RPSBLAST alignment for GI: 254780727 and conserved domain: TIGR02520

>gnl|CDD|162902 TIGR02520, pilus_B_mal_scr, type IVB pilus formation outer membrane protein, R64 PilN family. Several related protein families encode outer membrane pore proteins for type II secretion, type III secretion, and type IV pilus formation. This protein family appears to encode a secretin for pilus formation, although it is quite different from PilQ. Members include the PilN lipoprotein of the plasmid R64 thin pilus, a type IV pilus. Scoring between the trusted and noise cutoffs are examples of bundle-forming pilus B (bfpB). Length = 497
 Score = 40.3 bits (94), Expect = 0.001
 Identities = 47/196 (23%), Positives = 70/196 (35%), Gaps = 18/196 (9%)

Query: 195 QVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLD-R 253
           QV L V +  V+     Q G   S+   S        A+ G    +  G  +   V+D  
Sbjct: 260 QVLLNVKVLSVQFKGSDQTGVDWSLVYKSLSRFGLSLANAGTSTAATAGSSAGINVVDGP 319

Query: 254 FSFETVL-HALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTH-- 310
           F+  T L  AL     +  +  P++T ++ Q A F    Q  Y    S+T   +V +   
Sbjct: 320 FAGTTALIRALSTQGKVSVVTSPSVTTLNLQPAPFQIATQTGYLASQSTTVTANVGSSTD 379

Query: 311 ------DYGVVLHFTPTVLSPGRIGLRIQTEVSEPV----IGVNAG----DMPSYRVRKA 356
                   G  +   P +   G I L+     S+           G      P   VR  
Sbjct: 380 LEPGTITTGFNMTLLPDIRDDGDILLQFNISHSDLAQLRKFTSKDGGTKVQTPDTDVRNF 439

Query: 357 DTTVELPSGGTIVLAG 372
              V L SG T+VL+G
Sbjct: 440 SQRVNLKSGQTLVLSG 455