RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254780727|ref|YP_003065140.1| putative pilus assembly
protein [Candidatus Liberibacter asiaticus str. psy62]
         (474 letters)



>gnl|CDD|162900 TIGR02517, type_II_gspD, general secretion pathway protein D.  In
           Gram-negative bacteria, proteins that have first crossed
           the inner member by Sec-dependent protein transport can
           be exported across the outer membrane by type II
           secretion, also called the main terminal branch of the
           general secretion pathway. Members of this family are
           general secretion pathway protein D. In Yersinia
           enterocolitica, a second member of this family is part
           of a novel second type II secretion system specifically
           associated with virulence (See PubMed:12654803). This
           family is closely homologous to the type IV pilus outer
           membrane secretin PilQ (TIGR02515) and to the type III
           secretion system pore YscC/HrcC (TIGR02516).
          Length = 594

 Score =  115 bits (291), Expect = 2e-26
 Identities = 73/266 (27%), Positives = 112/266 (42%), Gaps = 32/266 (12%)

Query: 194 DQVTLKVTIAEVRRDILKQIGFQHSITG-------------SSSGPSKSFAADFGGKFV- 239
            QV ++  I EV  D   ++G Q  I G             S S    S +A   G    
Sbjct: 330 AQVLVEAIIVEVSLDDALELGVQWLIAGTGGGVNFSTGSPNSGSLLGASASAISLGSAGI 389

Query: 240 -----SEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQ-- 292
                S      V G     +   +L+AL++ T    L+ P+L  +  Q A    G +  
Sbjct: 390 GLLVTSSSTTSGVGGTGGGPNLGVLLNALKQDTGFNVLSTPSLLTLDNQEAEINVGQEVP 449

Query: 293 ---HLYKTVSSSTGATSVTTHDY---GVVLHFTPTVLSPGRIGLRIQTEVSEP---VIGV 343
                Y T +  T A    T+     G+ L  TP +   G + L I  EVS      +G 
Sbjct: 450 VLTGSYNTGTGGTNANPFNTYQRKDVGIKLKVTPQINEGGTVRLEIYQEVSSVAPTTVGS 509

Query: 344 NAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRF 403
            A   P++  R+  T V + +G T+VL GL++D   +    +PLL  IP+LG LFR++  
Sbjct: 510 AASG-PTFNKREIKTVVLVDNGDTVVLGGLIQDKTSESVTKVPLLGDIPVLGWLFRSTTT 568

Query: 404 NREETEIFIAATPFLV-KPVAMRDLS 428
            R +T + +  TP ++  P   R L+
Sbjct: 569 ERTKTNLMVFITPRIIRDPEDARALT 594


>gnl|CDD|162901 TIGR02519, pilus_MshL, pilus (MSHA type) biogenesis protein MshL.
           Members of this family are predicted secretins, that is,
           outer membrane pore proteins associated with delivery of
           proteins from periplasm to the outside of the cell.
           Related families include GspD of type II secretion
           (TIGR02517), the YscC/HrcC family from type III
           secretion (TIGR02516), and the PilQ secretin of type IV
           pilus formation (TIGR02515). Members of this family are
           found in gene clusters associated with MSHA
           (mannose-sensitive hemagglutinin) and related pili, and
           appear to be the secretin of this pilus system.
          Length = 290

 Score = 92.4 bits (230), Expect = 2e-19
 Identities = 61/232 (26%), Positives = 98/232 (42%), Gaps = 32/232 (13%)

Query: 210 LKQIGFQHSITGSSSGPSK--SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERAT 267
            K +G  +S   S +  S    F  + G             GV   F F+++++ L    
Sbjct: 69  YKALGAANSNDSSGNQFSSGLGFLDNIG---------LPT-GVNSGFGFDSIINFLATFG 118

Query: 268 AIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSST----GATSVTTHDY-------GVVL 316
             + L+ P + A++ Q A  + G    Y T  SST    G TS  + D        G+VL
Sbjct: 119 DTKVLSNPKVMALNNQPAVISVGDNIRYVTEESSTGTTGGTTSTASSDTRVDSVFSGIVL 178

Query: 317 HFTPTVLSPGRIGLRIQTEVSE---------PVIGVNAGDMPSYRVRKADTTVELPSGGT 367
             TP +   G++ L +   +SE         PV       +P   V++  + + +  G T
Sbjct: 179 GVTPQISDDGKVILNVHPSISEVKPQSIDLNPVGNGAEVALPEISVKEMSSVLRVKDGDT 238

