403 (14%)

Query: 69  VLVSDPTKADV-VVHSPRT--MYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEM 125
           V + DP+ ADV V+   RT  + L GK+ G  NV+L        L+  + +    A    
Sbjct: 44  VAIGDPSVADVLVIRGDRTGGVLLIGKSPGSTNVMLWEQGKDAPLSYVVNVSSPAA---- 99

Query: 126 TLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGR------------ 173
             +  +      V+++ DT ++ G   T++  QRAV  +     Q               
Sbjct: 100 --KSLLGPDTPSVKVLGDTALISGSAPTMEAHQRAVAAAGIEAHQRATLGSAAKGGTGGK 157

Query: 174 ---------------NQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ-- 216
                                S  ++ +   +A    V + V + E  R +LKQ+G    
Sbjct: 158 AGVASALAGADAANGGASGGESGTQIYDSSTVATRSVVQVDVRVVEFSRTVLKQVGLNIL 217

Query: 217 ---HSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFS--FETVLHAL-------E 264
              +  T  S  PS   +A +G          SV  +   F+  F +  H L       E
Sbjct: 218 KQNNGFTFGSFAPSALSSATYGATPTFN----SVAPISSAFNLVFNSATHGLFADLSLME 273

Query: 265 RATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLS 324
                R LAEPTL A+SGQSASF +GG+ +   +    G TS+    YGV L  TPTVLS
Sbjct: 274 SNNLARILAEPTLVALSGQSASFLAGGE-IPVPIPQGLGTTSIEYKPYGVGLTLTPTVLS 332

Query: 325 PGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQ 380
           P RI L++  E S+      + ++   +P+   R+ DTTVEL  G + V+ GL+  +   
Sbjct: 333 PQRIALKVAPEASQLDFANAVTISGVSVPAITTRRTDTTVELGDGESFVIGGLIDRETIS 392

Query: 381 LKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA 423
               +PLL  +P++GA F+   + + + E+ I  TP LV P+A
Sbjct: 393 NVAKVPLLGDLPVIGAFFKQLNYQQNDKELVIIVTPHLVSPLA 435


>gi|115351456|ref|YP_773295.1| type II and III secretion system protein [Burkholderia ambifaria
           AMMD]
 gi|115281444|gb|ABI86961.1| type II and III secretion system protein [Burkholderia ambifaria
           AMMD]
          Length = 444

 Score =  126 bits (316), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 120/423 (28%), Positives = 195/423 (46%), Gaps = 73/423 (17%)

Query: 34  AAVINIS-DVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVV----HSPRTMY 88
           AA  N S D+ +G  ++++ G            +Q + V DP   DV+V    H+  ++ 
Sbjct: 23  AAGTNASIDLAVGSQRQVAAGRT----------LQRIAVGDPAVVDVLVMKGSHA-GSVL 71

Query: 89  LFGKNVGQANVILI--GHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVV 146
           L  K  G  NV+L   G D   + N++++     A L+         S  +V+      V
Sbjct: 72  LVAKAPGSTNVLLWERGRDEPTVWNVNVVDAAAQAALD--------GSAPKVKGYGGAAV 123

Query: 147 LHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVR 206
           L G   ++   +RAV + +    + G           V++   +     V + V + E  
Sbjct: 124 LSGSSASLDAHERAVAVGKRMGGKDG----------TVIDASTVGNRSVVQVDVRVVEFS 173

Query: 207 RDILKQIGFQ------------------HSITGSSSGPSKSFAADFGGKFVSEGGDFSV- 247
           R +LK+ G                     S+TG   G + +FAA  GG  ++   +  V 
Sbjct: 174 RSVLKEAGLNFFKQSNGFAFGAFSPGGLQSVTG---GATSAFAAT-GGIPIASAFNLVVN 229

Query: 248 ---KGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGA 304
              +G+    S       LE     R LA+PTL A+SGQSASF +GG+ +   V  + G+
Sbjct: 230 SAGRGIFGNISI------LEANNLARVLAQPTLVALSGQSASFLAGGE-IPVPVPQALGS 282

Query: 305 TSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTV 360
           T++    YGV L  TPTVLS  RI L++  E S+      + +N+  +P+   R+ADTTV
Sbjct: 283 TAIDWKQYGVGLTLTPTVLSQHRIALKVAPESSQLDFQHGVTINSVSVPAITTRRADTTV 342

Query: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           EL  G + V+ GL+  +       +P+L  +PI+GA F++  + + + E+ I  TP LV 
Sbjct: 343 ELGDGESFVIGGLIDRETMSNISKVPVLGDLPIIGAFFKSLNYQQNDKELVIIVTPHLVA 402

Query: 421 PVA 423
           P+A
Sbjct: 403 PIA 405


>gi|293606490|ref|ZP_06688848.1| roadblock/LC7 domain protein [Achromobacter piechaudii ATCC 43553]
 gi|292815113|gb|EFF74236.1| roadblock/LC7 domain protein [Achromobacter piechaudii ATCC 43553]
          Length = 458

 Score =  126 bits (316), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 87/241 (36%), Positives = 132/241 (54%), Gaps = 23/241 (9%)

Query: 207 RDILKQIGFQHSIT-----GSSSGPSKSFAADFG---GKFVSEGGDFSVKGVLDRFSFET 258
           R ++KQ G   + +     G+S+       A  G   G  ++ G  FS+    D  +F  
Sbjct: 190 RSVMKQAGINFAASNGPWAGTSATAPSGLGAPLGFTPGGIIASG--FSL--FYDSNNFSA 245

Query: 259 VLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHF 318
            L  L+     R LAEPTL A++GQSASF +GG+ L    +   G T+VT   +G+ L  
Sbjct: 246 RLRLLQSNGMARVLAEPTLVALTGQSASFLAGGE-LPIPEAGGLGTTTVTFKPFGIGLTV 304

Query: 319 TPTVLSPGRIGLRIQTEVSE----PVIGVNAGD-----MPSYRVRKADTTVELPSGGTIV 369
           TPTVLS  RI L++  E SE      I +N        +P+ R R+ADTTVEL  G + V
Sbjct: 305 TPTVLSRDRISLKVAPEASELDYSNGIAINTSADTSTIIPALRTRRADTTVELGDGESFV 364

Query: 370 LAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSR 429
           ++GL+    + +   +P+L  +PI+GA FR+  +++E+TE+ I  TP LV+P+A R ++ 
Sbjct: 365 ISGLVSRQTKAMVNKVPMLGDLPIIGAFFRSVDYSQEDTELVIVVTPRLVRPIA-RGVTL 423

Query: 430 P 430
           P
Sbjct: 424 P 424


>gi|322419944|ref|YP_004199167.1| type II and III secretion system protein [Geobacter sp. M18]
 gi|320126331|gb|ADW13891.1| type II and III secretion system protein [Geobacter sp. M18]
          Length = 493

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 115/371 (30%), Positives = 166/371 (44%), Gaps = 49/371 (13%)

Query: 81  VHSPRTMYLFGKNVGQANVILI----GHDGKQMLNLDILIERDIAHLEMTLRRFIADSNI 136
           + S   + L G  +G  ++I+     G +       D+ +  D   +E  L+       I
Sbjct: 116 ILSEYVLKLDGTAIGSTSMIIWTKGEGDERPAPTFFDLKVTGDREAIENQLKEMAPKETI 175

Query: 137 RVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQV 196
            V+  SDTVVL G V   Q   +A E+++ F             + KV+N + +    QV
Sbjct: 176 VVQYASDTVVLSGNVANDQTKTKAFEIAKAF-------------APKVINNMTVNVPQQV 222

Query: 197 TLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEG-------GDFSVKG 249
            L+V +A+V +  LK++G    I GS++    +  A   G     G       GDF    
Sbjct: 223 LLQVKVAQVDKSSLKKLGISFLIKGSTAEGFSNLVAGPDGAVTGIGTGAATGIGDFPS-- 280

Query: 250 VLDRFS---------FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
            LD F             VL AL      + LAEP L   S Q   F +G +     + S
Sbjct: 281 -LDSFQAGVSYFPAGIGAVLSALSSKGLAKVLAEPNLLVRSSQEGYFLAGSKIPIAILES 339

Query: 301 STG--ATSVTTHDYGVVLHFTPTVLSPGRIGLRIQ-TEVSE-----PVIGVNAGDMPSYR 352
           + G   TS+     G+ L F P VL  G I L+I   EVS      PV G      P   
Sbjct: 340 TGGQATTSIRYEPVGIKLKFKPEVLENGMISLKINPAEVSSIQGFLPVNG-----YPIID 394

Query: 353 VRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFI 412
            R  +T+VEL  G +++LAGLL++D  +    IPLL  IPILGALFR+S  + +E E+  
Sbjct: 395 TRTVETSVELKDGESLILAGLLQEDEIKNMSKIPLLGDIPILGALFRSSSSDIKEKELVF 454

Query: 413 AATPFLVKPVA 423
             TP +V+P A
Sbjct: 455 FITPKIVQPTA 465


>gi|317403496|gb|EFV84000.1| hypothetical protein HMPREF0005_03138 [Achromobacter xylosoxidans
           C54]
          Length = 458

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 93/255 (36%), Positives = 132/255 (51%), Gaps = 25/255 (9%)

Query: 207 RDILKQIGFQHSITGSSSGPSKS--------FAADFG-GKFVSEGGDFSVKGVLDRFSFE 257
           R ++KQ G   +     SGP  S        F A  G  K  +    FS+    D   F 
Sbjct: 190 RSVMKQAGISFA---GRSGPWGSTNSITPDGFPAPLGFNKGAALASGFSL--FYDSNDFS 244

Query: 258 TVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLH 317
             L  L+     R LAEPTL A++GQSASF +GG+ L    +   G T+VT   +G+ L 
Sbjct: 245 ARLRLLQNNGMARVLAEPTLVALTGQSASFLAGGE-LPIPEAGGLGTTTVTFKPFGIGLT 303

Query: 318 FTPTVLSPGRIGLRIQTEVSE----PVIGVNAGD-----MPSYRVRKADTTVELPSGGTI 368
            TPTVLS  RI L++  E SE      I V+ G      +P+ R R+ADTTVEL  G + 
Sbjct: 304 VTPTVLSRERIALKVAPEASELDYSNAIAVSNGTNSTTLIPALRTRRADTTVELGDGESF 363

Query: 369 VLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLS 428
           V++GL+    + L   +P+L  +PI+G+ FR+  + +E+TE+ I  TP LV+P+A R ++
Sbjct: 364 VVSGLVSRQTRALVNKVPMLGDLPIIGSFFRSVDYTQEDTELVIVVTPRLVRPIA-RGVT 422

Query: 429 RPDDHYSVEDDAKAF 443
            P      E    AF
Sbjct: 423 LPLPGAKQEAADTAF 437


>gi|190574779|ref|YP_001972624.1| putative exported fimbriae assembly protein [Stenotrophomonas
           maltophilia K279a]
 gi|190012701|emb|CAQ46329.1| putative exported fimbriae assembly protein [Stenotrophomonas
           maltophilia K279a]
          Length = 451

 Score =  125 bits (314), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 129/435 (29%), Positives = 204/435 (46%), Gaps = 66/435 (15%)

Query: 62  VPVDVQDVLVSDPTKADVV-VHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
           +P D++ V ++DP  AD+V +   R   L GK  G   ++L      +   L + ++  +
Sbjct: 46  LPADLERVAIADPGVADIVMLRGQRQALLVGKAPGTTTLLLWHRKQAEPQRLQVRVQSAV 105

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELS-ETFLSQSGRNQYANS 179
                   +  AD+             +G+V T QD+Q  ++ S ++ LS     + A  
Sbjct: 106 --------QGAADAGS-----------NGLVFTQQDNQGLLQGSTDSVLSHMQEQKTAAM 146

Query: 180 SSKK---VMNLLNIAGEDQVTLKVTIAEVRRDILKQIG--FQHSITGSSSGPSKSFAADF 234
           +  K   + +   ++    V ++V + E  +  LKQIG  FQ+         + SFA  F
Sbjct: 147 ALGKDGLLADASTVSSGGVVQVEVKVVEFNKTALKQIGISFQNR--------NGSFAYGF 198

Query: 235 ---GGKF---------VSEG--GDFSVKGVLDRF-----SFETVLHA----LERATAIRT 271
              GG+          + EG  G+ +   +   F     S + + +A    L+     R 
Sbjct: 199 ARPGGQLPGNTGILPGMKEGNSGNEAESPISSAFRLVFGSTKGLWNADVDLLQSNGMARV 258

Query: 272 LAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLR 331
           LAEPTL A+SGQSASF +GG+ L        G T++T   +G+ L  TPTVL+P RI L+
Sbjct: 259 LAEPTLVALSGQSASFLAGGE-LPILEPQGLGTTTITYKPFGIGLTVTPTVLAPNRIALK 317

Query: 332 IQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPL 387
           +  E S+      I +N   +PS   R+ADTTVEL  G + V+ GL+  ++      IPL
Sbjct: 318 VAPEASDLDYSNAIALNGVQIPSITTRRADTTVELGDGESFVIGGLVSSNVVSNVGKIPL 377

Query: 388 LSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNR 447
           L  +PI+G+ FRN  + R++ E+ I  TP LV+P+A R+   P      E +AK      
Sbjct: 378 LGDLPIIGSFFRNFDYKRQDKELVIIVTPRLVQPLA-RNTELP---LPGEREAKPHMPEW 433

Query: 448 VNKIYGPKEASEVEG 462
              + GP     V G
Sbjct: 434 GAWLLGPISQDPVPG 448


>gi|194366097|ref|YP_002028707.1| type II and III secretion system protein [Stenotrophomonas
           maltophilia R551-3]
 gi|194348901|gb|ACF52024.1| type II and III secretion system protein [Stenotrophomonas
           maltophilia R551-3]
          Length = 452

 Score =  125 bits (314), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 128/428 (29%), Positives = 198/428 (46%), Gaps = 52/428 (12%)

Query: 62  VPVDVQDVLVSDPTKADVV-VHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
           +P D++ V ++DP  AD+V +   R   L GK  G   ++L      +   + + ++   
Sbjct: 47  LPADLERVAIADPGVADIVMLRGQRQALLVGKAPGTTTLLLWHRKQAEPQRMQVRVQS-- 104

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELS-ETFLSQSGRNQYANS 179
                            V+  +DT    G+V T QD+Q  ++ S ++ LS     + A  
Sbjct: 105 ----------------AVQGAADTGS-GGLVFTQQDNQGLLQGSTDSVLSHMQEQRTAAM 147

Query: 180 SSKKVMNLLN---IAGEDQVTLKVTIAEVRRDILKQIG--FQHSITGSSSG---PSKSFA 231
           +  K   L +   I+    V ++V + E  +  LKQIG  FQ+     + G   P     
Sbjct: 148 ALGKDGTLADTSTISSGGVVQVEVKVVEFNKTALKQIGISFQNRNGNFAYGFARPGGQLP 207

Query: 232 ADFG---GKFVSEGGDFSVKGVLDRF-----SFETVLHA----LERATAIRTLAEPTLTA 279
            + G   G      G+ +   +   F     S + + +A    L+     R LAEPTL A
Sbjct: 208 GNTGILPGMKEGNSGNEAESPISSAFRLVFGSTKGLWNADVDLLQSNGMARVLAEPTLVA 267

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE- 338
           +SGQSASF +GG+ L        G T++T   +G+ L  TPTVL+P RI L++  E S+ 
Sbjct: 268 LSGQSASFLAGGE-LPILEPQGLGTTTITYKPFGIGLTVTPTVLAPNRIALKVAPEASDL 326

Query: 339 ---PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILG 395
                I +N   +PS   R+ADTTVEL  G + V+ GL+  ++      IPLL  +PI+G
Sbjct: 327 DYSNAIALNGVQIPSITTRRADTTVELGDGESFVIGGLVSSNVVSSVGKIPLLGDLPIIG 386

Query: 396 ALFRNSRFNREETEIFIAATPFLVKPVAMR-DLSRPDDHYSVEDDAKAFFFNRVNKIYGP 454
           + FRN  + R++ E+ I  TP LVKP+A   +L  P D      +AK         + GP
Sbjct: 387 SFFRNFDYKRQDKELVIIVTPRLVKPLARNTELPLPGDR-----EAKPHMPEWGAWLLGP 441

Query: 455 KEASEVEG 462
                V G
Sbjct: 442 ISQDPVPG 449


>gi|307944371|ref|ZP_07659712.1| putative type III secretion component [Roseibium sp. TrichSKD4]
 gi|307772717|gb|EFO31937.1| putative type III secretion component [Roseibium sp. TrichSKD4]
          Length = 411

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 105/385 (27%), Positives = 179/385 (46%), Gaps = 24/385 (6%)

Query: 58  IILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIE 117
           I+L+    V  V +     A+V   + + +Y+ G   G  N++++ +D   + +  I++ 
Sbjct: 31  ILLRFNEPVASVFIGSNEIAEVQAVNEKAIYVSGLTAGTTNLLVMNYDNDIIRSHAIVVH 90

Query: 118 RDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYA 177
                    L   I + ++ V+   +T ++ G V  I D+    E+ +T L + GR    
Sbjct: 91  PVNNETSYLLENLIPNGDVTVQSSGNTSIIRGNVDNIDDADDIREV-KTRLEEQGR---- 145

Query: 178 NSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG--------SSSGPSKS 229
                KV++    +   QV+LKV I E+ R  L ++GF  S           + SG ++ 
Sbjct: 146 -----KVIDKTTTSTPVQVSLKVRIVELYRADLIKLGFDVSSVSSGSVFKVVTGSGIAQD 200

Query: 230 FAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTS 289
           F +   G  V       + G  + F+   +L  LE+   I+ LAEP LT ++G+ A+F S
Sbjct: 201 FMSTLIGS-VEGQTRVGISGANNSFNVNAMLDLLEKRGYIQILAEPRLTTVTGEKATFRS 259

Query: 290 GGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--EPVIGVNAGD 347
           GG+    +V+   G  +    + G+ + F P +L   +I + I +E+   +P   VN+  
Sbjct: 260 GGEFAV-SVNQGNGVFTAEYKETGISIDFIPEILPGDKISIDISSEIKFVDPQSVVNSA- 317

Query: 348 MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREE 407
            P+  VR   T  ++ SG T  LAGL +      K G P LSKIP+ G L   +  +REE
Sbjct: 318 -PALLVRSVQTNAQVASGQTFALAGLYQLTQSSSKSGPPYLSKIPVFGNLLSKTNESREE 376

Query: 408 TEIFIAATPFLVKPVAMRDLSRPDD 432
            E+    TP+LV      +  +P D
Sbjct: 377 RELIFFITPYLVHSSVPIEKKQPTD 401


>gi|167911136|ref|ZP_02498227.1| type II/III secretion system protein [Burkholderia pseudomallei
           112]
          Length = 432

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 119/390 (30%), Positives = 182/390 (46%), Gaps = 50/390 (12%)

Query: 66  VQDVLVSDPTKADV-VVHSPRT-MYLFGKNVGQANVILI--GHDGKQMLNLDILIERDIA 121
           VQ V ++DP  ADV V+   R  + L  K  G  ++++   G D      ++++      
Sbjct: 35  VQRVAIADPNVADVLVIKGGRGGVLLVAKAAGTTSLMVWERGRDEPAAYTVNVV------ 88

Query: 122 HLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSS 181
                 R  +   +  V+  + T V+ G   T+    RA+ + +    + G         
Sbjct: 89  --SGAARALLDGGSPSVKAYNGTAVVAGSAATLDAHARALAVGKGMAGKDG--------- 137

Query: 182 KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG--FQHSITGSSSGPSKSFAADFGGKFV 239
             V+++  + G++ V + V + E  R +LKQ G  F     G + G   SFA   G   V
Sbjct: 138 -GVLDVSTVGGKNVVQVDVRVVEFSRSVLKQAGLNFFKQNNGFTFG---SFAPA-GLASV 192

Query: 240 SEGGDFS---------------VKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
           + GG  S               V G   R  F   L  LE     R LA+PTL A+SGQS
Sbjct: 193 TGGGTSSMSVSANIPIASAFNLVVGSATRGLFAD-LSILEANNLARVLAQPTLVALSGQS 251

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PV 340
           ASF +GG+ +   V  S G  S+    YGV L  TPTVLSP RI L++  E S+      
Sbjct: 252 ASFLAGGE-IPVPVPQSLGTISIDWKPYGVGLTLTPTVLSPRRIALKVAPESSQLDFVHS 310

Query: 341 IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
           I +N   +P+   R+ADTTVEL  G + V+ GL+  +     + +P L  +PI+G  F++
Sbjct: 311 ITINGVTVPALTTRRADTTVELGDGESFVIGGLIDRETTSNVDKVPFLGDLPIIGTFFKH 370

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSRP 430
             + + + E+ I  TP LV P+A ++ S P
Sbjct: 371 LSYQQNDKELVIIVTPHLVAPIA-KNASLP 399


>gi|297568753|ref|YP_003690097.1| type II and III secretion system protein [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296924668|gb|ADH85478.1| type II and III secretion system protein [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 406

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 83/261 (31%), Positives = 132/261 (50%), Gaps = 23/261 (8%)

Query: 195 QVTLKVTIAEVRRDILKQIGFQ-----HSITGSSSGPS-----------KSFAADFGGKF 238
           QV   + + EV R  L+Q G        SIT +++ P               A+D G  F
Sbjct: 117 QVRADIRVVEVSRRALRQSGVNLLKDSDSITVATTAPGVLTGIDNQAAGLPLASDSG--F 174

Query: 239 VSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV 298
           V     F++     +     ++  LE      TLAEP+LT +SG++ASF +GG+      
Sbjct: 175 VPLAQAFNLVAGDAKQRLLGIISLLESNGFAYTLAEPSLTVMSGKTASFLAGGEVPIPVS 234

Query: 299 SSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVR 354
             ++G+ S+   D+GV L  TPTVL P RI + +  EVSE      +      +P +RVR
Sbjct: 235 HGTSGSVSIEYRDFGVRLQLTPTVLDPRRITIEVSPEVSELDFSAAVSTAGVTVPGFRVR 294

Query: 355 KADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAA 414
           + +TTV+L  G + V++GL+ ++     E +P L  +PILGA F+++R    + E+ +  
Sbjct: 295 RTETTVQLADGESFVISGLISNENASTVEKVPFLGSLPILGAFFKSTRLQSNDKELIMVV 354

Query: 415 TPFLVKPVAM-RDLSRPDDHY 434
           TP LV+P+     +  P +HY
Sbjct: 355 TPHLVRPLERGAQVPLPGEHY 375


>gi|149173675|ref|ZP_01852304.1| probable type II secretion system protein [Planctomyces maris DSM
           8797]
 gi|148847205|gb|EDL61539.1| probable type II secretion system protein [Planctomyces maris DSM
           8797]
          Length = 744

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 91/257 (35%), Positives = 139/257 (54%), Gaps = 20/257 (7%)

Query: 172 GRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFA 231
           G N YA+S    ++N+L I GE QV + VTIA++ R +++Q+G   S+            
Sbjct: 311 GNNGYASSF---IVNMLEIPGEFQVMIHVTIAQMNRTMMRQLGVDLSVL----------- 356

Query: 232 ADFGGKFV--SEGG-DFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
            D G +F+  S GG   ++ G+ +      +++AL +    + +A PTLT +SG SASF 
Sbjct: 357 FDGGRQFLGSSMGGVPSTLTGIFEAGEVNVLINALAQNGTTKIMARPTLTVLSGHSASFL 416

Query: 289 SGGQHLYKTVSSSTGA--TSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAG 346
           +GG+    T+    GA  TS T   +G  +  TP V+    I +RI  E S+   G +  
Sbjct: 417 AGGEFAVPTIVGVGGAQGTSTTFRGFGTSIVVTPIVIDKDLIRMRIVPEYSQINDGNSVQ 476

Query: 347 DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA-LFRNSRFNR 405
            +P    R+A TTVEL  G TIVLAGL   D       IP L +IP++G+ LF + + ++
Sbjct: 477 GIPGLNSRRAQTTVELREGQTIVLAGLFGHDSSTGVTRIPWLGEIPLVGSYLFSSKQSSQ 536

Query: 406 EETEIFIAATPFLVKPV 422
            E+E+ I  TP LV+P+
Sbjct: 537 GESELLITVTPQLVRPM 553


>gi|332284569|ref|YP_004416480.1| putative outer membrane protein [Pusillimonas sp. T7-7]
 gi|330428522|gb|AEC19856.1| putative outer membrane protein [Pusillimonas sp. T7-7]
          Length = 474

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 109/384 (28%), Positives = 183/384 (47%), Gaps = 32/384 (8%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +++ + +V +L +P DV  V V D    + V    + + +F ++ G   + +   DG++ 
Sbjct: 28  LNLQVGEVKVLGIP-DVARVAVGDGHIINAVATDEKEVIVFARHEGSTALQIWSADGQRW 86

Query: 110 LNLDILIERDIAHLEMTLRRFIAD-SNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
                +    +  ++  LR  +    + ++  V D +V+ G   +  D +R  EL++ + 
Sbjct: 87  QYQIEVAPEGLRQIQQELRSVLERIPHAQLSAVGDKLVIEGDDLSDGDRERIAELAKHY- 145

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQ-VTLKVTIAEVRRDILKQIGFQHSITGSSSGPS 227
                         ++++     G D+ V L V + EV R  L+++G + + T +  G S
Sbjct: 146 -------------PQLLDFTGQVGWDRMVLLDVQVVEVPRIQLQELGLRWN-TATDGGLS 191

Query: 228 KSFAADFGGKFVSEGGDFSVKGV-------LDRFSFETVLHA-----LERATAIRTLAEP 275
              A D G K + +    SV  +          F    +L A      ++ TA+  LA+P
Sbjct: 192 AGLAWDGGSKRLDDRPSESVMPIGFPATMAAGYFGVNALLSARINAMAQKGTAV-VLAQP 250

Query: 276 TLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTE 335
            L A SG +A F +GG+  Y TV ++ G T+     YGV L  TP +   G +  RI+ E
Sbjct: 251 QLLARSGSTAEFLAGGEVPYSTVDAN-GNTNTAFKPYGVSLRITPQIERNGAVRSRIEVE 309

Query: 336 VSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILG 395
           VS     ++  + PS + R+A T   + SG T+VLAG L  +     + +P L  IPILG
Sbjct: 310 VSSVDNALSVPNGPSLKTRRAATEFNVRSGQTLVLAGFLSREATHNVDKVPGLGDIPILG 369

Query: 396 ALFRNSRFNREETEIFIAATPFLV 419
            LF++SRF R ETE+ I  TP LV
Sbjct: 370 ELFKSSRFQRHETELAIFVTPVLV 393


>gi|116620532|ref|YP_822688.1| type II and III secretion system protein [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116223694|gb|ABJ82403.1| type II and III secretion system protein [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 529

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 104/401 (25%), Positives = 185/401 (46%), Gaps = 35/401 (8%)

Query: 41  DVEIGKGK-KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANV 99
           DV+   G  K+ + + K +I+  P+++Q + V++    + V  +P+ + + GK  G+  +
Sbjct: 53  DVQPAPGPGKLMVTVGKSLIIDSPMNIQRISVANGELIEAVAVNPKEVLINGKAAGETTL 112

Query: 100 ILIGHDGKQMLNLDILIERDIAHLEMT---LRRFIADSNIRVEMVSDTVVLHGMVRTIQD 156
           I+    G ++L  D+ +      L++    L R   D  I V   ++   + G V+ +  
Sbjct: 113 IIWQQGGNRLL-YDLTVRISPVRLDVVRQQLARDFPDDEINVTYDNEVAFVRGRVKDLSA 171

Query: 157 SQRAVELSETFLSQSGRNQYANSSSKKVMNLLNI---AGEDQVTLKVTIAEVRRDILKQI 213
           + R + ++              +S  K +NLL +     E Q+ L V  A V R     +
Sbjct: 172 ADRVMAIA--------------ASLGKTVNLLRVDVPPVETQILLHVRFANVDRGASTDL 217

Query: 214 GFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFE------TVLHALERAT 267
           G   + TG+ +  +      +    V   G  S+   L+   F         + ALE   
Sbjct: 218 GVSLA-TGAFNQSTAITTGQYPPPTVGTDGRVSISDALNILLFRKDINLGATIKALESKR 276

Query: 268 AIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS--TGATSVTTHDYGVVLHFTPTVLSP 325
            + TLAEP + AI+G+ A+F +GG+     V      GA S+T  ++G+ ++F P +   
Sbjct: 277 MLETLAEPNVMAINGKPAAFIAGGEFPVPMVQGGGLAGAVSITFREFGIRINFLPKITPR 336

Query: 326 GRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQL 381
           G I L +  EVS       +      +P+   R+  T VEL +G + V+AGLL +   + 
Sbjct: 337 GTIQLAVAPEVSSLDYSNAVTFQGYTIPALATRRIQTEVELETGQSFVIAGLLDNRTTET 396

Query: 382 KEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPV 422
              IP LS IP+LG LF++    +  TE+ +  TP +V+P+
Sbjct: 397 LNKIPGLSNIPLLGKLFQSRAVAKNNTELMVIVTPEIVRPI 437


>gi|53719509|ref|YP_108495.1| putative exported fimbriae assembly protein [Burkholderia
           pseudomallei K96243]
 gi|76808601|ref|YP_333341.1| type II/III secretion system protein [Burkholderia pseudomallei
           1710b]
 gi|121598954|ref|YP_993098.1| type II/III secretion system protein [Burkholderia mallei SAVP1]
 gi|124383520|ref|YP_001026125.1| type II/III secretion system protein [Burkholderia mallei NCTC
           10229]
 gi|126440403|ref|YP_001058807.1| type II/III secretion system protein [Burkholderia pseudomallei
           668]
 gi|134282202|ref|ZP_01768907.1| type II/III secretion system protein [Burkholderia pseudomallei
           305]
 gi|167002482|ref|ZP_02268272.1| type II/III secretion system protein [Burkholderia mallei PRL-20]
 gi|167719788|ref|ZP_02403024.1| type II/III secretion system protein [Burkholderia pseudomallei
           DM98]
 gi|167738786|ref|ZP_02411560.1| type II/III secretion system protein [Burkholderia pseudomallei 14]
 gi|167816009|ref|ZP_02447689.1| type II/III secretion system protein [Burkholderia pseudomallei 91]
 gi|167845916|ref|ZP_02471424.1| type II/III secretion system protein [Burkholderia pseudomallei
           B7210]
 gi|167894492|ref|ZP_02481894.1| type II/III secretion system protein [Burkholderia pseudomallei
           7894]
 gi|167902899|ref|ZP_02490104.1| type II/III secretion system protein [Burkholderia pseudomallei
           NCTC 13177]
 gi|237812067|ref|YP_002896518.1| bacterial type II/III secretion system protein [Burkholderia
           pseudomallei MSHR346]
 gi|238562618|ref|ZP_00440075.2| bacterial type II/III secretion system protein [Burkholderia mallei
           GB8 horse 4]
 gi|242315526|ref|ZP_04814542.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106b]
 gi|254177827|ref|ZP_04884482.1| type II/III secretion system protein [Burkholderia mallei ATCC
           10399]
 gi|254179957|ref|ZP_04886556.1| type II/III secretion system protein [Burkholderia pseudomallei
           1655]
 gi|254188633|ref|ZP_04895144.1| type II/III secretion system protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254198005|ref|ZP_04904427.1| type II/III secretion system protein [Burkholderia pseudomallei
           S13]
 gi|254260610|ref|ZP_04951664.1| type II/III secretion system protein [Burkholderia pseudomallei
           1710a]
 gi|254358355|ref|ZP_04974628.1| type II/III secretion system protein [Burkholderia mallei
           2002721280]
 gi|52209923|emb|CAH35895.1| putative exported fimbriae assembly protein [Burkholderia
           pseudomallei K96243]
 gi|76578054|gb|ABA47529.1| type II/III secretion system protein [Burkholderia pseudomallei
           1710b]
 gi|121227764|gb|ABM50282.1| type II/III secretion system protein [Burkholderia mallei SAVP1]
 gi|124291540|gb|ABN00809.1| type II/III secretion system protein [Burkholderia mallei NCTC
           10229]
 gi|126219896|gb|ABN83402.1| type II/III secretion system protein [Burkholderia pseudomallei
           668]
 gi|134246240|gb|EBA46329.1| type II/III secretion system protein [Burkholderia pseudomallei
           305]
 gi|148027482|gb|EDK85503.1| type II/III secretion system protein [Burkholderia mallei
           2002721280]
 gi|157936312|gb|EDO91982.1| type II/III secretion system protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160698866|gb|EDP88836.1| type II/III secretion system protein [Burkholderia mallei ATCC
           10399]
 gi|169654746|gb|EDS87439.1| type II/III secretion system protein [Burkholderia pseudomallei
           S13]
 gi|184210497|gb|EDU07540.1| type II/III secretion system protein [Burkholderia pseudomallei
           1655]
 gi|237503987|gb|ACQ96305.1| bacterial type II/III secretion system protein [Burkholderia
           pseudomallei MSHR346]
 gi|238522203|gb|EEP85649.1| bacterial type II/III secretion system protein [Burkholderia mallei
           GB8 horse 4]
 gi|242138765|gb|EES25167.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106b]
 gi|243061822|gb|EES44008.1| type II/III secretion system protein [Burkholderia mallei PRL-20]
 gi|254219299|gb|EET08683.1| type II/III secretion system protein [Burkholderia pseudomallei
           1710a]
          Length = 441

 Score =  124 bits (310), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 118/390 (30%), Positives = 181/390 (46%), Gaps = 50/390 (12%)

Query: 66  VQDVLVSDPTKADV-VVHSPRT-MYLFGKNVGQANVILI--GHDGKQMLNLDILIERDIA 121
           VQ V ++DP  ADV V+   R  + L  K  G  ++++   G D      ++++      
Sbjct: 44  VQRVAIADPNVADVLVIKGGRGGVLLVAKAAGTTSLMVWERGRDEPAAYTVNVV------ 97

Query: 122 HLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSS 181
                 R  +   +  V+  + T V+ G   T+    RA+ + +    + G         
Sbjct: 98  --SGAARALLDGGSPSVKAYNGTAVVAGSAATLDAHARALAVGKGMAGKDG--------- 146

Query: 182 KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG--FQHSITGSSSGPSKSFAADFGGKFV 239
             V+++  + G++ V + V + E  R +LKQ G  F     G + G   SFA   G   V
Sbjct: 147 -GVLDVSTVGGKNVVQVDVRVVEFSRSVLKQAGLNFFKQNNGFTFG---SFAPA-GLASV 201

Query: 240 SEGGDFS---------------VKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
           + GG  S               V G   R  F   L  LE     R LA+PTL A+SGQS
Sbjct: 202 TGGGTSSMSVSANIPIASAFNLVVGSATRGLFAD-LSILEANNLARVLAQPTLVALSGQS 260

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PV 340
           ASF +GG+ +   V  S G  S+    YGV L  TPTVLSP RI L++  E S+      
Sbjct: 261 ASFLAGGE-IPVPVPQSLGTISIDWKPYGVGLTLTPTVLSPRRIALKVAPESSQLDFVHS 319

Query: 341 IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
           I +N   +P+   R+ADTTVEL  G +  + GL+  +     + +P L  +PI+G  F++
Sbjct: 320 ITINGVTVPALTTRRADTTVELGDGESFAIGGLIDRETTSNVDKVPFLGDLPIIGTFFKH 379

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSRP 430
             + + + E+ I  TP LV P+A ++ S P
Sbjct: 380 LSYQQNDKELVIIVTPHLVAPIA-KNASLP 408


>gi|167919159|ref|ZP_02506250.1| type II/III secretion system protein [Burkholderia pseudomallei
           BCC215]
          Length = 432

 Score =  124 bits (310), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 118/390 (30%), Positives = 181/390 (46%), Gaps = 50/390 (12%)

Query: 66  VQDVLVSDPTKADV-VVHSPRT-MYLFGKNVGQANVILI--GHDGKQMLNLDILIERDIA 121
           VQ V ++DP  ADV V+   R  + L  K  G  ++++   G D      ++++      
Sbjct: 35  VQRVAIADPNVADVLVIKGGRGGVLLVAKAAGTTSLMVWERGRDEPAAYTVNVV------ 88

Query: 122 HLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSS 181
                 R  +   +  V+  + T V+ G   T+    RA+ + +    + G         
Sbjct: 89  --SGAARALLDGGSPSVKAYNGTAVVAGSAATLDAHARALAVGKGMAGKDG--------- 137

Query: 182 KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG--FQHSITGSSSGPSKSFAADFGGKFV 239
             V+++  + G++ V + V + E  R +LKQ G  F     G + G   SFA   G   V
Sbjct: 138 -GVLDVSTVGGKNVVQVDVRVVEFSRSVLKQAGLNFFKQNNGFTFG---SFAPA-GLASV 192

Query: 240 SEGGDFS---------------VKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
           + GG  S               V G   R  F   L  LE     R LA+PTL A+SGQS
Sbjct: 193 TGGGTSSMSVSANIPIASAFNLVVGSATRGLFAD-LSILEANNLARVLAQPTLVALSGQS 251

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PV 340
           ASF +GG+ +   V  S G  S+    YGV L  TPTVLSP RI L++  E S+      
Sbjct: 252 ASFLAGGE-IPVPVPQSLGTISIDWKPYGVGLTLTPTVLSPRRIALKVAPESSQLDFVHS 310

Query: 341 IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
           I +N   +P+   R+ADTTVEL  G +  + GL+  +     + +P L  +PI+G  F++
Sbjct: 311 ITINGVTVPALTTRRADTTVELGDGESFAIGGLIDRETTSNVDKVPFLGDLPIIGTFFKH 370

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSRP 430
             + + + E+ I  TP LV P+A ++ S P
Sbjct: 371 LSYQQNDKELVIIVTPHLVAPIA-KNASLP 399


>gi|53723520|ref|YP_102954.1| type II/III secretion system protein [Burkholderia mallei ATCC
           23344]
 gi|126448299|ref|YP_001080603.1| type II/III secretion system protein [Burkholderia mallei NCTC
           10247]
 gi|126452556|ref|YP_001066058.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106a]
 gi|167824385|ref|ZP_02455856.1| type II/III secretion system protein [Burkholderia pseudomallei 9]
 gi|217423417|ref|ZP_03454918.1| type II/III secretion system protein [Burkholderia pseudomallei
           576]
 gi|226199666|ref|ZP_03795219.1| type II/III secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|254199896|ref|ZP_04906262.1| type II/III secretion system protein [Burkholderia mallei FMH]
 gi|254206228|ref|ZP_04912580.1| type II/III secretion system protein [Burkholderia mallei JHU]
 gi|254297793|ref|ZP_04965246.1| type II/III secretion system protein [Burkholderia pseudomallei
           406e]
 gi|52426943|gb|AAU47536.1| type II/III secretion system protein [Burkholderia mallei ATCC
           23344]
 gi|126226198|gb|ABN89738.1| type II/III secretion system protein [Burkholderia pseudomallei
           1106a]
 gi|126241169|gb|ABO04262.1| type II/III secretion system protein [Burkholderia mallei NCTC
           10247]
 gi|147749492|gb|EDK56566.1| type II/III secretion system protein [Burkholderia mallei FMH]
 gi|147753671|gb|EDK60736.1| type II/III secretion system protein [Burkholderia mallei JHU]
 gi|157807445|gb|EDO84615.1| type II/III secretion system protein [Burkholderia pseudomallei
           406e]
 gi|217393275|gb|EEC33296.1| type II/III secretion system protein [Burkholderia pseudomallei
           576]
 gi|225928252|gb|EEH24286.1| type II/III secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
          Length = 432

 Score =  123 bits (309), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 118/390 (30%), Positives = 181/390 (46%), Gaps = 50/390 (12%)

Query: 66  VQDVLVSDPTKADV-VVHSPRT-MYLFGKNVGQANVILI--GHDGKQMLNLDILIERDIA 121
           VQ V ++DP  ADV V+   R  + L  K  G  ++++   G D      ++++      
Sbjct: 35  VQRVAIADPNVADVLVIKGGRGGVLLVAKAAGTTSLMVWERGRDEPAAYTVNVV------ 88