Query: 368 IVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLV 419
           +VL GL+       K G+P L  IP LG LF     ++++TE+ I   P +V
Sbjct: 239 VVLGGLIDKKKSNTKTGLPFLGDIPGLGYLFGYKSKSKKKTELVIIIRPSVV 290


>gnl|CDD|106878 PHA00019, IV, phage assembly protein.
          Length = 428

 Score = 91.8 bits (228), Expect = 3e-19
 Identities = 53/196 (27%), Positives = 92/196 (46%), Gaps = 11/196 (5%)

Query: 232 ADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSG- 290
           A       S GG F   G+ +       + ALE ++  R L+ P +  +SGQS   + G 
Sbjct: 235 ARLTTVLSSAGGSF---GIFNGNVLGLSVKALENSSNSRVLSRPRILTLSGQSGYISVGQ 291

Query: 291 ------GQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVN 344
                 G+   +  + +    ++   D GV L  TP V+  G++ L I T+         
Sbjct: 292 NVPFVTGRVTGEAANVNNPFQTIERKDVGVSLEVTPVVMGDGQLVLDIDTKADSLSDSTI 351

Query: 345 AGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFN 404
           A D+ + + R   TTV++  G T++L GL+  +       +P LSKIP++G LFR+   +
Sbjct: 352 ASDIITNQ-RSLQTTVQVKDGQTLLLGGLISSNNTDGDSSVPFLSKIPLIGWLFRSKSDS 410

Query: 405 REETEIFIAATPFLVK 420
            E+  +++  T  ++K
Sbjct: 411 NEQRTLYVLLTARVIK 426


>gnl|CDD|182549 PRK10560, hofQ, outer membrane porin HofQ; Provisional.
          Length = 386

 Score = 87.2 bits (216), Expect = 8e-18
 Identities = 69/237 (29%), Positives = 105/237 (44%), Gaps = 19/237 (8%)

Query: 195 QVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRF 254
           QV L   I  +    L+++G + +    +            G+  + G D SV     R 
Sbjct: 154 QVELAAHIVTINEKSLRELGVKWT-LADAQQAGGV------GQVTTLGSDLSVATATTRV 206

Query: 255 SF----------ETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGA 304
            F          +  L ALE+   +  +A P L A   Q AS   G +  Y+  S  +GA
Sbjct: 207 GFNIGRINGRLLDLELSALEQKQQLDIIASPRLLASHLQPASIKQGSEIPYQVSSGESGA 266

Query: 305 TSVTTHDYGVVLHFTPTVLSPGRI--GLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVEL 362
           TSV   +  + +  TPTVL  GRI   L I   V   V+    G++ +   ++ +T VE+
Sbjct: 267 TSVEFKEAVLGMEVTPTVLQKGRIRLKLHISQNVPGQVLQQADGEVLAIDKQEIETQVEV 326

Query: 363 PSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLV 419
            SG T+ L G+     +  ++ +PLL  IP LG LFR+     E  E+ +  TP LV
Sbjct: 327 KSGETLALGGIFSRKNKSGQDSVPLLGDIPWLGQLFRHDGKEDERRELVVFITPRLV 383


>gnl|CDD|162898 TIGR02515, IV_pilus_PilQ, type IV pilus secretin (or competence
           protein) PilQ.  A number of proteins homologous to PilQ
           are involved in type IV pilus formation, competence for
           transformation, type III secretion, and type II
           secretion (also called the main terminal branch of the
           general secretion pathway). Members of this family
           include PilQ itself, which is a component of the type IV
           pilus structure, from a number of species. In
           Haemophilus influenzae, the member of this family is
           associated with competence for transformation with
           exogenous DNA rather than with formation of a type IV
           pilus; the surface structure required for competence may
           be considered an unusual, incomplete type IV pilus
           structure.
          Length = 418

 Score = 77.7 bits (192), Expect = 6e-15
 Identities = 48/164 (29%), Positives = 84/164 (51%), Gaps = 6/164 (3%)

Query: 260 LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFT 319
           L ALE       ++ P +   + + A    G +  Y   +SS+GATSV   +  + L  T
Sbjct: 258 LSALESEGRGEIISSPRVVTANNKKAKIKQGTEIPY-QQTSSSGATSVEFKEAVLSLEVT 316

Query: 320 PTVLSPGRIGLRIQTEVSEPVIGVNA---GDMPSYRVRKADTTVELPSGGTIVLAGLLKD 376
           P +   GRI + +   VS+   GV A   G +P+   ++ +T V + +G T+V+ G+ + 
Sbjct: 317 PQITPDGRIIMDLL--VSKDSPGVVAQAGGGVPAIDKQEINTQVLVKNGETVVIGGIYEQ 374