Query: 122 HLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSS 181
                 R  +   +  V+  + T V+ G   T+    RA+ + +    + G         
Sbjct: 89  --SGAARALLDGGSPSVKAYNGTAVVAGSAATLDAHARALAVGKGMAGKDG--------- 137

Query: 182 KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG--FQHSITGSSSGPSKSFAADFGGKFV 239
             V+++  + G++ V + V + E  R +LKQ G  F     G + G   SFA   G   V
Sbjct: 138 -GVLDVSTVGGKNVVQVDVRVVEFSRSVLKQAGLNFFKQNNGFTFG---SFAPA-GLASV 192

Query: 240 SEGGDFS---------------VKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
           + GG  S               V G   R  F   L  LE     R LA+PTL A+SGQS
Sbjct: 193 TGGGTSSMSVSANIPIASAFNLVVGSATRGLFAD-LSILEANNLARVLAQPTLVALSGQS 251

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PV 340
           ASF +GG+ +   V  S G  S+    YGV L  TPTVLSP RI L++  E S+      
Sbjct: 252 ASFLAGGE-IPVPVPQSLGTISIDWKPYGVGLTLTPTVLSPRRIALKVAPESSQLDFVHS 310

Query: 341 IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
           I +N   +P+   R+ADTTVEL  G +  + GL+  +     + +P L  +PI+G  F++
Sbjct: 311 ITINGVTVPALTTRRADTTVELGDGESFAIGGLIDRETTSNVDKVPFLGDLPIIGTFFKH 370

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSRP 430
             + + + E+ I  TP LV P+A ++ S P
Sbjct: 371 LSYQQNDKELVIIVTPHLVAPIA-KNASLP 399


>gi|254523433|ref|ZP_05135488.1| type II and III secretion system protein:Transport-associated
           [Stenotrophomonas sp. SKA14]
 gi|219721024|gb|EED39549.1| type II and III secretion system protein:Transport-associated
           [Stenotrophomonas sp. SKA14]
          Length = 433

 Score =  122 bits (307), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 116/388 (29%), Positives = 186/388 (47%), Gaps = 46/388 (11%)

Query: 62  VPVDVQDVLVSDPTKADVV-VHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
           +P D++ V ++DP  AD+V +   R   L GK  G   ++L      +   + + ++  +
Sbjct: 28  LPADLERVAIADPGVADIVMLRGQRQALLVGKAPGTTTLLLWHRKQAEPQRVQVRVQSAV 87

Query: 121 AHLEMT----LRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQY 176
                T    L     D    ++  +D+V+ H     +Q+ Q A       ++     Q 
Sbjct: 88  QGAANTGTSGLLFTQQDQQGLLQGSTDSVLAH-----MQEQQTAA------MALGKEGQL 136

Query: 177 ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG--FQHSITGSSSG---PSKSFA 231
           A++S+        ++    V ++V + E  +  LKQIG  FQ+     + G   P     
Sbjct: 137 ADAST--------VSSGGVVQVEVKVVEFNKTALKQIGISFQNRNGSFAYGIARPGGQLP 188

Query: 232 ADFG---GKFVSEGGDFSVKGVLDRF-----SFETVLHA----LERATAIRTLAEPTLTA 279
            + G   G    E G+ S   +   F     S + + +A    L+     R LAEPTL A
Sbjct: 189 GNTGILPGMKEGESGNESTSPISSAFRLVFGSTKGLWNADVDLLQSNGMARVLAEPTLVA 248

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE- 338
           +SGQSASF +GG+ L        G T++T   +G+ L  TPTVL+P RI L++  E S+ 
Sbjct: 249 LSGQSASFLAGGE-LPILEPQGLGTTTITYKPFGIGLTVTPTVLAPNRIALKVAPEASDL 307

Query: 339 ---PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILG 395
                I +N   +PS   R+ADTTVEL  G + V+ GL+  ++      IPLL  +PI+G
Sbjct: 308 DYSNSIALNGVQIPSITTRRADTTVELGDGESFVIGGLVSSNVVSSVNKIPLLGDLPIIG 367

Query: 396 ALFRNSRFNREETEIFIAATPFLVKPVA 423
           + FRN  + R++ E+ I  TP LV+P+A
Sbjct: 368 SFFRNFDYKRQDKELVIIVTPRLVQPLA 395


>gi|114321311|ref|YP_742994.1| type II and III secretion system protein [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114227705|gb|ABI57504.1| type II and III secretion system protein [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 428

 Score =  122 bits (307), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 88/254 (34%), Positives = 133/254 (52%), Gaps = 21/254 (8%)

Query: 195 QVTLKVTIAEVRRDILKQIG-----------FQHSITGSSSG---PSKSFAADFGGKFVS 240
           QV   + + EV R  L+++G           F     GS SG   P     A+ G     
Sbjct: 139 QVQADIRLVEVSRSKLREMGGSILGRRGSANFLFGGPGSVSGSVAPGGVGDANVGLPASD 198

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
            G +    G   RF   ++++ALE      TLAEP+L A+SGQSA+F +GG+      SS
Sbjct: 199 SGFNIFYGGGGSRFL--SMINALEANDFAYTLAEPSLVALSGQSATFHAGGEFPVPVPSS 256

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKA 356
            +   ++   ++GV + FTPTV+   R+ L++  EVSE      I +    +P  RVR+ 
Sbjct: 257 GSDTINIRFKEFGVRVSFTPTVIDGDRLTLKVAPEVSELDDTSGIEIAGTRVPGLRVRRT 316

Query: 357 DTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATP 416
           DTTV L  G + V++GL+ + +    +  P L  IP+LGA FR+SR + E+ E+ +  TP
Sbjct: 317 DTTVTLGDGESFVISGLVSNHMASQVDKFPGLGNIPVLGAFFRSSRVSEEDRELLMIVTP 376

Query: 417 FLVKPVAMRDLSRP 430
            LV+P+A RD  +P
Sbjct: 377 HLVQPLA-RDAEQP 389


>gi|299532819|ref|ZP_07046206.1| type II and III secretion system protein [Comamonas testosteroni
           S44]
 gi|298719043|gb|EFI60013.1| type II and III secretion system protein [Comamonas testosteroni
           S44]
          Length = 454

 Score =  122 bits (307), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 106/182 (58%), Gaps = 6/182 (3%)

Query: 251 LDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTH 310
            D+      +  LE     R LA PTL A+SGQSA+F SGG+ +   V + TG  ++   
Sbjct: 240 FDKAGIGVNIGMLEGNNLARVLAAPTLVALSGQSANFLSGGE-VPVPVPAGTGMVAIQYK 298

Query: 311 DYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGG 366
            YG+ L  +PTVLS  RI L++  E SE      I +N+  +PS   R+ADTTVEL  G 
Sbjct: 299 PYGIGLTVSPTVLSNDRIVLKVAPEASELDYANTIVLNSATVPSITTRRADTTVELGDGE 358

Query: 367 TIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRD 426
           + V+ GL+  +     + +PLL  IPILG LF+   F ++E+E+ I  TP LVKP+A RD
Sbjct: 359 SFVIGGLVSRNTTSGTDKVPLLGDIPILGVLFKRQEFQQKESELAIVVTPRLVKPLA-RD 417

Query: 427 LS 428
           ++
Sbjct: 418 VN 419


>gi|15602717|ref|NP_245789.1| RcpA [Pasteurella multocida subsp. multocida str. Pm70]
 gi|12721161|gb|AAK02936.1| RcpA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 470

 Score =  122 bits (307), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 107/395 (27%), Positives = 186/395 (47%), Gaps = 38/395 (9%)

Query: 66  VQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM----LNLDILIER--D 119
           +  + VS P+ AD  +    +  ++ K  G+A V   G DGK +    +N++ LI    D
Sbjct: 47  IDTIFVSSPSVADYEILDDNSFIIYAKEEGRAEVTAFGQDGKPLTTDFINVNPLISNIND 106

Query: 120 IAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRA-----------VELSETFL 168
           I+     ++    +SN+ V+ V    V+ G  RT ++S+ A            +++ET  
Sbjct: 107 ISDTNRQIKARFPNSNLSVKKVGKAYVIEGKARTQEESEEAHRIVGEALGNSKKVTETSF 166

Query: 169 SQS-GRNQYANSSSK----KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS-ITGS 222
           ++S G  +Y     K     V+N  ++A   Q+ +K+++ EV + + + +G     + G 
Sbjct: 167 NRSEGVKEYIPFLDKYQFDGVINNASVADSTQINVKLSVVEVNKKLTEALGINWGRVVGV 226

Query: 223 SSGPSKSFAADFGGKFVSEGG---DFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTA 279
            SGP    +    G F   GG   + +  GV         ++AL      + LAEP+++ 
Sbjct: 227 HSGPLLGGSVSLSGGFSGSGGSTLNINATGV------SAFINALNNQDNGKILAEPSISL 280

Query: 280 ISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP 339
           +SG++A    GG+  +       G+ ++   ++GV L     V    RI L +   VS  
Sbjct: 281 LSGETADILVGGELPFAQ-KDKEGSATIIYKEFGVKLIVGAKVQKNKRIRLALDQSVS-T 338

Query: 340 VIGV----NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILG 395
           + G     N G +P +  R+A +  E+  G + ++ GL      +    +PLL  IPILG
Sbjct: 339 IAGSYAYDNVGTVPYFNTRRAKSIFEVADGESFIIGGLFSSQDAEGINKVPLLGDIPILG 398

Query: 396 ALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           + FRN+R +RE+ E+ I AT  +VKPV   D+  P
Sbjct: 399 SFFRNARTDREDKELVIVATVNVVKPVHESDIVYP 433


>gi|264680618|ref|YP_003280528.1| type II and III secretion system protein [Comamonas testosteroni
           CNB-2]
 gi|262211134|gb|ACY35232.1| type II and III secretion system protein [Comamonas testosteroni
           CNB-2]
          Length = 454

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 106/182 (58%), Gaps = 6/182 (3%)

Query: 251 LDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTH 310
            D+      +  LE     R LA PTL A+SGQSA+F SGG+ +   V + TG  ++   
Sbjct: 240 FDKAGIGVNIGMLEGNNLARVLAAPTLVALSGQSANFLSGGE-VPVPVPAGTGMVAIQYK 298

Query: 311 DYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGG 366
            YG+ L  +PTVLS  RI L++  E SE      I +N+  +PS   R+ADTTVEL  G 
Sbjct: 299 PYGIGLTVSPTVLSNDRIVLKVAPEASELDYANTIVLNSATVPSITTRRADTTVELGDGE 358

Query: 367 TIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRD 426
           + V+ GL+  +     + +PLL  IPILG LF+   F ++E+E+ I  TP LVKP+A RD
Sbjct: 359 SFVIGGLVSRNTTSGTDKVPLLGDIPILGVLFKRQEFQQKESELAIVVTPRLVKPLA-RD 417

Query: 427 LS 428
           ++
Sbjct: 418 VN 419


>gi|294102189|ref|YP_003554047.1| type II and III secretion system protein [Aminobacterium
           colombiense DSM 12261]
 gi|293617169|gb|ADE57323.1| type II and III secretion system protein [Aminobacterium
           colombiense DSM 12261]
          Length = 384

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 114/434 (26%), Positives = 187/434 (43%), Gaps = 67/434 (15%)

Query: 1   MRYLQRTFFTMMSIFLFS----SNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNK 56
           M  L+R  +   ++   +    + P +A    +   ++AV+   +V     K++S+G N 
Sbjct: 1   MACLKRKLWVFFAVVFLTVVVGALPVLAATYHLDVGDSAVLKYQNV-----KRMSVG-NP 54

Query: 57  VIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILI 116
            ++  +P+D   VL++                  GK  G A +I+    G  M    IL+
Sbjct: 55  DVLDAIPLDNNQVLLT------------------GKVEGGAALIVWDAAGMHMEK--ILV 94

Query: 117 ERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQY 176
              I      L+  +   NI V +    VVL G V+T +D  RAV ++  F         
Sbjct: 95  HPSIEAPSWELKELLQAENIDVTVRGGAVVLEGKVKTPRDRLRAVAIAGAF--------- 145

Query: 177 ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ--HSITGSSSG-----PSKS 229
                +KV+NLL +    Q+ L+  + EV++     +G +      G+  G     P   
Sbjct: 146 ----GEKVINLLEVDSAPQIKLRAVVMEVKKKDGDALGMKRLEGQEGTFWGIFDLTPDTG 201

Query: 230 FAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTS 289
              D+     ++G  +S K           ++AL      + L+ P LT +SG+ AS   
Sbjct: 202 HMLDY-----TKGAHYSAK-------INAWINALVENKEAKILSRPYLTTLSGEEASLNV 249

Query: 290 GGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNA 345
           GG+ +   V        +    YGV++ FTP +   G I L  + EVSE      I    
Sbjct: 250 GGE-IPVPVGVDNNEIKIEWKPYGVIMKFTPELDGIGEIWLTFEAEVSEIDWENAIETQG 308

Query: 346 GDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNR 405
             +P+ R RK    V L    ++V+ GLL +   +L + IPLL  IPI+G LF++  F  
Sbjct: 309 IKIPAIRTRKIANKVRLGHNESLVVGGLLDNKQSKLVKKIPLLGDIPIIGELFKSREFTN 368

Query: 406 EETEIFIAATPFLV 419
           +ETE+ I  TP +V
Sbjct: 369 DETELVITVTPEVV 382


>gi|221070074|ref|ZP_03546179.1| type II and III secretion system protein [Comamonas testosteroni
           KF-1]
 gi|220715097|gb|EED70465.1| type II and III secretion system protein [Comamonas testosteroni
           KF-1]
          Length = 454

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 106/182 (58%), Gaps = 6/182 (3%)

Query: 251 LDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTH 310
            D+      +  LE     R LA PTL A+SGQSA+F SGG+ +   V + TG  ++   
Sbjct: 240 FDKAGIGVNIGMLEGNNLARVLAAPTLVALSGQSANFLSGGE-VPVPVPAGTGLVAIQYK 298

Query: 311 DYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGG 366
            YG+ L  +PTVLS  RI L++  E SE      I +N+  +PS   R+ADTTVEL  G 
Sbjct: 299 PYGIGLTVSPTVLSNDRIVLKVAPEASELDYANTIVLNSATIPSITTRRADTTVELGDGE 358

Query: 367 TIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRD 426
           + V+ GL+  +     + +PLL  IPILG LF+   F ++E+E+ I  TP LVKP+A RD
Sbjct: 359 SFVIGGLVSRNTTSGTDKVPLLGDIPILGVLFKRQEFQQKESELAIVVTPRLVKPLA-RD 417

Query: 427 LS 428
           ++
Sbjct: 418 VN 419


>gi|319795779|ref|YP_004157419.1| type II and iii secretion system protein [Variovorax paradoxus EPS]
 gi|315598242|gb|ADU39308.1| type II and III secretion system protein [Variovorax paradoxus EPS]
          Length = 462

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 128/249 (51%), Gaps = 20/249 (8%)

Query: 194 DQVTLKVTIAEVRRDILKQIGFQ-HSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLD 252
           + V ++V + E  R +LKQ G    S   +S+G S    +  G K  +   D S+ G  +
Sbjct: 176 NTVQVEVKVVEFNRSVLKQAGLNIFSTRANSNGFSFGVFSPAGLKSSTFASDGSINGEYN 235

Query: 253 R---------FSFETV-----LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV 298
                     F+F        +  LE     R LAEPTL A+SGQSASF SGG+ L   V
Sbjct: 236 NPLAQAFSLLFNFGKAGIGLNVGFLEGNGMARVLAEPTLVAMSGQSASFLSGGE-LPVPV 294

Query: 299 SSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVR 354
               G TS+    +G+ L  TPTVLS  RI L++  E S+      + +N   +P+   R
Sbjct: 295 PQGLGTTSIEYKPFGIGLTLTPTVLSNDRIVLKVAPEASDLDYTNSLSINGIAVPAISTR 354

Query: 355 KADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAA 414
           +ADTTVEL  G + ++ GL+        + +PLL  +PILG+ F+ +++   E E+ I  
Sbjct: 355 RADTTVELGDGESFIIGGLVSRTTTSNADKVPLLGDLPILGSFFKQNKYQMSEKELVILV 414

Query: 415 TPFLVKPVA 423
           TP LVKP+A
Sbjct: 415 TPHLVKPIA 423


>gi|198284413|ref|YP_002220734.1| type II and III secretion system protein [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218666419|ref|YP_002427081.1| bacterial type II/III secretion system protein [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198248934|gb|ACH84527.1| type II and III secretion system protein [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218518632|gb|ACK79218.1| bacterial type II/III secretion system protein [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 478

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 93/268 (34%), Positives = 142/268 (52%), Gaps = 25/268 (9%)

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQ-HSITGSSS----GPSKSFAADFG 235
           + KV++   I  +D+V + V + E  +  LK +G    S TG  S    GPS   +A++ 
Sbjct: 169 TGKVIDQSVIPVDDEVQVGVKVVEFSKAQLKNVGINIFSSTGGFSLGTFGPSTLTSANYP 228

Query: 236 GKFVSEG-GDFSVKGV------------LDRFSFETVLHALERATAIRTLAEPTLTAISG 282
               S G G  ++ GV            +      + L  LE    +R LAEPTL A++G
Sbjct: 229 VSLASGGPGALAITGVAPFTQAFNLVGGVGNSGLSSYLSLLEGNNILRVLAEPTLVAMNG 288

Query: 283 QSASFTSGGQ-HLYKTVSSSTGATSVTTH--DYGVVLHFTPTVLSPGRIGLRIQTEVSE- 338
           Q ASF +GG+  +    SS  G  ++T     YGV L  TPT+LS  RI L +   VS  
Sbjct: 289 QQASFLAGGEIPIPVPQSSGVGTPTITIQYKKYGVQLDLTPTILSAHRIALHVAPSVSSL 348

Query: 339 ---PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILG 395
                I +N   +P+  VR+ADTTV L +G ++V+ GL+   +QQ    +P+L  +PILG
Sbjct: 349 DYTNAITLNGYSVPALLVRQADTTVTLGNGESLVIGGLVDRQMQQNISKVPILGDLPILG 408

Query: 396 ALFRNSRFNREETEIFIAATPFLVKPVA 423
           A FR+ ++++++ E+ I  TP LV+P+A
Sbjct: 409 AFFRSIQYSKQDMELAIIVTPRLVRPIA 436


>gi|239817412|ref|YP_002946322.1| type II and III secretion system protein [Variovorax paradoxus
           S110]
 gi|239803989|gb|ACS21056.1| type II and III secretion system protein [Variovorax paradoxus
           S110]
          Length = 457

 Score =  120 bits (302), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 97/313 (30%), Positives = 151/313 (48%), Gaps = 33/313 (10%)

Query: 132 ADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIA 191
           A +   +E+   +  L G + ++   Q+A E +      +G  + A    + V+N+ +  
Sbjct: 118 AATTYSIEVRRRSATLAGTMDSVAAHQQARETA-----MAGMPEKAELIDRSVVNVRS-- 170

Query: 192 GEDQVTLKVTIAEVRRDILKQIG------------FQHSITGSSSGPSKSFAADFGGKFV 239
             + V ++V + E  R +LKQ G            F   + G SS  S +FA++  G   
Sbjct: 171 --NTVQVEVKVVEFNRSVLKQAGLNIFSTRANSNGFSFGVFGPSSLGSTTFASN--GSIS 226

Query: 240 SEGGDFSVKGVLDRFSFETV-----LHALERATAIRTLAEPTLTAISGQSASFTSGGQHL 294
            E  +   +     F+F        +  LE     R LAEPTL A+SGQSASF +GG+ L
Sbjct: 227 GEYHNPLAQAFSLLFNFGKAGVGLNVGFLEGNGMARVLAEPTLVAMSGQSASFLAGGE-L 285

Query: 295 YKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPS 350
                   G TS+    +G+ L  TPTVLS  RI L++  E S+      + +    +P+
Sbjct: 286 PVPAPQGLGTTSIEYKPFGIGLTLTPTVLSNDRIVLKVAPEASDLDYTNSLSIGGVAVPA 345

Query: 351 YRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEI 410
              R+ADTTVEL  G + ++ GL+        + +PLL  +PILG  FR +++   E E+
Sbjct: 346 ITTRRADTTVELGDGESFIIGGLVSRTTTSNVDKVPLLGDLPILGTFFRQNKYQMSEKEL 405

Query: 411 FIAATPFLVKPVA 423
            I  TP LVKP+A
Sbjct: 406 VILVTPHLVKPIA 418


>gi|70734199|ref|YP_257839.1| type II/III secretion system protein [Pseudomonas fluorescens Pf-5]
 gi|68348498|gb|AAY96104.1| bacterial type II/III secretion system protein [Pseudomonas
           fluorescens Pf-5]
          Length = 417

 Score =  120 bits (302), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 82/251 (32%), Positives = 131/251 (52%), Gaps = 27/251 (10%)

Query: 195 QVTLKVTIAEVRRDILKQ-----IGFQHS----------ITGSSSGPSKSFAADFGGKFV 239
           QV   +   EV R  LK+      G  H+          +TG +SG   S    FGG+  
Sbjct: 133 QVQTDIRFVEVSRTKLKEASVSIFGRGHNFLFGAPGTAPVTGGTSG---SVTPTFGGRRT 189

Query: 240 S---EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYK 296
           +   + G F++          T+++ALE +    TLA P+L A+SGQSASF +GG+    
Sbjct: 190 NIPLDNGTFNIG--FGNGRVLTLINALEGSGFAYTLARPSLVALSGQSASFLAGGEIPIP 247

Query: 297 TVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYR 352
             S+ + + ++   ++G+ L  TPT++  GRI L++  EVSE      + +    +P+  
Sbjct: 248 VPSTGSNSVTIEYKEFGIRLTLTPTIVDRGRISLKVAPEVSELDYSNAVTIAGTQVPALT 307

Query: 353 VRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFI 412
           VR+ DT++ L  G + V++GL+  +        P L  IP+LGA FR++  NREE E+ +
Sbjct: 308 VRRTDTSISLADGESFVISGLISTNNSSQVNKFPGLGDIPVLGAFFRDTTINREERELLM 367

Query: 413 AATPFLVKPVA 423
             TP LV+P+A
Sbjct: 368 VVTPHLVQPLA 378


>gi|296121060|ref|YP_003628838.1| type II and III secretion system protein [Planctomyces limnophilus
           DSM 3776]
 gi|296013400|gb|ADG66639.1| type II and III secretion system protein [Planctomyces limnophilus
           DSM 3776]
          Length = 622

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 106/403 (26%), Positives = 178/403 (44%), Gaps = 37/403 (9%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           K+ I      ++Q P  +  V   DP    V   +   + + G   G   +++   +G  
Sbjct: 59  KLEIAERFARVVQFPRKILRVDGFDPAVLSVTALAHDQLRVQGITEGITTMVITDENGA- 117

Query: 109 MLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL 168
           +  +D+++  D   L+  L R   ++++ V  + D V+L G V   Q     V++++ + 
Sbjct: 118 ITTIDVMVAGDARLLQAVLSREYPNTSVTVTKLKDNVLLRGWVVEPQQITEIVDIAKLY- 176

Query: 169 SQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG------S 222
                  Y N     V+N + + G  QV L+  + EV+R  L+ +G   +  G      S
Sbjct: 177 -------YPN-----VLNQMKMGGPQQVQLRCKVMEVQRSKLRSLGLNFTYLGRNVAFSS 224

Query: 223 SSG---PSKSFAADFGGKF---VSEGG----DFSVKGVLDRFSFETVLHALERATAIRTL 272
           + G   P  +F    GG     +++ G      S+  V D F+F  +L AL     ++  
Sbjct: 225 TPGAISPLDAFTVPIGGPPGVGLAQSGFRNATMSLGIVGDDFAFGGLLEALREEGLLKIQ 284

Query: 273 AEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRI 332
           AEPT+   SG+ A   SGG+     V    G  ++   ++GV L   P +LSP R+   I
Sbjct: 285 AEPTIVTRSGEPAKIVSGGEFPIP-VPQGLGTIAIEWREFGVRLESVPMILSPNRLKQTI 343

Query: 333 QTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLL 388
             EVSE      + +N+  +P    R  +T VE+  G T+ + GL+          IP L
Sbjct: 344 IAEVSERDLTNAVTLNSTTVPGLTKRTVETQVEMNFGQTLAIGGLISSRKTAQTSKIPFL 403

Query: 389 SKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
            ++P +GA FR   ++  ETE+ +  TP  V   AM     PD
Sbjct: 404 GELPYVGAAFRRVNYDEAETELLVLITPEFVS--AMDPAQVPD 444


>gi|225872754|ref|YP_002754211.1| type II/III secretion system protein [Acidobacterium capsulatum
           ATCC 51196]
 gi|225792181|gb|ACO32271.1| type II/III secretion system protein [Acidobacterium capsulatum
           ATCC 51196]
          Length = 480

 Score =  119 bits (298), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 109/386 (28%), Positives = 181/386 (46%), Gaps = 33/386 (8%)

Query: 56  KVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDIL 115
           + + L     ++ V VSDP   +    SP  + +  K  G +++++    G+  +   + 
Sbjct: 63  RSMFLDTATPLKRVYVSDPAVLNSFTASPHQVLITAKAPGISSLVVWDESGRSNV-YTVS 121

Query: 116 IERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQ 175
            + D++ L+  +        I    + D V L G V T  ++  A +L++ +        
Sbjct: 122 SDIDVSGLQAAINAAFPHDMIHASALQDRVTLTGEVATESEAAAAEKLAQGY-------- 173

Query: 176 YANSSSKKVMNLLNIAGE--DQVTLKVTIAEVRRDILKQIGFQH-------SITGSSSGP 226
                +K V N +++A +   QV LKV  AEV R   +Q+GF         ++TG+   P
Sbjct: 174 -----AKTVENSIDLAPQRVQQVQLKVRFAEVDRTRAQQLGFNFISAGRNAAVTGTQQFP 228

Query: 227 SKS---FAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQ 283
           S S      +     ++      +       +    + ALE    ++ LAEPT+T+ISG 
Sbjct: 229 SFSNYTLGGNSTANPITVSNPLDLLLYSSDLNLGATIQALENDQVLQILAEPTITSISGV 288

Query: 284 SASFTSGGQHLYKTVSS-STGATSVTTH--DYGVVLHFTPTVLSPGRIGLRIQTEVSE-- 338
            ASF SGGQ  +  V   +TG TSVT     YGV L FTP V   G I L++  EVS   
Sbjct: 289 EASFLSGGQFPFPVVQGGTTGFTSVTVQFRPYGVKLDFTPYVNPDGTIRLKVAPEVSALD 348

Query: 339 --PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGA 396
               + ++   +P+   R+A T V L +G +  ++GLL   +    E +P +S+IPILG 
Sbjct: 349 YTNEVQISGYSIPAIDTRRAKTEVVLKNGQSFAISGLLDHRLTNDYERMPGISRIPILGQ 408

Query: 397 LFRNSRFNREETEIFIAATPFLVKPV 422
           LFR+ +     T++ +  TP +V P+
Sbjct: 409 LFRSYQKQASTTDLIVIVTPTIVDPL 434


>gi|260768627|ref|ZP_05877561.1| type II and III secretion system protein [Vibrio furnissii CIP
           102972]
 gi|260616657|gb|EEX41842.1| type II and III secretion system protein [Vibrio furnissii CIP
           102972]
          Length = 387

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 86/248 (34%), Positives = 125/248 (50%), Gaps = 24/248 (9%)

Query: 195 QVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSK----SFAADFGGKFVSE---GGDF-- 245
           QV   + + EV +  LK+ GF     G  SG +     + AA  GG F  E   G  F  
Sbjct: 104 QVQTDIKVVEVSKSALKEAGF---FFGKQSGNTTFGIGNNAALNGGNFAGELLSGNSFLP 160

Query: 246 ------SVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVS 299
                  V G + R    T+  AL       TLAEP+L  +SG +A+F +GG+  Y   +
Sbjct: 161 LSNAFNVVIGDMSRGILSTI-SALNANGFAYTLAEPSLVTMSGHTATFLAGGEFPYPK-A 218

Query: 300 SSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRK 355
           SS G  ++   ++GV L+ +PTV+   RI L++  EVSE      +      +P   VR+
Sbjct: 219 SSDGDITIEFKEFGVRLNLSPTVMKDNRIMLKVAPEVSELNYNNAVSTGGVLVPGMSVRR 278

Query: 356 ADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAAT 415
            DTTV+L  G T V++GL+        +  P L  IPILGA F ++RF + + E+ +  T
Sbjct: 279 TDTTVQLGDGETFVISGLISSSTMNNSDRFPGLGDIPILGAFFSSTRFEKNDKELMMVVT 338

Query: 416 PFLVKPVA 423
           P LVKP+A
Sbjct: 339 PHLVKPIA 346


>gi|77456876|ref|YP_346381.1| type II and III secretion system protein [Pseudomonas fluorescens
           Pf0-1]
 gi|77380879|gb|ABA72392.1| putative Flp pilus assembly protein, secretin [Pseudomonas
           fluorescens Pf0-1]
          Length = 422

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 113/389 (29%), Positives = 177/389 (45%), Gaps = 52/389 (13%)

Query: 42  VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVIL 101
           +E+G+G + ++        Q PV +  V V DP  ADV V   + + L G   G A  ++
Sbjct: 42  LEVGEGLQQAV--------QSPVAITRVAVGDPKIADVRVTGDQGVLLTGVGPG-ATTLM 92

Query: 102 IGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAV 161
           I           ++  +  A   MT     + S               +   +Q   R V
Sbjct: 93  IWTACASTPRQSMVFVQGKASAAMTAAALPSSSE------------PNLPSQVQTDIRFV 140

Query: 162 ELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITG 221
           E+S T L ++G + Y   S+  +           VT  V        +L       +I  
Sbjct: 141 EVSRTKLKEAGTSIYGKGSNNFLFGAPGTVPNTGVTPGVV------PLL-------NIDP 187

Query: 222 SSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAIS 281
             + PS   A D     +  GG  S         F  +++ALE +    TLA P+L A+S
Sbjct: 188 RIAAPSIPLANDMFN--IVWGGGSS--------KFLGIVNALEGSGFAYTLARPSLVALS 237

Query: 282 GQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVI 341
           GQSASF +GG+      S+++ + S+   ++G+ L  TPTV+S  RI L++  EVSE  +
Sbjct: 238 GQSASFLAGGEVPIPVPSANSNSYSIEYKEFGIRLTLTPTVVSNDRIALKVAPEVSE--L 295

Query: 342 GVNAG------DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILG 395
             N G       +P++ +R+ DT++ L  G + V++GL+           P L  IP+LG
Sbjct: 296 DYNNGVTIGGTKVPAFTIRRTDTSISLADGESFVISGLISTRNASEVNKFPGLGDIPVLG 355

Query: 396 ALFRNSRFNREETEIFIAATPFLVKPVAM 424
           A FRNS  NREE E+ +  TP LV+P+A+
Sbjct: 356 AFFRNSSINREERELLMIVTPHLVQPLAV 384


>gi|293391332|ref|ZP_06635666.1| type II/IV secretion system secretin RcpA/CpaC [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|32452623|gb|AAP43985.1| RcpA [Aggregatibacter actinomycetemcomitans]
 gi|290951866|gb|EFE01985.1| type II/IV secretion system secretin RcpA/CpaC [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 460

 Score =  118 bits (296), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 101/391 (25%), Positives = 182/391 (46%), Gaps = 25/391 (6%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM----LNLDI 114
           ++Q    +  + VS P  AD  +    +  ++ K  G+  V   G DG+ +    +N+D 
Sbjct: 41  LVQTKEKIDTIFVSSPNIADYEILDDNSFIIYAKEEGRTEVTAFGVDGRPLTSDTVNVDS 100

Query: 115 LIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDS---QRAV--------EL 163
           ++   IA     L+    ++N+ V+ V    V+ G  R+ ++S   +R V        ++
Sbjct: 101 VV-TSIADTNKQLKSHFPNTNLSVKKVGKAYVIEGKARSQEESDEVRRIVGEALGNGRKI 159

Query: 164 SETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS 223
           +ET L +             V++  NIA   Q+ +K+++ EV + + + +G   S   + 
Sbjct: 160 TETKLGEDALPFLDKYHYDGVVDNANIADTTQINVKLSVVEVNKKLSEAMGINWSHV-AG 218

Query: 224 SGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQ 283
           SGP       FGG F    G       LD       ++AL+  +  + LAEP ++ +SG+
Sbjct: 219 SGPLLGGNFGFGGGFNGNQGVLR----LDAKGISAFINALDNQSNGKVLAEPNISMLSGE 274

Query: 284 SASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV 343
           +A    GG+  +       G+ ++   ++G+ L     +    RI L +   VS      
Sbjct: 275 TADILVGGEIPFAQ-RDKDGSPTIIYKEFGIKLAVAAKLQKNDRIRLALDQSVSTIAGNY 333

Query: 344 N---AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
           N    G++P +  RKA +  E+ +G + ++ GL   +  +    +PLL  IPILG+ FRN
Sbjct: 334 NFEGVGNIPFFNTRKAKSLFEVANGESFIIGGLFSSNDLEGINKVPLLGDIPILGSFFRN 393

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           +   R++ E+ I AT  +VKPV  +D+  PD
Sbjct: 394 ATTERDKKELVIVATVNVVKPVNEKDVVYPD 424


>gi|78486068|ref|YP_391993.1| type II and III secretion system protein [Thiomicrospira crunogena
           XCL-2]
 gi|78364354|gb|ABB42319.1| Flp (type IV) pilus assembly protein CpaC homolog [Thiomicrospira
           crunogena XCL-2]
          Length = 520

 Score =  118 bits (296), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 92/305 (30%), Positives = 153/305 (50%), Gaps = 28/305 (9%)

Query: 184 VMNLLNIAGEDQVTLKVTIAEVR-----------RDILKQIG-FQHSITGSSSGPS-KSF 230
           V+N++++ G+ Q+ L V +AEV            RD   + G F     G+ +  S  + 
Sbjct: 215 VVNMIDVTGKSQIKLSVRVAEVVKGNPFKSGVAIRDKKDRFGIFPPGNLGTQALFSLNNS 274

Query: 231 AADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSG 290
             D  G        F +    +  S   VL  LE     R LA+P L   SG++A+F  G
Sbjct: 275 PGDTAGISFPHPDAFQIGFNPENGSIFGVLSLLEGHNLARVLAKPELIVQSGETATFLVG 334

Query: 291 GQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGD--- 347
           G+ +   V+ +    +V+  +YGV L F+P V   G I + ++ EVS+    ++A +   
Sbjct: 335 GE-VAIPVAQNADTITVSYKEYGVRLRFSPIVTESGDIQMTVEPEVSD----IDAANGTQ 389

Query: 348 -----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSR 402
                +PS+R RK  TT+ L  G + ++ GLL+D+I+     +P+L  IPILGALFR++ 
Sbjct: 390 TNNIIIPSFRSRKTSTTITLAPGQSFIIGGLLQDNIRSQVSKVPVLGDIPILGALFRSNS 449

Query: 403 FNREETEIFIAATPFLVKPV-AMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVE 461
           +  +++E+ I  TP  V PV A + +S P ++     +  AFF  +V ++  P+  S + 
Sbjct: 450 YVHDKSELAIMVTPTFVAPVDAGKKVSLPGENLKRPSNMDAFFLGKVAEVL-PEGESALP 508

Query: 462 GQNYK 466
             N K
Sbjct: 509 ESNVK 513


>gi|110833080|ref|YP_691939.1| type II secretion system protein [Alcanivorax borkumensis SK2]
 gi|110646191|emb|CAL15667.1| type II secretion system protein, probable [Alcanivorax borkumensis
           SK2]
          Length = 406

 Score =  118 bits (296), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 83/240 (34%), Positives = 123/240 (51%), Gaps = 28/240 (11%)

Query: 195 QVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRF 254
           QV   + I EV R  L   GF++S            A+  GG            G  D F
Sbjct: 141 QVQTDIRIMEVSRSKLNSFGFEYSNIFDGGNTQVGVASPGGG------------GPSDSF 188

Query: 255 SF-------ETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSV 307
           +         T+++ALE      TLA+P+LTA+SGQ+A+F SGG+    T S + G   V
Sbjct: 189 NLFRLGKNSTTIINALESGGFAYTLAKPSLTALSGQTATFLSGGEFPVPTRSDNNGV-QV 247

Query: 308 TTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAG------DMPSYRVRKADTTVE 361
               +G+ L  TPTV+S  +I L++  EVSE  +  +AG       +P  RVR+++TTV 
Sbjct: 248 EFKSFGIGLALTPTVISGDQIILKVAPEVSE--LDFSAGVESAGTSIPGLRVRRSETTVS 305

Query: 362 LPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
           L  G T +++GL+  +       IP L  +P+LGA FR+ + +RE+ E+ +  TP LV P
Sbjct: 306 LAPGETFIISGLVSQNTVNNSNRIPGLGNLPVLGAFFRSGQLSREDKEMVMVVTPHLVSP 365


>gi|167836794|ref|ZP_02463677.1| type II/III secretion system protein [Burkholderia thailandensis
           MSMB43]
          Length = 423

 Score =  118 bits (296), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 124/417 (29%), Positives = 187/417 (44%), Gaps = 59/417 (14%)

Query: 32  ANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADV-VVHSPRT-MYL 89
           A AA +   ++  G  ++I++G            VQ V + DP  ADV V+   R  + L
Sbjct: 2   AQAAEMGAIELTTGAQRQIAVGRG----------VQRVAIGDPNVADVLVIKGGRGGVLL 51

Query: 90  FGKNVGQANVILI--GHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVL 147
             K  G  ++++   G D   +  +D++            R  +      V     T V+
Sbjct: 52  VAKAAGSTSLMVWERGRDEPAVYTVDVV--------SGAARALLDGGAPGVRAYDGTAVV 103

Query: 148 HGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRR 207
            G   T+    RA+ + +    + G    A++          + G++ V + V + E  R
Sbjct: 104 SGSAATLDAHARALAVGKGMAGKGGGVVDAST----------VGGKNVVQVDVRVVEFSR 153

Query: 208 DILKQIG--FQHSITGSSSGPSKSFAADFGGKFVSEGGDFS---------------VKGV 250
            +LKQ G  F     G + G   SFA   G   V+ GG  S               V G 
Sbjct: 154 SVLKQAGLNFFKQNNGFTFG---SFAPA-GLASVTGGGTSSMSVSANIPIASAFNLVVGS 209

Query: 251 LDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTH 310
             R  F   L  LE     R LA+PTL A+SGQSASF +GG+ +   V  S G  S+   
Sbjct: 210 ATRGLFAD-LSILEANNLARVLAQPTLVALSGQSASFLAGGE-IPVPVPQSLGTISIDWK 267

Query: 311 DYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGG 366
            YGV L  TPTVLSP RI L++  E S+      I +N   +P+   R+ADTTVEL  G 
Sbjct: 268 PYGVGLTLTPTVLSPRRIALKVAPESSQLDFVHSITINGVTVPALTTRRADTTVELGDGE 327

Query: 367 TIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA 423
           + V+ GL+  +     + +P L  +PI+G  F++  + + + E+ I  TP LV P+A
Sbjct: 328 SFVIGGLIDRETTSNVDKVPFLGDLPIIGTFFKHLSYQQNDKELVIIVTPHLVAPIA 384


>gi|188592032|ref|YP_001796630.1| type II secretion system protein; precursor [Cupriavidus
           taiwanensis LMG 19424]
 gi|170938406|emb|CAP63393.1| putative Type II secretion system protein; putative precursor
           [Cupriavidus taiwanensis LMG 19424]
          Length = 475

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 84/258 (32%), Positives = 132/258 (51%), Gaps = 30/258 (11%)

Query: 190 IAGEDQVTLKVTIAEVRRDILKQIGF--------------------QHSITGSSSGPSKS 229
           ++G  QV +KV   E+ + +LK++G                     + + T  S G   S
Sbjct: 184 LSGTVQVDVKVV--EISKTVLKEVGINFFRNNSGFAFGTFSPSTLNKFTFTPGSGGAPGS 241

Query: 230 FAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTS 289
           F+AD      +    F++            +  LE     R LAEP+L A+SGQSASF +
Sbjct: 242 FSADIASPMSNA---FNLVAASLTHGIFANISLLEANGLARVLAEPSLVALSGQSASFLA 298

Query: 290 GGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PV--IGVNA 345
           GG+ +   V  + G T++    +G+ L  +PTVLS  RI L++  E S+  P   I +N 
Sbjct: 299 GGE-IPIPVPQALGTTTIQFKPFGIGLTVSPTVLSADRIALKVAPEASDLDPSRGISING 357

Query: 346 GDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNR 405
             +P+   R+ADTTVEL  G + V+ GL+  +       +P+L  +P++GA F+N  F++
Sbjct: 358 AVVPAIVTRRADTTVELGDGESFVIGGLVSRNTVSNVNKVPVLGDLPVIGAFFKNLNFHQ 417

Query: 406 EETEIFIAATPFLVKPVA 423
           E+ E+ I  TP LVKP+A
Sbjct: 418 EDRELMIVVTPRLVKPMA 435


>gi|104779900|ref|YP_606398.1| type II/IV secretion system protein D [Pseudomonas entomophila L48]
 gi|95108887|emb|CAK13583.1| Putative type II/IV secretion system protein D [Pseudomonas
           entomophila L48]
          Length = 426

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 64/173 (36%), Positives = 104/173 (60%), Gaps = 4/173 (2%)

Query: 256 FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVV 315
           F  +++ALE +    TLA P+LT +SG +ASF +GG+      SS +   S+   ++GV 
Sbjct: 216 FLAMINALENSGFAYTLARPSLTVLSGLTASFLAGGEIPIPVPSSGSDNVSIEYKEFGVR 275

Query: 316 LHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLA 371
           L  TPTV+S  RI L++  EVSE      + +    +P   VR+ DT++ L  G + +++
Sbjct: 276 LALTPTVVSGNRINLKVAPEVSELDYNNAVVIAGTRVPGLSVRRTDTSITLADGESFIIS 335

Query: 372 GLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAM 424
           GL+  +++   + +P L  +PI+GA FR +  NREETE+ +  TP LV+P+A+
Sbjct: 336 GLITSNVRSGVDKMPGLGNLPIIGAFFRQTALNREETELLMIVTPHLVQPLAV 388


>gi|229588195|ref|YP_002870314.1| putative type II secretion system protein [Pseudomonas fluorescens
           SBW25]
 gi|229360061|emb|CAY46915.1| putative type II secretion system protein [Pseudomonas fluorescens
           SBW25]
          Length = 405

 Score =  118 bits (295), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 110/408 (26%), Positives = 181/408 (44%), Gaps = 75/408 (18%)

Query: 28  PIKEANAAVINISD-------VEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVV 80
           P+  A AA  N S        VE+G+G +          LQ PV +  + + DP  ADV 
Sbjct: 22  PVGMALAAPGNCSALGQLPAVVEVGEGLQQE--------LQSPVAITRLAIGDPKIADVR 73

Query: 81  VHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIE-RDIAHLEMTLRRFIADSNIRVE 139
           V+  R   L G   G  ++++            + ++ R  + L         D  +  +
Sbjct: 74  VNGDRHFLLTGVASGATSLMVWTACASTPRQSMVFVKGRATSALTSLSLSPSEDPLLPSQ 133

Query: 140 MVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLK 199
           + +D       +R ++ S+  ++ + T L  +G+N +  S         N+    +   K
Sbjct: 134 VQTD-------IRFVEVSRTKLKEASTRLLGTGKNFFLGSP--------NLLSPSEGVFK 178

Query: 200 VTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETV 259
           + ++                       + SF   FGG  VS                  +
Sbjct: 179 LPVS-----------------------TDSFNVGFGGGRVS-----------------AM 198

Query: 260 LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFT 319
           ++ALER+    TLA P+L A+SGQSASF +GG+      S+ +   S+   ++G+ L  T
Sbjct: 199 INALERSGFAYTLARPSLVAMSGQSASFLAGGEVPVPVPSAGSDTISIEYKEFGIRLTLT 258

Query: 320 PTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLK 375
           PTV+   RI L++  EVSE      + +    +P+  VR+ DT+V L  G + V++GL+ 
Sbjct: 259 PTVIDRNRITLKVAPEVSELDYSNAVIIQGIQVPALTVRRTDTSVSLADGESFVISGLIS 318

Query: 376 DDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA 423
            + +      P L  IPILGA FR+S  +REE E+ +  TP LV+P+A
Sbjct: 319 TNNRSTISKFPGLGDIPILGAFFRDSNISREEKELLMIVTPHLVQPLA 366


>gi|116694140|ref|YP_728351.1| flp pilus assembly protein, secretin [Ralstonia eutropha H16]
 gi|113528639|emb|CAJ94986.1| flp pilus assembly protein, secretin [Ralstonia eutropha H16]
          Length = 470

 Score =  118 bits (295), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 84/258 (32%), Positives = 132/258 (51%), Gaps = 30/258 (11%)

Query: 190 IAGEDQVTLKVTIAEVRRDILKQIGF--------------------QHSITGSSSGPSKS 229
           ++G  QV +KV   E+ + +LK++G                     + + T  S G   S
Sbjct: 179 LSGTVQVDVKVV--EISKTVLKEVGINFFRNNSGFAFGTFSPSTLNKFTFTPGSGGAPGS 236

Query: 230 FAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTS 289
           F+AD      +    F++            +  LE     R LAEP+L A+SGQSASF +
Sbjct: 237 FSADIASPMSNA---FNLVAASLTHGIFANISLLEANGLARVLAEPSLVALSGQSASFLA 293

Query: 290 GGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PV--IGVNA 345
           GG+ +   V  + G T++    +G+ L  +PTVLS  RI L++  E S+  P   I +N 
Sbjct: 294 GGE-IPIPVPQALGTTTIQFKPFGIGLTVSPTVLSADRIALKVAPEASDLDPSRGISING 352

Query: 346 GDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNR 405
             +P+   R+ADTTVEL  G + V+ GL+  +       +P+L  +P++GA F+N  F++
Sbjct: 353 AVVPAIVTRRADTTVELGDGESFVIGGLVSRNTVSNVNKVPVLGDLPVIGAFFKNLNFHQ 412

Query: 406 EETEIFIAATPFLVKPVA 423
           E+ E+ I  TP LVKP+A
Sbjct: 413 EDRELMIVVTPRLVKPLA 430


>gi|322434104|ref|YP_004216316.1| type II and III secretion system protein [Acidobacterium sp.
           MP5ACTX9]
 gi|321161831|gb|ADW67536.1| type II and III secretion system protein [Acidobacterium sp.
           MP5ACTX9]
          Length = 484

 Score =  117 bits (293), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 119/439 (27%), Positives = 205/439 (46%), Gaps = 48/439 (10%)

Query: 43  EIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILI 102
           ++G  + + + +   ++L    +++ + V +PT        P  + L  K  G +++++ 
Sbjct: 55  DMGGDETLHLLVGHSMVLHSTSNIKRIFVGNPTVLQSYTGGPSEIVLTAKATGVSSLVVW 114

Query: 103 GHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVE 162
              G+  L   I  + D   L+ ++      S I V      + L G V T + S  A +
Sbjct: 115 DTQGQSCL-YTIAADMDPETLQRSMHDAYPKSQIDVGGHEGRIFLSGTVPTQEASDNAFK 173

Query: 163 LSETFLSQSGRNQYANSSSKKVMN---LLNIAGEDQVTLKVTIAEVRRDILKQIGFQ--- 216
           L             A+S SK V+N   ++ I G+ QV LK+ I EV R  ++Q G     
Sbjct: 174 L-------------ASSYSKDVVNSIRVVTIHGK-QVQLKLRIVEVDRTKMEQFGINLFR 219

Query: 217 ----HSITGSSSGPSKSFAADFGGKFVSEGGD-----FSVKGVLDRFSFE------TVLH 261
               +++ G ++G   S A    G   +          +V   L+ F +         + 
Sbjct: 220 PTASNAVGGLTTGQFPSLATYATGTPATATAPAVPATINVNNPLNFFIYSFSHEIGATIQ 279

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV----SSSTGATSVTTHDYGVVLH 317
            LE+   ++ LAEPTLTA+SGQSA F SGG+  +  V    S++  A +++   YGV + 
Sbjct: 280 DLEQKQILQVLAEPTLTAMSGQSAKFLSGGEFPFPVVQGGGSAAGVAITISFRPYGVKVD 339

Query: 318 FTPTVLSPGRIGLRIQTEVS----EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGL 373
           FTPTV   G I L++  EVS       + ++   +P+   R+A+T VE+ +G T  L GL
Sbjct: 340 FTPTVNEDGSIHLKVAPEVSTLDFSNAVTISGFTIPALSTRRAETEVEILNGQTFALTGL 399

Query: 374 LKDDIQQLKEGIPLLSKIPILGALFRNSR-FNREETEIFIAATPFLVKPVAM-RDLSRPD 431
           L     +    IP +S++PILG LF  ++ +     E+ +  T  +V P+    D ++PD
Sbjct: 400 LDHRTTESLSQIPGISRLPILGKLFATTKSYTHSVIELVVLVTANVVDPLTQPTDTTQPD 459

Query: 432 DHYSVEDDAKAFFFNRVNK 450
              +V +  K+ F N ++K
Sbjct: 460 --MAVPNLDKSVFDNDLSK 476


>gi|254429436|ref|ZP_05043143.1| Bacterial type II and III secretion system protein [Alcanivorax sp.
           DG881]
 gi|196195605|gb|EDX90564.1| Bacterial type II and III secretion system protein [Alcanivorax sp.
           DG881]
          Length = 384

 Score =  117 bits (292), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 84/244 (34%), Positives = 127/244 (52%), Gaps = 26/244 (10%)

Query: 195 QVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVL--- 251
           QV   + + EV R  L Q+G  +S + +    +   AA         G  F V G +   
Sbjct: 108 QVQTDIRVLEVSRSELNQLGMSYSNSFNGGQSAVGIAA--------PGSGFQVPGAVPTP 159

Query: 252 ------DRFSFET----VLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS 301
                 + F F       ++ALE      TLAEP+LT++SGQSASF SGG+    T S++
Sbjct: 160 LGTEGFNLFGFGANSVLAINALEAGGFAYTLAEPSLTSLSGQSASFLSGGEFPVPTRSTT 219

Query: 302 TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEP--VIGVNAGDM--PSYRVRKAD 357
            G   +   ++G+ L  TPTV+   +I L++  EVSE     GV  G +  P  RVR+A+
Sbjct: 220 DG-VQIEFKEFGIGLSLTPTVIDKSQIILKVAPEVSELDFSAGVETGGVAVPGLRVRRAE 278

Query: 358 TTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPF 417
           TTV L  G T +++GL+  +     + +P +  IP+LGA FR+SR  +++ E+ +  TP 
Sbjct: 279 TTVSLAPGETFIISGLVSRNTINSSDRLPGIGNIPLLGAFFRSSRIQKDDKELVMVVTPH 338

Query: 418 LVKP 421
           LV P
Sbjct: 339 LVTP 342


>gi|319943382|ref|ZP_08017664.1| type II and III secretion system protein [Lautropia mirabilis ATCC
           51599]
 gi|319743197|gb|EFV95602.1| type II and III secretion system protein [Lautropia mirabilis ATCC
           51599]
          Length = 434

 Score =  117 bits (292), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 93/310 (30%), Positives = 150/310 (48%), Gaps = 43/310 (13%)

Query: 133 DSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAG 192
           +S +R   + D ++L G   T + + RA EL + +               +V++L++  G
Sbjct: 113 NSGVRARALGDRILLEGQNPTEEGAWRAAELVKRY--------------PQVISLVSRRG 158

Query: 193 EDQ-VTLKVTIAEVRRDILKQIGFQHSITGSS----SGPSKSFAADF--GGKFVSEGGDF 245
            +Q + L+V + E+ R+ LKQ+G +    G+     SGPS     DF   G F+ EGG  
Sbjct: 159 YEQMINLEVKMIEIGRNALKQLGVRWQGGGAGDWAVSGPSFGVIGDFKRSGAFLPEGGAA 218

Query: 246 SVKGVLDRFSFETVLHALERATAIR-----------------TLAEPTLTAISGQSASFT 288
           + +G    F+    +H    + ++                   LAEP L+  SG  A F 
Sbjct: 219 ATRG----FAVAPRIHPFATSASMVSSLSSMIDLMVQNGDAAVLAEPRLSTRSGGKARFV 274

Query: 289 SGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDM 348
           +GG+ L   V S+ GA +V   +YGV     P V + G I   + TEVS     V    +
Sbjct: 275 AGGE-LPIPVLSANGAANVDFKEYGVRFEVEPVVNAQGVISASLHTEVSSIDDEVTVMGV 333

Query: 349 PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREET 408
           P  R + ++T V L  G T+V+AG++++++      IP L  +PILG LFR+ RF + E+
Sbjct: 334 PGLRKQSSNTDVNLRPGETLVIAGMVRNEMSGAITKIPGLGDLPILGHLFRSKRFRQRES 393

Query: 409 EIFIAATPFL 418
           E+ +  TP L
Sbjct: 394 EMVVLITPRL 403


>gi|94312586|ref|YP_585795.1| pilus assembly protein [Cupriavidus metallidurans CH34]
 gi|93356438|gb|ABF10526.1| pilus assembly protein [Cupriavidus metallidurans CH34]
          Length = 473

 Score =  116 bits (291), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 111/379 (29%), Positives = 185/379 (48%), Gaps = 39/379 (10%)

Query: 66  VQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEM 125
           ++ V V +P  AD          L  K+ G  + +L+      + +L I   RD+A +  
Sbjct: 73  LERVAVGNPEVADA---------LLLKHRGGPSTVLVVARKPGVTDLKIW-SRDVAPVSY 122

Query: 126 TLRRFIADSNIRVEMVSDTVVLHGMVRTIQ-DSQRAVELSETFLSQSGRNQYANSSSKKV 184
           T+R    D+ +R +    +V L     +I  +S  A   + T ++       A+     V
Sbjct: 123 TVR---VDA-VRPDPGGASVDLSSAGASISGESPDAPAAARTLMAARAAVSSADGKRAGV 178

Query: 185 M---NLLNIAGEDQVTLKVTIAEVRRDILKQIG--FQHSITGSSSG---PSKSFAADFG- 235
           +   + + ++G  QV +KV   E+ + +LK+IG  F     G + G   PS    A F  
Sbjct: 179 VVDRSTVPVSGTVQVDVKVV--EISKTVLKEIGLNFYRDNGGFAFGTFSPSSLTKATFTP 236

Query: 236 --GKFVSEGGDFS-----VKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFT 288
             G  V      S     + G + +  F   L  +E    +R LAEP+L A+SGQSASF 
Sbjct: 237 GVGTVVDSVSPISSAFNLIAGSVSKGIFAN-LSLMEANGLVRVLAEPSLVALSGQSASFL 295

Query: 289 SGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PVIGV--N 344
           +GG+ +   V  + G T++    +G+ L  +PTV+S  RI L++  E S+  P  G+  N
Sbjct: 296 AGGE-IPIPVPQALGTTTIQYKPFGIGLTVSPTVMSRERIALKVAPEASDLDPSRGIVLN 354

Query: 345 AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFN 404
              +P+   R+ADTT+EL  G + V+ GL+  +       +P L  +P++G+ F+N  F+
Sbjct: 355 GATVPAIVTRRADTTIELGDGESFVIGGLVSRNTVSNVSKVPFLGDLPVIGSFFKNLNFH 414

Query: 405 REETEIFIAATPFLVKPVA 423
           +E+ E+ I  TP L+KP+A
Sbjct: 415 QEDRELMIVVTPHLIKPLA 433


>gi|194335913|ref|YP_002017707.1| type II and III secretion system protein [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|194308390|gb|ACF43090.1| type II and III secretion system protein [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 510

 Score =  116 bits (291), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 104/412 (25%), Positives = 179/412 (43%), Gaps = 64/412 (15%)

Query: 66  VQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEM 125
           ++ V + DP  AD ++ +   +YL GK +G  N+ +   +G  + +  + + R    L+ 
Sbjct: 73  IKRVAMGDPKVADYIMLNRFEVYLLGKKMGSTNLAVWDQNG-NLTSSPVQVSRGTTALQA 131

Query: 126 TLR-RFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS---QSGRNQYA---- 177
            L+  F  +++I +  +   +VL G V     ++    L  ++      SG  + A    
Sbjct: 132 LLKVLFPKENDIHLLALGPALVLSGSVSDALVAESVARLVRSYFGGSVSSGTPESALVGT 191

Query: 178 ----------------------------------NSSSKKVMNLLNIAGEDQVTLKVTIA 203
                                             + S++ V+NLL +    QV L+V IA
Sbjct: 192 DSKPFTGIIEEMSKDVVFSKTESHSKETTTHGGESDSTRGVVNLLKVRDSQQVRLEVCIA 251

Query: 204 EVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHAL 263
           +V R  ++ +G     T      S   +      FVS     ++       +    + A 
Sbjct: 252 QVSRTFIESLGISFFKTSGDIQGSTLLSG-----FVSNATLNNLLLGRLGQANGIKMVAD 306

Query: 264 ERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHD----------YG 313
            + +  + LAEPT+  +SG+   F  GG+             ++  +D          YG
Sbjct: 307 RKPSLFKVLAEPTIVTMSGKEGFFLVGGKIYVPVRVIDYSPINLQEYDKYYISYKEYLYG 366

Query: 314 VVLHFTPTVLSPGRIGLRIQTEVSEP-----VIGVNAGDMPSYRVRKADTTVELPSGGTI 368
           V L F P VL  GRI L++ +EVSEP       G  A ++P +++    T V++  G  +
Sbjct: 367 VGLRFMPVVLDAGRISLKVVSEVSEPDTESATSGTKA-NLPLFKISTVSTNVQMNEGENL 425

Query: 369 VLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           V+ GL  D+     + +PLLS+IPILGALFR+++ N E+TE+ +   P LVK
Sbjct: 426 VIGGLKLDNFANAIDSVPLLSEIPILGALFRDTKKNAEKTELMVIIRPTLVK 477


>gi|4768955|gb|AAD29695.1| rough colony protein A [Aggregatibacter actinomycetemcomitans]
          Length = 460

 Score =  116 bits (291), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 101/391 (25%), Positives = 182/391 (46%), Gaps = 25/391 (6%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM----LNLDI 114
           ++Q    +  + VS P  AD  +    T  ++ K  G+  V   G DG+ +    +N+D 
Sbjct: 41  LVQTKEKIDTIFVSSPNIADYEILDDNTFIIYAKEEGRTEVTAFGADGRPLTSDTVNVDS 100

Query: 115 LIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDS---QRAV--------EL 163
           ++   IA     L+    ++N+ V+ V    V+ G  R+ ++S   +R V        ++
Sbjct: 101 VV-TSIADTNKQLKSRFPNTNLSVKKVGKAYVIEGEARSQEESDEVRRIVGEALGSGRKV 159

Query: 164 SETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS 223
           +ET L +             V++  NIA   Q+ +K+++ EV + + + +G   S   + 
Sbjct: 160 TETKLGEDSLPFLDKYHYDDVVDNANIADTTQINVKLSVVEVNKKLSEAMGINWSHV-AG 218

Query: 224 SGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQ 283
           SGP       FGG F    G       LD       ++AL+  +  + LAEP ++ +SG+
Sbjct: 219 SGPLVGGNFGFGGGFNGNQGVLR----LDAKGISAFINALDNQSNGKVLAEPNISMLSGE 274

Query: 284 SASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV 343
           +A    GG+  +       G+ ++   ++G+ L     +    RI L +   VS      
Sbjct: 275 TADILVGGEIPFAQ-RDRDGSPTIIYKEFGIKLAVAAKLQKNNRIRLALDQTVSTIAGNY 333

Query: 344 N---AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
           N    G++P +  RKA +  E+ +G + ++ GL   +  +    +PLL  IPILG+ FR+
Sbjct: 334 NFDGIGNIPFFNTRKAKSLFEVANGESFIIGGLFSSNDLEGINKVPLLGDIPILGSFFRS 393

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           +   R++ E+ I AT  +VKPV  +D+  PD
Sbjct: 394 ATTERDKKELVIVATVNVVKPVNEKDVVYPD 424


>gi|8096202|dbj|BAA96101.1| unnamed protein product [Actinobacillus actinomycetemcomitans]
          Length = 460

 Score =  116 bits (290), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 101/391 (25%), Positives = 182/391 (46%), Gaps = 25/391 (6%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM----LNLDI 114
           ++Q    +  + VS P  AD  +    T  ++ K  G+  V   G DG+ +    +N+D 
Sbjct: 41  LVQTKEKIDTIFVSSPNIADYEILDDNTFIIYAKEEGRTEVTAFGADGRPLTSDTVNVDS 100

Query: 115 LIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDS---QRAV--------EL 163
           ++   IA     L+    ++N+ V+ V    V+ G  R+ ++S   +R V        ++
Sbjct: 101 VV-TSIADTNKQLKSRFPNTNLSVKKVGKAYVIEGKARSQEESDEVRRIVGEALGSGRKV 159

Query: 164 SETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS 223
           +ET L +             V++  NIA   Q+ +K+++ EV + + + +G   S   + 
Sbjct: 160 TETKLGEDSLPFLDKYHYDGVVDNANIADTTQINVKLSVVEVNKKLSEAMGINWSHV-AG 218

Query: 224 SGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQ 283
           SGP       FGG F    G       LD       ++AL+  +  + LAEP ++ +SG+
Sbjct: 219 SGPLVGGNFGFGGGFNGNQGVLR----LDAKGISAFINALDNQSNGKVLAEPNISMLSGE 274

Query: 284 SASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV 343
           +A    GG+  +       G+ ++   ++G+ L     +    RI L +   VS      
Sbjct: 275 TADILVGGEIPFAQ-RDRDGSPTIIYKEFGIKLAVAAKLQKNNRIRLALDQTVSTIAGNY 333

Query: 344 N---AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
           N    G++P +  RKA +  E+ +G + ++ GL   +  +    +PLL  IPILG+ FR+
Sbjct: 334 NFDGIGNIPFFNTRKAKSLFEVANGESFIIGGLFSSNDLEGINKVPLLGDIPILGSFFRS 393

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           +   R++ E+ I AT  +VKPV  +D+  PD
Sbjct: 394 ATTERDKKELVIVATVNVVKPVNEKDVVYPD 424


>gi|261867455|ref|YP_003255377.1| RcpA [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261412787|gb|ACX82158.1| RcpA [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 420

 Score =  116 bits (290), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 101/391 (25%), Positives = 182/391 (46%), Gaps = 25/391 (6%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM----LNLDI 114
           ++Q    +  + VS P  AD  +    T  ++ K  G+  V   G DG+ +    +N+D 
Sbjct: 1   MVQTKEKIDTIFVSSPNIADYEILDDNTFIIYAKEEGRTEVTAFGADGRPLTSDTVNVDS 60

Query: 115 LIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDS---QRAV--------EL 163
           ++   IA     L+    ++N+ V+ V    V+ G  R+ ++S   +R V        ++
Sbjct: 61  VV-TSIADTNKQLKSRFPNTNLSVKKVGKAYVIEGKARSQEESDEVRRIVGEALGSGRKV 119

Query: 164 SETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS 223
           +ET L +             V++  NIA   Q+ +K+++ EV + + + +G   S   + 
Sbjct: 120 TETKLGEDSLPFLDKYHYDGVVDNANIADTTQINVKLSVVEVNKKLSEAMGINWSHV-AG 178

Query: 224 SGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQ 283
           SGP       FGG F    G       LD       ++AL+  +  + LAEP ++ +SG+
Sbjct: 179 SGPLVGGNFGFGGGFNGNQGVLR----LDAKGISAFINALDNQSNGKVLAEPNISMLSGE 234

Query: 284 SASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV 343
           +A    GG+  +       G+ ++   ++G+ L     +    RI L +   VS      
Sbjct: 235 TADILVGGEIPFAQ-RDRDGSPTIIYKEFGIKLAVAAKLQKNNRIRLALDQTVSTIAGNY 293

Query: 344 N---AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
           N    G++P +  RKA +  E+ +G + ++ GL   +  +    +PLL  IPILG+ FR+
Sbjct: 294 NFDGIGNIPFFNTRKAKSLFEVANGESFIIGGLFSSNDLEGINKVPLLGDIPILGSFFRS 353

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           +   R++ E+ I AT  +VKPV  +D+  PD
Sbjct: 354 ATTERDKKELVIVATVNVVKPVNEKDVVYPD 384


>gi|119773845|ref|YP_926585.1| putative type II and III secretion system outermembrane protein,
           secretin [Shewanella amazonensis SB2B]
 gi|119766345|gb|ABL98915.1| putative type II and III secretion system outermembrane protein,
           secretin [Shewanella amazonensis SB2B]
          Length = 423

 Score =  116 bits (290), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 116/412 (28%), Positives = 202/412 (49%), Gaps = 49/412 (11%)

Query: 65  DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLE 124
           +V+ V+V +       V   + + L G++ G +++ L   DG  +  L +++ ++ A   
Sbjct: 28  NVERVVVGNGGVLSAKVLDEKNVILIGESEGLSDIQLWQKDG-TVRKLSVVVTKENAQTT 86

Query: 125 M-TLRRFIAD-SNIRVEMVSDTVVLHGMVRTIQDS--QRAVELSETFLSQSGRNQYANSS 180
           + T++R +A+  +I V      +V+HG     Q    ++ ++  +  L      +Y  S 
Sbjct: 87  VGTMKRMLAEFPSIEVTESDGVIVIHGEADASQRETLEKVLDGKDNILPLIKYVKYGKSI 146

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHS--ITGSSSGPSKSFAAD--FG- 235
                       E  V ++V I E  +  L  IG Q    ++G + G +K+F A+  F  
Sbjct: 147 ------------EPMVKMEVKIVEFNKSTLNNIGVQWENVMSGPAFGAAKAFTANPIFSV 194

Query: 236 ---GKFV-SEGGDFS-VKGVLDR--FSFETVLHAL--------ERATAIRTLAEPTLTAI 280
              G++  S GG  S   GVLD   +S+  ++  +        E+  A R LAEP LT  
Sbjct: 195 SSPGQYANSIGGAVSDAIGVLDTRGWSYFGIVTGIGSQIQLLAEKGDA-RMLAEPNLTTR 253

Query: 281 SGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVS--E 338
           SG++ASF +GG+   +TVS   G+  +   +YG+ L+  P V +   I  R+  EVS  +
Sbjct: 254 SGEAASFLAGGEIPIRTVSG-VGSVDIQYKEYGIRLNIEPVVDADNNIVSRVMAEVSAVD 312

Query: 339 PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALF 398
           P I +  G  P +  R+ ++ + + +  T+V++GL+  ++ ++    PLL  IPILG LF
Sbjct: 313 PSIQLE-GSAPGFLTRRTESVINVKNKQTMVISGLVNSEMSKVVNKFPLLGDIPILGELF 371

Query: 399 RNSRFNREETEIFIAATPFLVKP---VAMRDLSRPDDHYSVEDDAK--AFFF 445
           ++  F  E+TE+ I  TP +V P      + LSR  +   V+D AK  AF+ 
Sbjct: 372 KSRNFREEKTELVIFVTPTVVYPGEDSHEKSLSRAREL--VDDAAKLEAFYI 421


>gi|307133496|dbj|BAJ19008.1| RcpA [Aggregatibacter actinomycetemcomitans]
          Length = 460

 Score =  116 bits (290), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 101/391 (25%), Positives = 182/391 (46%), Gaps = 25/391 (6%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM----LNLDI 114
           ++Q    +  + VS P  AD  +    T  ++ K  G+  V   G DG+ +    +N+D 
Sbjct: 41  LVQTKEKIDTIFVSSPNIADYEILDDNTFIIYAKEEGRTEVTAFGADGRPLTSDTVNVDS 100

Query: 115 LIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDS---QRAV--------EL 163
           ++   IA     L+    ++N+ V+ V    V+ G  R+ ++S   +R V        ++
Sbjct: 101 VV-TSIADTNKQLKSRFPNTNLSVKKVGKAYVIEGKARSQEESDEVRRIVGEALGSGRKV 159

Query: 164 SETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS 223
           +ET L +             V++  NIA   Q+ +K+++ EV + + + +G   S   + 
Sbjct: 160 TETKLGEDSLPFLDKYHYDGVVDNANIADTTQINVKLSVVEVNKKLSEAMGINWSHV-AG 218

Query: 224 SGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQ 283
           SGP       FGG F    G       LD       ++AL+  +  + LAEP ++ +SG+
Sbjct: 219 SGPLVGGNFGFGGGFNGNQGVLR----LDAKGISAFINALDNQSNGKILAEPNISMLSGE 274

Query: 284 SASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV 343
           +A    GG+  +       G+ ++   ++G+ L     +    RI L +   VS      
Sbjct: 275 TADILVGGEIPFAQ-RDRDGSPTIIYKEFGIKLAVAAKLQKNNRIRLALDQTVSTIAGNY 333

Query: 344 N---AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
           N    G++P +  RKA +  E+ +G + ++ GL   +  +    +PLL  IPILG+ FR+
Sbjct: 334 NFDGIGNIPFFNTRKAKSLFEVANGESFIIGGLFSSNDLEGINKVPLLGDIPILGSFFRS 393

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           +   R++ E+ I AT  +VKPV  +D+  PD
Sbjct: 394 ATTERDKKELVIVATVNVVKPVNEKDVVYPD 424


>gi|307548787|dbj|BAJ19109.1| RcpA [Aggregatibacter actinomycetemcomitans]
 gi|307548802|dbj|BAJ19123.1| RcpA [Aggregatibacter actinomycetemcomitans]
          Length = 460

 Score =  116 bits (290), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 101/391 (25%), Positives = 182/391 (46%), Gaps = 25/391 (6%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM----LNLDI 114
           ++Q    +  + VS P  AD  +    T  ++ K  G+  V   G DG+ +    +N+D 
Sbjct: 41  LVQTKEKIDTIFVSSPNIADYEILDDNTFIIYAKEEGRTEVTAFGADGRPLTSDTVNVDS 100

Query: 115 LIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDS---QRAV--------EL 163
           ++   IA     L+    ++N+ V+ V    V+ G  R+ ++S   +R V        ++
Sbjct: 101 VV-TSIADTNKQLKSRFPNTNLSVKKVGKAYVIEGKARSQEESDEVRRIVGEALGSGRKV 159

Query: 164 SETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS 223
           +ET L +             V++  NIA   Q+ +K+++ EV + + + +G   S   + 
Sbjct: 160 TETKLGEDSLPFLDKYHYDGVVDNANIADTTQINVKLSVVEVNKKLSEAMGINWSHV-AG 218

Query: 224 SGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQ 283
           SGP       FGG F    G       LD       ++AL+  +  + LAEP ++ +SG+
Sbjct: 219 SGPLVGGNFGFGGGFNGNQGVLR----LDAKGISAFINALDNQSNGKVLAEPNISMLSGE 274

Query: 284 SASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV 343
           +A    GG+  +       G+ ++   ++G+ L     +    RI L +   VS      
Sbjct: 275 TADILVGGEIPFAQ-RDRDGSPTIIYKEFGIKLAVAAKLQKNNRIRLALDQTVSTIAGNY 333

Query: 344 N---AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
           N    G++P +  RKA +  E+ +G + ++ GL   +  +    +PLL  IPILG+ FR+
Sbjct: 334 NFDGIGNIPFFNTRKAKSLFEVANGESFIIGGLFSSNDLEGINKVPLLGDIPILGSFFRS 393

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           +   R++ E+ I AT  +VKPV  +D+  PD
Sbjct: 394 ATTERDKKELVIVATVNVVKPVNEKDVIYPD 424


>gi|258624763|ref|ZP_05719694.1| Flp pilus assembly protein [Vibrio mimicus VM603]
 gi|258582925|gb|EEW07743.1| Flp pilus assembly protein [Vibrio mimicus VM603]
          Length = 347

 Score =  115 bits (289), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 104/331 (31%), Positives = 154/331 (46%), Gaps = 42/331 (12%)

Query: 123 LEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLS-----------QS 171
           L+ TL     D +I V  V D VVL G V + +   +   L    L            ++
Sbjct: 2   LKQTLIARFPDESISVSNVGDQVVLDGTVSSEEVKYKIYRLVGEMLKKNVSKVNNHVIET 61

Query: 172 GRN------QY-ANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSS 224
           G N      QY A      V+N L +   +Q+ +K+TIAEV    L ++G  +   G   
Sbjct: 62  GENNREEALQYTATYVYDGVINNLKVLTTEQINVKLTIAEVSSSFLSELGVSYGDIG--- 118

Query: 225 GPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQS 284
                   D G KF ++  DF+ + ++       ++ A       + LAEP L+ ISG++
Sbjct: 119 ------GGDVG-KFYNKLLDFTAQDIV------AIIAASGNDDIGQVLAEPNLSVISGET 165

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN 344
           ASF  GG+         T   ++   +YG+ L     V     I L +  EVS  +  VN
Sbjct: 166 ASFLVGGEIPLAIKEDDT--YTIHYKEYGIKLSMVAKVTDSENIRLSLLPEVS-SLDSVN 222

Query: 345 AGD-----MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFR 399
             D      PS + RKA TTV+L  G + VLAGLL  + ++    IP+L  IPILGALF 
Sbjct: 223 RSDNSSYNFPSLKTRKAQTTVQLKDGQSFVLAGLLTTEERESLRKIPILGDIPILGALFS 282

Query: 400 NSRFNREETEIFIAATPFLVKPVAMRDLSRP 430
           +++ +R++TE+ I AT  LV PV    +  P
Sbjct: 283 STKSDRKKTELIIVATVNLVDPVKTEQVKLP 313


>gi|187478776|ref|YP_786800.1| pilus assembly protein [Bordetella avium 197N]
 gi|115423362|emb|CAJ49896.1| putative pilus assembly protein [Bordetella avium 197N]
          Length = 426

 Score =  115 bits (289), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 99/342 (28%), Positives = 154/342 (45%), Gaps = 37/342 (10%)

Query: 85  RTMYLFGKNVGQANV-ILIGHDGKQMLNLDILIERDIAHLEMTLRRFIAD-SNIRVEMVS 142
           + + LF +  G ++V +  G  G +   L ++      H+   + + +A    +R+ +V 
Sbjct: 67  KEVILFARKEGVSSVHVWRGQSGVRAYALRVM-PAGFGHIRAEVEQLLAAMPALRLSVVG 125

Query: 143 DTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQ-VTLKVT 201
             +V+ G      D QR   L++ +               +V++L    G +Q V L V 
Sbjct: 126 HHLVIEGSGLPDHDKQRISALAQRY--------------PEVLDLTGDVGWEQMVLLDVQ 171

Query: 202 IAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLH 261
           + E+ R  L ++G   S+    S P +S A  +G      G     +           L 
Sbjct: 172 VVELPRARLTELGMHWSMGAEGSHPVRSHAGVWG-SLQWSGAAIGAR-----------LQ 219

Query: 262 ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPT 321
           AL +      LA P L A SG +ASF +GG+  Y+   S     S     YGV L  TP 
Sbjct: 220 ALAQRGEAVFLARPRLLARSGSAASFLAGGEVPYRGAESEA---STVFKPYGVSLKITPR 276

Query: 322 VLSPGRIGLRIQTEVS--EPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQ 379
           +   G I   I+ E S  +P + V AG  P+ R R+A+T   +PSG T+VL G L  ++ 
Sbjct: 277 IDPRGTIRSHIEVESSSIDPTLTVPAG--PAMRTRRAETEFNVPSGQTLVLGGFLGRELS 334

Query: 380 QLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
               G+P LS IP+LG LF   R    +TE+ I  TP +V+P
Sbjct: 335 SETRGVPWLSDIPVLGLLFGERRQQNRDTELAIFVTPTIVRP 376


>gi|73539231|ref|YP_299598.1| type II and III secretion system protein [Ralstonia eutropha
           JMP134]
 gi|72122568|gb|AAZ64754.1| type II and III secretion system protein [Ralstonia eutropha
           JMP134]
          Length = 469

 Score =  115 bits (289), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/254 (31%), Positives = 128/254 (50%), Gaps = 28/254 (11%)

Query: 193 EDQVTLKVTIAEVRRDILKQIGF--------------------QHSITGSSSGPSKSFAA 232
            + V + V + E+ + +LK++G                     + + T  + G + SF+A
Sbjct: 179 SNTVQVDVKVVEISKTVLKEVGINFFRNNSGFAFGSFSPSTLSKFTFTPGTGGANGSFSA 238

Query: 233 DFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQ 292
           D      +    F++        F   +  LE     R LAEP+L A+SGQSASF SGG+
Sbjct: 239 DITTPISNA---FNLVAASLSHGFFANISLLEANGLARVLAEPSLVALSGQSASFLSGGE 295

Query: 293 HLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PV--IGVNAGDM 348
            +   V  + G T++    +G+ L  +PTVLS  RI L++  E S+  P   I +N   +
Sbjct: 296 -IPIPVPQALGTTTIQFKPFGIGLTVSPTVLSDQRIALKVAPEASDLDPSRGIAINGAIV 354

Query: 349 PSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREET 408
           P+   R+ADTT+EL  G + V+ GL+  +       +P L  +P++G  F+N  F++E+ 
Sbjct: 355 PAIVTRRADTTIELGDGESFVIGGLVSRNTVSNVNKVPFLGDLPVIGPFFKNLNFHQEDR 414

Query: 409 EIFIAATPFLVKPV 422
           E+ I  TP LVKP+
Sbjct: 415 ELMIVVTPRLVKPL 428


>gi|307730006|ref|YP_003907230.1| type II and III secretion system protein [Burkholderia sp.
           CCGE1003]
 gi|307584541|gb|ADN57939.1| type II and III secretion system protein [Burkholderia sp.
           CCGE1003]
          Length = 490

 Score =  115 bits (289), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 112/429 (26%), Positives = 186/429 (43%), Gaps = 89/429 (20%)

Query: 66  VQDVLVSDPTKADV-VVHSPRT--MYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAH 122
           ++ V + DP+ ADV ++   +T  + L GK+ G  NV+L        L+  + +    A 
Sbjct: 41  LRRVAIGDPSVADVLIIKGDKTGGVLLVGKSPGSTNVMLWEQGKDAPLSYVVNVSSPAA- 99

Query: 123 LEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQ------------ 170
                +  +      V ++ D+ ++ G   T++  QRAV  +     Q            
Sbjct: 100 -----KSLLGPGTPSVRVLGDSALISGSAPTMEAHQRAVAAAAIEARQRATLGTVANSAA 154

Query: 171 ------------------SGRNQYANS-SSKKVMNLLNIAGEDQVTLKVTIA-------- 203
                             SG +  A S ++    +  +  G+ Q+    T+A        
Sbjct: 155 NSAAAGASVGRGGRGTAVSGMSGAAGSDATNGGASFASAMGDAQIYDTSTVATRSVVQVD 214

Query: 204 ----EVRRDILKQIGFQ---------------HSITGSSSGPSKSF------AADFGGKF 238
               E  R +LKQ+G                  +++ ++ GP+ SF      ++ F   F
Sbjct: 215 VRVVEFSRTVLKQVGLNILKQNNGFTFGSFAPSALSSATYGPTPSFNSVAPISSAFNLVF 274

Query: 239 VSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV 298
            S     + +G+    S       +E     R LAEPTL A+SGQSASF +GG+ +   +
Sbjct: 275 NS-----ATRGLFADLSL------MESNNLARILAEPTLVALSGQSASFLAGGE-IPVPI 322

Query: 299 SSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVR 354
               G TS+    YGV L  TPTVLSP RI L++  E S+      + ++   +P+   R
Sbjct: 323 PQGLGTTSIEYKPYGVGLTLTPTVLSPQRIALKVAPEASQLDFANAVTISGVSVPAITTR 382

Query: 355 KADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAA 414
           + DTTVEL  G + V+ GL+  +       +PLL  +P++GA F+   + + + E+ I  
Sbjct: 383 RTDTTVELGDGESFVIGGLIDRETISNVAKVPLLGDLPVIGAFFKQLNYQQNDKELVIIV 442

Query: 415 TPFLVKPVA 423
           TP LV P+A
Sbjct: 443 TPHLVSPLA 451


>gi|255658704|ref|ZP_05404113.1| putative type II/III secretion system protein [Mitsuokella
           multacida DSM 20544]
 gi|260849091|gb|EEX69098.1| putative type II/III secretion system protein [Mitsuokella
           multacida DSM 20544]
          Length = 548

 Score =  115 bits (288), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 108/425 (25%), Positives = 188/425 (44%), Gaps = 57/425 (13%)

Query: 50  ISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM 109
           +SI LN+   L    ++  V +++P  ADV +    ++ + G + G   + +   +G + 
Sbjct: 31  LSIDLNQSYYLNTGRNITRVAIANPKIADVSLLDGTSLNVIGISPGTTTLNVWASNGYR- 89

Query: 110 LNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVR---------TI------ 154
               I +    + L   ++  I   ++RV+M+   ++L G V+         TI      
Sbjct: 90  YEYRITVSDQDSGLAKIVQDAIGLPDVRVQMIGGKILLRGTVKNQYERNLAYTIAKLYAK 149

Query: 155 -------QDSQRAVELSETFLSQSGRNQYAN-----------------SSSKKVMNLLNI 190
                  QD  + V  +E+  S +   +Y N                 S+   V+NLL +
Sbjct: 150 GSNSSPSQDQGQYVSTTESKSSMTPDGRYENKTVTNDSYQRTPRDTSGSTGDSVVNLLEM 209

Query: 191 AGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAA-DFGGKFVSE-------G 242
              DQ+ ++    E+     K +G  ++    S   S      D G  +  E       G
Sbjct: 210 TNPDQINIEAMFVELGTSDAKNLGINYASQDMSDTDSSGIKMNDVGTYYAGESYGRQRSG 269

Query: 243 GD--FSVKGVLDRFS-FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVS 299
           G+  ++   +   FS     +HAL      R ++ P +T +SG++AS   GG+  Y+  S
Sbjct: 270 GNHWYNSNWLFTHFSKINAEIHALIENGKARVISRPNVTTMSGKNASILIGGEVPYQE-S 328

Query: 300 SSTGATSVTTHDYGVVLH-FTPTVLSPGRIGLRIQTEVS----EPVIGVNAGDMPSYRVR 354
           +  G+T+ +   YG+ +  + PTV   G I   ++T+VS       +  +   MP    R
Sbjct: 329 NGFGSTTTSYKTYGIGIQLWKPTVDQDGNITTELETQVSRLDWNNAVTKDGYRMPGIATR 388

Query: 355 KADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAA 414
            A TTV +PSG T+V+ GLL  +     + +PLL  IPILG LF+    +R++TEI +  
Sbjct: 389 SAYTTVNIPSGMTMVIGGLLNSNDANTIQKVPLLGNIPILGELFKYHNKSRQKTEIVVLI 448

Query: 415 TPFLV 419
           TP +V
Sbjct: 449 TPRVV 453


>gi|330873797|gb|EGH07946.1| type II/III secretion system protein [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 384

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 105/367 (28%), Positives = 162/367 (44%), Gaps = 51/367 (13%)

Query: 63  PVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIE-RDIA 121
           PV +  + V DP  ADV V+      L G   G  ++++            + +  R  A
Sbjct: 24  PVAIPRIAVGDPKIADVHVNGTDGFLLTGVAQGTTSLMVWTACATAPRQSMVFVRGRATA 83

Query: 122 HLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSS 181
            +  T+    AD+ +  ++ +D               R +E+S T L Q+G + +   S+
Sbjct: 84  SMVETVPAPSADAELPSQVQTDI--------------RFIEVSRTKLKQAGTSIFGKGSN 129

Query: 182 KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFA-ADFGGKFVS 240
             +       G       VT+                  G+ SG   S   A+     V 
Sbjct: 130 NFLF------GAPGTVPGVTVTP----------------GTVSGALPSIPLAESAFNIVW 167

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
            GG   V G         +L+ALE +    TLA P+L A+SGQSASF +GG+      ++
Sbjct: 168 GGGSSKVLG---------ILNALENSGFAYTLARPSLVALSGQSASFLAGGEFPVPVPNT 218

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKA 356
                S+   ++GV L  TPTV+   RI L++  EVSE      I +    +P  R R+ 
Sbjct: 219 EGNGISIEYKEFGVRLTLTPTVVGRNRILLKVAPEVSELDFTSEISIAGTTVPIIRTRRT 278

Query: 357 DTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATP 416
           DT++ L  G + V++GL+        E  P L  IPILGA FR+S+  R+E E+ +  TP
Sbjct: 279 DTSIALADGESFVVSGLINTSNISTVEKFPGLGDIPILGAFFRSSKIQRDERELLMIVTP 338

Query: 417 FLVKPVA 423
            LV+P+A
Sbjct: 339 HLVQPLA 345


>gi|284048526|ref|YP_003398865.1| type II and III secretion system protein [Acidaminococcus
           fermentans DSM 20731]
 gi|283952747|gb|ADB47550.1| type II and III secretion system protein [Acidaminococcus
           fermentans DSM 20731]
          Length = 590

 Score =  114 bits (286), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 102/384 (26%), Positives = 177/384 (46%), Gaps = 33/384 (8%)

Query: 71  VSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRF 130
           V +P  ADV + S     L GK  G   +++   +G++  N  + +    A     ++  
Sbjct: 49  VGNPEIADVRLLSGNDFLLVGKKPGSTTLLVWSDNGREEYN--VFVSGSDAGTAQAIQEA 106

Query: 131 IADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFL-SQSGRNQYANSSSKK------ 183
           I    ++V+M++  V+L G V+   +   A+++++ +L S  G    A +  K+      
Sbjct: 107 IGYPEVQVQMMNGKVLLRGRVQNQYEHDSAIKVAQMYLGSGGGTTSTAQAGGKEGTAAQG 166

Query: 184 ------VMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQH---SITGSSSGPSKSFAADF 234
                 ++++L++    QV L   I E+     K +G Q+   ++  +++G S S     
Sbjct: 167 GTTDSNIIDMLDMTEPTQVRLVAQIIEINTSAEKDLGIQYWSPTLGDNTTGNSNSTDITR 226

Query: 235 G--GKFVSEGGDFSVKGVLDRF-----SFETVLHALERATAIRTLAEPTLTAISGQSASF 287
           G  G F +    +  +G    F     +    L AL  +   R L+ P++T +SGQ A  
Sbjct: 227 GTPGLFYAGENFYKQRGSFGWFGSHLSNLNASLQALVTSGKARILSRPSITTMSGQKAKI 286

Query: 288 TSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIG--VNA 345
             GG+    T S+  G  ++   DYGV L   P V +  +I  ++  EVS    G  V  
Sbjct: 287 LIGGRIPIPT-SAGDGQIAIDWRDYGVKLDIEPVVDADNKITSKVHAEVSTLDYGHSVKE 345

Query: 346 GD--MPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRF 403
            D  +P+   R+A+  + + SG T+ + GLL  +  +    IPLL  IPI+G  FR++  
Sbjct: 346 NDFSIPAIASREAEAMINVRSGMTMAIGGLLNSEDSKSVSKIPLLGDIPIIGQFFRHTST 405

Query: 404 NREETEIFIAATPFLV---KPVAM 424
            R+  E+ I  TP LV    PV+M
Sbjct: 406 TRDNRELLILITPLLVGDDSPVSM 429


>gi|26000712|gb|AAN75208.1| RcpA [Aggregatibacter actinomycetemcomitans]
          Length = 460

 Score =  114 bits (286), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 100/391 (25%), Positives = 181/391 (46%), Gaps = 25/391 (6%)

Query: 59  ILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQM----LNLDI 114
           ++Q    +  + VS P  AD  +    T  ++ K  G+  V   G DG+ +    +N+D 
Sbjct: 41  LVQTKEKIDTIFVSSPNIADYEILDDNTFIIYAKEEGRTEVTAFGADGRPLTSDTVNVDS 100

Query: 115 LIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDS---QRAV--------EL 163
           ++   IA     L+    ++N+ V+ V    V+ G  R+ ++S   +R V        ++
Sbjct: 101 VV-TSIADTNKQLKSRFPNTNLSVKKVGKAYVIEGKARSQEESDEVRRIVGEALGSGRKV 159

Query: 164 SETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSS 223
           +ET L +             V++  NIA   Q+ +K+++ EV + + + +G   S   + 
Sbjct: 160 TETKLGEDSLPFLDKYHYDDVVDNANIADTTQINVKLSVVEVNKKLSEAMGINWSHV-AG 218

Query: 224 SGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQ 283
           SGP       FGG F    G       LD       ++AL+  +  + L EP ++ +SG+
Sbjct: 219 SGPLVGGNFGFGGGFNGNQGVLR----LDAKGISAFINALDNQSNGKVLPEPNISMLSGE 274

Query: 284 SASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGV 343
           +A    GG+  +       G+ ++   ++G+ L     +    RI L +   VS      
Sbjct: 275 TADILVGGEIPFAQ-RDRDGSPTIIYKEFGIKLAVAAKLQKNNRIRLALDQTVSTIAGNY 333

Query: 344 N---AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
           N    G++P +  RKA +  E+ +G + ++ GL   +  +    +PLL  IPILG+ FR+
Sbjct: 334 NFDGIGNIPFFNTRKAKSLFEVANGESFIIGGLFSSNDLEGINKVPLLGDIPILGSFFRS 393

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           +   R++ E+ I AT  +VKPV  +D+  PD
Sbjct: 394 ATTERDKKELVIVATVNVVKPVNEKDVIYPD 424


>gi|320322730|gb|EFW78823.1| type II/III secretion system protein [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320330485|gb|EFW86464.1| type II/III secretion system protein [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 416

 Score =  114 bits (285), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 105/367 (28%), Positives = 162/367 (44%), Gaps = 51/367 (13%)

Query: 63  PVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIE-RDIA 121
           PV +  + V DP  ADV V+      L G   G  ++++            + +  R  A
Sbjct: 56  PVAITRIAVGDPKIADVHVNGTDGFLLTGVAQGTTSLMVWTACATAPRQSMVFVRGRATA 115

Query: 122 HLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSS 181
            +  T+    AD+ +  ++ +D               R +E+S T L Q+G + +   S+
Sbjct: 116 SMVETVPAPSADAELPSQVQTDI--------------RFIEVSRTKLKQAGTSIFGKGSN 161

Query: 182 KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFA-ADFGGKFVS 240
             +       G       VT+                  G+ SG   S   A+     V 
Sbjct: 162 NFLF------GAPGTVPGVTVTP----------------GTVSGALPSIPLAESAFNIVW 199

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
            GG   V G         +L+ALE +    TLA P+L A+SGQSASF +GG+      ++
Sbjct: 200 GGGSSKVLG---------ILNALENSGFAYTLARPSLVALSGQSASFLAGGEFPVPVPNT 250

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKA 356
                S+   ++GV L  TPTV+   RI L++  EVSE      I +    +P  R R+ 
Sbjct: 251 EGNGISIEYKEFGVRLTLTPTVVGRNRILLKVAPEVSELDFTSEISIAGTTVPIIRTRRT 310

Query: 357 DTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATP 416
           DT++ L  G + V++GL+        E  P L  IPILGA FR+S+  R+E E+ +  TP
Sbjct: 311 DTSIALADGESFVVSGLINTSNISTVEKFPGLGDIPILGAFFRSSKIQRDERELLMIVTP 370

Query: 417 FLVKPVA 423
            LV+P+A
Sbjct: 371 HLVQPLA 377


>gi|187926427|ref|YP_001892772.1| type II and III secretion system protein [Ralstonia pickettii 12J]
 gi|241665914|ref|YP_002984273.1| type II and III secretion system protein [Ralstonia pickettii 12D]
 gi|187728181|gb|ACD29345.1| type II and III secretion system protein [Ralstonia pickettii 12J]
 gi|240867941|gb|ACS65601.1| type II and III secretion system protein [Ralstonia pickettii 12D]
          Length = 454

 Score =  114 bits (285), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 84/257 (32%), Positives = 129/257 (50%), Gaps = 30/257 (11%)

Query: 188 LNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGS-----SSGPSKSFAADFGGKFVSE- 241
           +N+ G  QV ++V   E  + +LK+ GF    T       +  PS      FG   +S  
Sbjct: 163 MNVPGTVQVDVRVV--EFSKTVLKEAGFTFGRTRGGFDFRTFAPSSLSKVTFGSNGLSTE 220

Query: 242 -----GGDFSV------KGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSG 290
                G  F++      KG+    S       LE     R LAEP+L A+SGQSA+F +G
Sbjct: 221 STMPIGSAFNLLVSSVSKGLFADLSL------LESNGMARVLAEPSLVALSGQSANFLAG 274

Query: 291 GQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAG 346
           G+ +   V  + G T++    +G+ L  +PT+LS  RI L++  E S+      + +N  
Sbjct: 275 GE-IPIPVPQALGTTTIEYKPFGIGLTVSPTILSENRIALKVAPEASDLDFSRGVTLNGA 333

Query: 347 DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNRE 406
            +P+   R+ADTTVEL  G + V+ GL+        + +P L  +PI+G  F+   +N+E
Sbjct: 334 TVPAIVTRRADTTVELGDGESFVIGGLVSRSTLSNVDKVPFLGDVPIIGTFFKRLNYNQE 393

Query: 407 ETEIFIAATPFLVKPVA 423
           E E+ I  TP LVKP+A
Sbjct: 394 ERELVIIVTPHLVKPMA 410


>gi|330963696|gb|EGH63956.1| type III secretion component [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 174

 Score =  114 bits (285), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 66/162 (40%), Positives = 94/162 (58%), Gaps = 5/162 (3%)

Query: 285 ASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PV 340
           ASF +G + +   V  +     +    YGV L F+PT+L  GRI L+++ EVS       
Sbjct: 1   ASFLAGSE-VAVPVPVNREVVGIEYKPYGVSLLFSPTLLPNGRIALQVRPEVSSLMSTST 59

Query: 341 IGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRN 400
           + VN   +PS+RVR+ADT VE+ SG T  +AGL + +  Q  + +P+L  +PILG LFR+
Sbjct: 60  LDVNGYQVPSFRVRRADTRVEVGSGQTFAIAGLFQRESSQDMDKVPMLGDMPILGNLFRS 119

Query: 401 SRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKA 442
            RF R ETE+ I  TP+LV+PV  R ++ P D       A A
Sbjct: 120 KRFQRNETELVILITPYLVEPVKARVVATPLDKQRAASTASA 161


>gi|170720034|ref|YP_001747722.1| type II and III secretion system protein [Pseudomonas putida W619]
 gi|169758037|gb|ACA71353.1| type II and III secretion system protein [Pseudomonas putida W619]
          Length = 419

 Score =  114 bits (284), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 126/246 (51%), Gaps = 18/246 (7%)

Query: 195 QVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEG------------ 242
           QV   +   EVRR   K+ G +   +GS++    S      G  V+ G            
Sbjct: 136 QVQADIRFVEVRRTKYKEAGARLFFSGSNNSLIGS-PGTVPGTSVTPGAVPVTSPQIPLN 194

Query: 243 -GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS 301
            G F++        F   ++ALE +    TLA P+LT +SG +ASF +GG+      S+ 
Sbjct: 195 NGVFNIVWGGGSSRFLAAINALENSGFAYTLARPSLTVLSGLTASFLAGGEIPIPVPSAG 254

Query: 302 TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKAD 357
           +   S+   ++GV L  TPTV+S  RI L++  EVSE      + +    +P   +R+ D
Sbjct: 255 SDNFSIEYKEFGVRLALTPTVISRDRITLKVAPEVSELDYTNAVTIGGTSVPGLSIRRTD 314

Query: 358 TTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPF 417
           T++ L  G + +++GL+ ++ +   + +P L  +PILGA FR S   REETE+ +  TP 
Sbjct: 315 TSISLADGESFIISGLVGNNTRSAVDKLPGLGNLPILGAFFRQSALVREETELLMIVTPH 374

Query: 418 LVKPVA 423
           LV+P+A
Sbjct: 375 LVQPLA 380


>gi|309778769|ref|ZP_07673542.1| roadblock/LC7 domain protein [Ralstonia sp. 5_7_47FAA]
 gi|308922477|gb|EFP68101.1| roadblock/LC7 domain protein [Ralstonia sp. 5_7_47FAA]
          Length = 454

 Score =  114 bits (284), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 129/257 (50%), Gaps = 30/257 (11%)

Query: 188 LNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGS-----SSGPSKSFAADFGGKFVSE- 241
           +N+ G  QV ++V   E  + +LK+ GF    T       +  PS      FG   +S  
Sbjct: 163 MNVPGTVQVDVRVV--EFSKTVLKEAGFTFGRTRGGFDFRTFAPSSLSKVTFGSNGLSTE 220

Query: 242 -----GGDFSV------KGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSG 290
                G  F++      KG+    S       LE     R LAEP+L A+SGQSA+F +G
Sbjct: 221 STMPIGSAFNLLVSSVSKGLFADLSL------LESNGMARVLAEPSLVALSGQSANFLAG 274

Query: 291 GQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAG 346
           G+ +   V  + G T++    +G+ L  +PT+LS  RI L++  E S+      + +N  
Sbjct: 275 GE-IPIPVPQALGTTTIEYKPFGIGLTVSPTILSENRIALKVAPEASDLDFSRGVTLNGA 333

Query: 347 DMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNRE 406
            +P+   R+ADTTVEL  G + V+ GL+        + +P L  +P++G  F+   +N+E
Sbjct: 334 TVPAIVTRRADTTVELGDGESFVIGGLVSRSTLSNVDKVPFLGDVPVIGTFFKRLNYNQE 393

Query: 407 ETEIFIAATPFLVKPVA 423
           E E+ I  TP LVKP+A
Sbjct: 394 ERELVIIVTPHLVKPMA 410


>gi|152989020|ref|YP_001350207.1| putative type II secretion system protein [Pseudomonas aeruginosa
           PA7]
 gi|150964178|gb|ABR86203.1| probable type II secretion system protein [Pseudomonas aeruginosa
           PA7]
          Length = 408

 Score =  113 bits (283), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 80/245 (32%), Positives = 131/245 (53%), Gaps = 17/245 (6%)

Query: 194 DQVTLKVTIAEVRRDILKQI-------GFQHSITGS--SSGPSKSFA--ADFGGKFVSEG 242
           +QV   +   EV R  LKQ        G    + G+  S G  K  A  +  GG F +  
Sbjct: 124 NQVQTDIRFVEVSRSKLKQASTSFVRRGGNLWVLGAPGSLGDIKVNADGSGLGGTFGAGA 183

Query: 243 GDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST 302
             F++  +     + + ++ALE +    TLA P+L A+SGQSASF +GG+      + + 
Sbjct: 184 SGFNL--IFGGGKWLSFMNALEGSGFAYTLARPSLVAMSGQSASFLAGGEFPIPVPNGTN 241

Query: 303 GATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE--PVIGVNAGDM--PSYRVRKADT 358
              ++   ++G+ L  TPTV++  RI L++  EVSE     G+ +G +  P+ RVR+ DT
Sbjct: 242 DNVTIEYKEFGIRLTLTPTVMNNRRIALKVAPEVSELDYSAGIQSGGVAVPALRVRRTDT 301

Query: 359 TVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFL 418
           +V L  G + V++GL   +     +  P L  IPILGA FR+++ ++++ E+ +  TP L
Sbjct: 302 SVMLADGESFVISGLTSSNSVSNVDKFPWLGDIPILGAFFRSTKLDKDDRELLMIVTPHL 361

Query: 419 VKPVA 423
           V+P+A
Sbjct: 362 VQPLA 366


>gi|330811024|ref|YP_004355486.1| type II secretion system protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379132|gb|AEA70482.1| putative type II secretion system protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 407

 Score =  113 bits (283), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 64/169 (37%), Positives = 98/169 (57%), Gaps = 4/169 (2%)

Query: 259 VLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHF 318
           +++ALE +    TLA P+L A+SGQSASF +GG+      S+ +   S+   ++G+ L  
Sbjct: 200 MINALEGSGFAYTLARPSLVALSGQSASFLAGGEVPIPVPSAGSDNVSIEYKEFGIRLTL 259

Query: 319 TPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLL 374
           TPTV+   RI L++  EVSE      + +    +P+  VR+ DT++ L  G + V++GL+
Sbjct: 260 TPTVIGKNRIALKVAPEVSELDFTNAVNIAGTLVPALTVRRTDTSIALADGESFVISGLI 319

Query: 375 KDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA 423
                      P L  IPILGA FR++  NREE E+ +  TP LV+P+A
Sbjct: 320 STRNSSQVNKFPGLGDIPILGAFFRDNSINREERELLMIVTPHLVQPLA 368


>gi|107100112|ref|ZP_01364030.1| hypothetical protein PaerPA_01001133 [Pseudomonas aeruginosa PACS2]
          Length = 408

 Score =  113 bits (282), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 107/180 (59%), Gaps = 5/180 (2%)

Query: 256 FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVV 315
           + + ++ALE +    TLA P+L A+SGQSASF +GG+      + +    ++   ++G+ 
Sbjct: 195 WLSFMNALEGSGFAYTLARPSLVAMSGQSASFLAGGEFPIPVPNGTNDNVTIEYKEFGIR 254

Query: 316 LHFTPTVLSPGRIGLRIQTEVSE--PVIGVNAGDM--PSYRVRKADTTVELPSGGTIVLA 371
           L  TPTV++  RI L++  EVSE     G+ +G +  P+ RVR+ DT+V L  G + V++
Sbjct: 255 LTLTPTVMNNRRIALKVAPEVSELDYSAGIQSGGVAVPALRVRRTDTSVMLADGESFVIS 314

Query: 372 GLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           GL   +     +  P L  IPILGA FR+++ ++++ E+ +  TP LV+P+A  D   PD
Sbjct: 315 GLTSSNSVSNVDKFPWLGDIPILGAFFRSTKLDKDDRELLMIVTPHLVQPLAA-DAQLPD 373


>gi|149927033|ref|ZP_01915291.1| type II/III secretion system protein [Limnobacter sp. MED105]
 gi|149824254|gb|EDM83474.1| type II/III secretion system protein [Limnobacter sp. MED105]
          Length = 473

 Score =  113 bits (282), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 125/409 (30%), Positives = 184/409 (44%), Gaps = 60/409 (14%)

Query: 50  ISIGLNKVIILQ-VPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVG--------QANVI 100
           +S G  KVI L  +P  V    + DPT A V V  P      GKN G         +  +
Sbjct: 47  LSTGFQKVISLPGIPARVS---IGDPTIASVTVLKPTDRG--GKNAGVLVTGLKTGSTSL 101

Query: 101 LIGHDGKQMLN-LDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQR 159
           LI   G  M   + + +    A    TL+    D N+  E     + L G    +   Q+
Sbjct: 102 LIWDRGASMARVITVSVTGKAAETISTLK----DLNLETE--GQVLKLSGSTPNVSTYQQ 155

Query: 160 AVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIG----- 214
           A E     L + G    ++    ++++   I     V + V + E  R  L+++G     
Sbjct: 156 ARE----SLIKPG----SDGKPAELIDQATIQTSGTVQVDVKVVEFTRSELQRLGINLTG 207

Query: 215 ------FQHSITGSSS-----GPSKSFAADF-GGKFVSEG--GDFSVKGVLDR-FSFETV 259
                 F +SI G +S     G S +F+  F G   V E   G  +   V  R     + 
Sbjct: 208 QVNGGGFTYSIAGPASVSGSGGVSNAFSLAFNGAGCVGEAVIGALNPTPVGPRTCDLVSG 267

Query: 260 LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFT 319
           L+ L+     + LAEP+L A SGQ ASF +GG+ +   V S  G   +    +GV L FT
Sbjct: 268 LNILQADGYAKVLAEPSLIAQSGQDASFLAGGE-IPIPVPSGNGTIGIEYKKFGVGLSFT 326

Query: 320 PTVLSPGRIGLRIQTEVSE-------PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAG 372
           PT+LS   I LR+  EVS+        + GV    +P+   R+A TTVEL    + V+ G
Sbjct: 327 PTILSNKTIALRVSPEVSDLDFSRGTSIQGV---LVPAILTRRASTTVELGENQSFVIGG 383

Query: 373 LLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
           L+  +I      +P LS+IPILGA F+ + ++RE+ E+ I  TP  VKP
Sbjct: 384 LISRNIIANANRVPWLSEIPILGAFFKGNTYSREDKELLIIVTPRFVKP 432


>gi|71735124|ref|YP_276550.1| type II/III secretion system protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71555677|gb|AAZ34888.1| bacterial type II/III secretion system protein [Pseudomonas
           syringae pv. phaseolicola 1448A]
          Length = 416

 Score =  113 bits (282), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 106/366 (28%), Positives = 158/366 (43%), Gaps = 49/366 (13%)

Query: 63  PVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAH 122
           PV +  + V DP  ADV V+      L G   G  + +++           ++  R  A 
Sbjct: 56  PVAITRIAVGDPKIADVHVNGTDGFLLTGVAQGTTS-LMVWTACATAPRQSMVFVRGRAT 114

Query: 123 LEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSK 182
             M            VE V        +   +Q   R +E+S T L Q+G + +   S+ 
Sbjct: 115 TSM------------VETVPAPSADAELPSQVQTDIRFIEVSRTKLKQAGTSIFGKGSNN 162

Query: 183 KVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFA-ADFGGKFVSE 241
            +       G       VT+                  G+ SG   S   A+     V  
Sbjct: 163 FLF------GAPGTVPGVTVTP----------------GTVSGALPSIPLAESAFNIVWG 200

Query: 242 GGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSS 301
           GG   V G+L         +ALE +    TLA P+L A+SGQSASF +GG+      ++ 
Sbjct: 201 GGSSKVLGIL---------NALENSGFAYTLARPSLVALSGQSASFLAGGEFPVPVPNTE 251

Query: 302 TGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKAD 357
               S+   ++GV L  TPTV+   RI L++  EVSE      I +    +P  R R+ D
Sbjct: 252 GNGISIEYKEFGVRLTLTPTVVGRNRILLKVAPEVSELDFTSEISIAGTTVPIIRTRRTD 311

Query: 358 TTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPF 417
           T++ L  G + V++GL+        E  P L  IPILGA FR+S+  R+E E+ +  TP 
Sbjct: 312 TSIALADGESFVVSGLINTSNISTVEKFPGLGDIPILGAFFRSSKIQRDERELLMIVTPH 371

Query: 418 LVKPVA 423
           LV+P+A
Sbjct: 372 LVQPLA 377


>gi|116052338|ref|YP_792649.1| putative type II secretion system protein [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|115587559|gb|ABJ13574.1| putative type II secretion system protein [Pseudomonas aeruginosa
           UCBPP-PA14]
          Length = 416

 Score =  113 bits (282), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 107/180 (59%), Gaps = 5/180 (2%)

Query: 256 FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVV 315
           + + ++ALE +    TLA P+L A+SGQSASF +GG+      + +    ++   ++G+ 
Sbjct: 203 WLSFMNALEGSGFAYTLARPSLVAMSGQSASFLAGGEFPIPVPNGTNDNVTIEYKEFGIR 262

Query: 316 LHFTPTVLSPGRIGLRIQTEVSE--PVIGVNAGDM--PSYRVRKADTTVELPSGGTIVLA 371
           L  TPTV++  RI L++  EVSE     G+ +G +  P+ RVR+ DT+V L  G + V++
Sbjct: 263 LTLTPTVMNNRRIALKVAPEVSELDYSAGIQSGGVAVPALRVRRTDTSVMLADGESFVIS 322

Query: 372 GLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           GL   +     +  P L  IPILGA FR+++ ++++ E+ +  TP LV+P+A  D   PD
Sbjct: 323 GLTSSNSVSNVDKFPWLGDIPILGAFFRSTKLDKDDRELLMIVTPHLVQPLAA-DAQLPD 381


>gi|313106823|ref|ZP_07793035.1| RcpA [Pseudomonas aeruginosa 39016]
 gi|310879537|gb|EFQ38131.1| RcpA [Pseudomonas aeruginosa 39016]
          Length = 416

 Score =  113 bits (282), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 107/180 (59%), Gaps = 5/180 (2%)

Query: 256 FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVV 315
           + + ++ALE +    TLA P+L A+SGQSASF +GG+      + +    ++   ++G+ 
Sbjct: 203 WLSFMNALEGSGFAYTLARPSLVAMSGQSASFLAGGEFPIPVPNGTNDNVTIEYKEFGIR 262

Query: 316 LHFTPTVLSPGRIGLRIQTEVSE--PVIGVNAGDM--PSYRVRKADTTVELPSGGTIVLA 371
           L  TPTV++  RI L++  EVSE     G+ +G +  P+ RVR+ DT+V L  G + V++
Sbjct: 263 LTLTPTVMNNRRIALKVAPEVSELDYSAGIQSGGVAVPALRVRRTDTSVMLADGESFVIS 322

Query: 372 GLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           GL   +     +  P L  IPILGA FR+++ ++++ E+ +  TP LV+P+A  D   PD
Sbjct: 323 GLTSSNSVSNVDKFPWLGDIPILGAFFRSTKLDKDDRELLMIVTPHLVQPLAA-DAQLPD 381


>gi|218893396|ref|YP_002442265.1| RcpA [Pseudomonas aeruginosa LESB58]
 gi|254239026|ref|ZP_04932349.1| hypothetical protein PACG_05203 [Pseudomonas aeruginosa C3719]
 gi|296391003|ref|ZP_06880478.1| putative type II secretion system protein [Pseudomonas aeruginosa
           PAb1]
 gi|126170957|gb|EAZ56468.1| hypothetical protein PACG_05203 [Pseudomonas aeruginosa C3719]
 gi|218773624|emb|CAW29438.1| RcpA [Pseudomonas aeruginosa LESB58]
          Length = 416

 Score =  113 bits (282), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 107/180 (59%), Gaps = 5/180 (2%)

Query: 256 FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVV 315
           + + ++ALE +    TLA P+L A+SGQSASF +GG+      + +    ++   ++G+ 
Sbjct: 203 WLSFMNALEGSGFAYTLARPSLVAMSGQSASFLAGGEFPIPVPNGTNDNVTIEYKEFGIR 262

Query: 316 LHFTPTVLSPGRIGLRIQTEVSE--PVIGVNAGDM--PSYRVRKADTTVELPSGGTIVLA 371
           L  TPTV++  RI L++  EVSE     G+ +G +  P+ RVR+ DT+V L  G + V++
Sbjct: 263 LTLTPTVMNNRRIALKVAPEVSELDYSAGIQSGGVAVPALRVRRTDTSVMLADGESFVIS 322

Query: 372 GLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           GL   +     +  P L  IPILGA FR+++ ++++ E+ +  TP LV+P+A  D   PD
Sbjct: 323 GLTSSNSVSNVDKFPWLGDIPILGAFFRSTKLDKDDRELLMIVTPHLVQPLAA-DAQLPD 381


>gi|15599500|ref|NP_252994.1| RcpA [Pseudomonas aeruginosa PAO1]
 gi|254244885|ref|ZP_04938207.1| hypothetical protein PA2G_05758 [Pseudomonas aeruginosa 2192]
 gi|9950526|gb|AAG07692.1|AE004846_9 RcpA [Pseudomonas aeruginosa PAO1]
 gi|126198263|gb|EAZ62326.1| hypothetical protein PA2G_05758 [Pseudomonas aeruginosa 2192]
          Length = 416

 Score =  113 bits (282), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 107/180 (59%), Gaps = 5/180 (2%)

Query: 256 FETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVV 315
           + + ++ALE +    TLA P+L A+SGQSASF +GG+      + +    ++   ++G+ 
Sbjct: 203 WLSFMNALEGSGFAYTLARPSLVAMSGQSASFLAGGEFPIPVPNGTNDNVTIEYKEFGIR 262

Query: 316 LHFTPTVLSPGRIGLRIQTEVSE--PVIGVNAGDM--PSYRVRKADTTVELPSGGTIVLA 371
           L  TPTV++  RI L++  EVSE     G+ +G +  P+ RVR+ DT+V L  G + V++
Sbjct: 263 LTLTPTVMNNRRIALKVAPEVSELDYSAGIQSGGVAVPALRVRRTDTSVMLADGESFVIS 322

Query: 372 GLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPD 431
           GL   +     +  P L  IPILGA FR+++ ++++ E+ +  TP LV+P+A  D   PD
Sbjct: 323 GLTSSNSVSNVDKFPWLGDIPILGAFFRSTKLDKDDRELLMIVTPHLVQPLAA-DAQLPD 381


>gi|83749638|ref|ZP_00946621.1| GspD-related protein; cpaC1 [Ralstonia solanacearum UW551]
 gi|83723699|gb|EAP70894.1| GspD-related protein; cpaC1 [Ralstonia solanacearum UW551]
          Length = 401

 Score =  113 bits (282), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 84/308 (27%), Positives = 150/308 (48%), Gaps = 34/308 (11%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQ 108
           ++++ + K  ++Q+P  V++  V +P     ++ SP+T+YL G+ VG  N+I+ G  G  
Sbjct: 99  EVTVPVGKSTMVQLPEPVRNRTVGNPHIVQAMLVSPQTLYLLGQEVGTTNMIVQGRSGSC 158

Query: 109 MLNLDILIERDIAHLEMTLRRFIADS-NIRVEMVSDTVVLHGMVRTIQDSQRAVELSETF 167
            + +D+ +  D   L+ TLR  +  + N++V   +D++VL G V     +Q+ ++++  F
Sbjct: 159 SV-IDVSVGADPGGLQSTLRTLMPGAKNVQVSAAADSLVLGGSVSDSVQAQKVLDIANAF 217

Query: 168 LSQSGRNQY----------------------ANSSSKKVMNLLNIAGEDQVTLKVTIAEV 205
           +    R                         A   S +++N++ +    QV L+V +AEV
Sbjct: 218 VMHQTRGPAQGDQGGAAQGGGAMQGLGATPGAPPRSPRIINMMAVEAPQQVMLEVKVAEV 277

Query: 206 RRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALER 265
            + ++ Q+G   ++ G+    S +F A     F+S   D       +    +  L A + 
Sbjct: 278 SKTLIDQMGSALNVNGAFG--SWTFGAL--ANFLSGSNDIVNFSKNNHLPLKFALDAQKG 333

Query: 266 ATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTT-----HDYGVVLHFTP 320
              ++ LAEP+L AISGQ ASF +GG+ ++  VS       V         +GV L FTP
Sbjct: 334 DGLVKVLAEPSLMAISGQEASFLAGGK-VFIPVSQGAATNGVANIILXEETFGVGLRFTP 392

Query: 321 TVLSPGRI 328
           TV+  GRI
Sbjct: 393 TVMEKGRI 400


>gi|238027562|ref|YP_002911793.1| type II and III secretion system protein [Burkholderia glumae BGR1]
 gi|237876756|gb|ACR29089.1| Type II and III secretion system protein [Burkholderia glumae BGR1]
          Length = 476

 Score =  113 bits (282), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 95/168 (56%), Gaps = 5/168 (2%)

Query: 260 LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFT 319
           L  LE+    R LA+PTL A+SGQSA+F +GG+ +   V  + G  S+    YG+ L   
Sbjct: 271 LSILEQNNLARILAQPTLVALSGQSANFLAGGE-IPVPVPQALGTVSIEWKPYGIGLTVA 329

Query: 320 PTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLK 375
           PTVL P RI L++  E S+      I +N   +P+   R+ADTTVEL  G + V+ GL+ 
Sbjct: 330 PTVLGPNRIALKVAPEASQLDFVNAITINGVTVPALTTRRADTTVELGDGESYVIGGLVD 389

Query: 376 DDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVA 423
            +       +P L  +PI+GA F++  + + + E+ I  TP LV P+A
Sbjct: 390 RETTSNLSKVPFLGDLPIIGAFFKSLSYQQNDKELVIIVTPHLVSPIA 437


>gi|257487974|ref|ZP_05642015.1| type III secretion component, putative [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 170

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 84/135 (62%), Gaps = 4/135 (2%)

Query: 312 YGVVLHFTPTVLSPGRIGLRIQTEVSE----PVIGVNAGDMPSYRVRKADTTVELPSGGT 367
           YGV L F+PT+L  GRI L+++ EVS       + VN   +PS+RVR+ADT VE+ SG T
Sbjct: 23  YGVSLLFSPTLLPNGRIALQVRPEVSSLMSTTTLDVNGYQVPSFRVRRADTRVEVGSGQT 82

Query: 368 IVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDL 427
             +AGL + +  Q  + +P+L  +PILG LFR+ RF R ETE+ I  TP+LV+PV  R +
Sbjct: 83  FAIAGLFQRESSQDMDKVPMLGDMPILGNLFRSKRFQRNETELVILITPYLVEPVKDRVV 142

Query: 428 SRPDDHYSVEDDAKA 442
           + P D       A A
Sbjct: 143 ATPLDKQRAASTASA 157


>gi|325108834|ref|YP_004269902.1| type II and III secretion system protein [Planctomyces brasiliensis
           DSM 5305]
 gi|324969102|gb|ADY59880.1| type II and III secretion system protein [Planctomyces brasiliensis
           DSM 5305]
          Length = 736

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 104/425 (24%), Positives = 183/425 (43%), Gaps = 49/425 (11%)

Query: 33  NAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGK 92
           +A ++++  VE    +K+ + LN+  +++    V  + ++DPT  D+         + G 
Sbjct: 58  DARIVSMPQVE----RKLELVLNRSQLVKTRSRVTRMAIADPTVIDIAPFEEDEFAIIGT 113

Query: 93  NVGQANVILIGHDGKQML----------NLDILIERDIAHLEMTLRRFIADSNIRVEMVS 142
            +G   + L   +    L          N++  +  D   LE  +     +S + +  + 
Sbjct: 114 AIGSTTLTLWFENDDNPLIYEVTVIDDPNVEEQLRIDYGKLERKIAILFPNSKVYLIPLH 173

Query: 143 DTVVLHGMVRTIQDSQRAVELSE-TFLSQSG-----------------------RNQYAN 178
           + +V+ G  +   ++ R +++    FL   G                            +
Sbjct: 174 EKLVVKGQAKDAAEAARILQIVRGEFLDDYGGLYGPNGGAGRGGGGGGGYDDDGIRDEDD 233

Query: 179 SSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKF 238
             S  ++N+L + GE QV L VTIAE+ R  L+++G   ++  ++          F G  
Sbjct: 234 LYSSFIVNMLQVPGEYQVMLHVTIAELNRSQLRRMGVDFAVLFAN-------GQHFIGST 286

Query: 239 VSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTV 298
           +S GG  ++ G+ +      +++AL      + L+ P+LT +SG  A F +GG+    T 
Sbjct: 287 IS-GGVPTLTGIFNNGDISVLINALASNGTAKILSRPSLTTLSGHPAQFLAGGEFAVPTT 345

Query: 299 SSSTG--ATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKA 356
               G   TS     +G  +   PTV+      LRI  E S+     + G +P    R+ 
Sbjct: 346 VGVGGVQGTSTQFRGFGTSMVVVPTVVDGDLFRLRIAPEFSQINQNNSVGGIPGLDSRRV 405

Query: 357 DTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGAL-FRNSRFNREETEIFIAAT 415
            TTVEL  G TIVL GLL          IPLL +IP++G L F   R   +E E+ +  T
Sbjct: 406 QTTVELREGQTIVLGGLLSRQTASEVTRIPLLGEIPLIGPLMFNTKRATEDELELLVLVT 465

Query: 416 PFLVK 420
           P +V+
Sbjct: 466 PEIVR 470


>gi|222111308|ref|YP_002553572.1| type II and iii secretion system protein [Acidovorax ebreus TPSY]
 gi|221730752|gb|ACM33572.1| type II and III secretion system protein [Acidovorax ebreus TPSY]
          Length = 356

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 107/344 (31%), Positives = 160/344 (46%), Gaps = 38/344 (11%)

Query: 103 GHDGKQMLNLDILIERDI-AHLEMTLRRFIA-DSNIRVEMVSDTVVLHGMVRTIQDSQRA 160
             +G Q +N ++ +  D  A   M LR+ ++ D  I V  V D VVL GM    QDS   
Sbjct: 4   ARNGTQ-INYEVTVSADHHAKTAMELRQLLSHDKGINVSAVGDKVVLDGMYAN-QDS--- 58

Query: 161 VELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQ-------VTLKVTIAEVRRDILKQI 213
                     + + Q    +  +V+NL+    EDQ       V L V + EVR+  L  I
Sbjct: 59  ----------AAKIQKIVKAYPQVLNLVRERPEDQLVV