Query: 377 DIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
                ++ +P L  IP+LG LF+ +  + E++E+ I  TP +V 
Sbjct: 375 TQTNSEDKVPFLGDIPVLGNLFKKTGKSDEKSELLIFITPRIVN 418


>gnl|CDD|184149 PRK13568, hofQ, putative outer membrane porin HofQ; Provisional.
          Length = 381

 Score = 73.2 bits (180), Expect = 1e-13
 Identities = 55/168 (32%), Positives = 84/168 (50%), Gaps = 12/168 (7%)

Query: 260 LHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFT 319
           L ALE+   +  +A P L     Q+AS   G +  Y   S  +G+TS+   +  + +  T
Sbjct: 217 LSALEQENQVDIIASPRLFTSHQQTASIKQGTEIPYTVSSGKSGSTSIEFKEAVLGMEVT 276

Query: 320 PTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKA--DTTVELPSGGTIVLAGLLKDD 377
           P +L  GRI L+++   + P   +  G+     + K    T V +  G TIVL G+ +  
Sbjct: 277 PKILRNGRITLKLKISQNMPGRTIKRGEGEMLAIDKQEIQTQVTVKDGETIVLGGIFQ-- 334

Query: 378 IQQLKEG---IPLLSKIPILGALFRNS--RFNREETEIFIAATPFLVK 420
            QQ ++    +PLL  IP+LGALFR    + +R E  IFI  TP L+ 
Sbjct: 335 -QQKRQSVNKVPLLGDIPLLGALFRQDTQQQSRRELVIFI--TPKLIS 379


>gnl|CDD|162899 TIGR02516, type_III_yscC, type III secretion outer membrane pore,
           YscC/HrcC family.  A number of proteins homologous to
           the type IV pilus secretin PilQ (TIGR02515) are involved
           in type IV pilus formation, competence for
           transformation, type III secretion, and type II
           secretion (also called the main terminal branch of the
           general secretion pathway). The clade described by this
           model contains the outer membrane pore proteins of
           bacterial type III secretion systems, typified by YscC
           for animal pathogens and HrcC for plant pathogens.
          Length = 462

 Score = 67.8 bits (166), Expect = 5e-12
 Identities = 51/235 (21%), Positives = 91/235 (38%), Gaps = 15/235 (6%)

Query: 195 QVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRF 254
            + +   I ++    L Q+G     T  +      F           G   S     D  
Sbjct: 235 LIEISAWIIDIDASDLSQLGVDWQATLGAGDRQTGFNV---SAGAGLGATGSSIVTSDGD 291

Query: 255 SFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGAT--SVTTHDY 312
            F   ++ALE+    + ++ P++  +    A   +  +  Y  VS    A   SVT    
Sbjct: 292 YFMARVNALEQTGKAKIVSRPSVLTLENVQAVLDNN-RTFYVKVSGERVADLESVT---A 347

Query: 313 GVVLHFTPTVLSPGRIGLRIQTEVS-----EPVIGVNAGD-MPSYRVRKADTTVELPSGG 366
           G  L  TP V+       +I+  V      +   G +  D +P  +  + +T   +  G 
Sbjct: 348 GTSLRVTPRVIGDEGAQRQIKLNVDIEDGQQKTDGTSTVDALPEIKRTEINTQARVGHGQ 407

Query: 367 TIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKP 421
           ++++ G  +D+     +GIPLL  IP+LG LFR++   +         TP +V+ 
Sbjct: 408 SLLIGGYYRDESADSVDGIPLLGDIPLLGNLFRSTSKEKSRVVRLFLITPKIVRD 462


>gnl|CDD|185244 PRK15346, PRK15346, outer membrane secretin SsaC; Provisional.
          Length = 499

 Score = 48.9 bits (117), Expect = 3e-06
 Identities = 56/230 (24%), Positives = 101/230 (43%), Gaps = 48/230 (20%)

Query: 195 QVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGG-------KFVSEGGDFSV 247
            + + V+I +V    + Q+G   S + S  G   SF + F           +S  G+F V
Sbjct: 272 MIEISVSIIDVDAGDINQLGIDWSASASLGGGKISFNSGFADGNASGFSTVISNTGNFMV 331

Query: 248 KGVLDRFSFETVLHALERATAIRTLAEP---TLT---AISGQSASFTSGGQHLYKTVSSS 301
           +           L+ALE+ +  + L++P   TL    A+  ++ +F       Y  +   
Sbjct: 332 R-----------LNALEKNSKAKILSQPSVVTLNNIQAVLDKNVTF-------YTKLQGE 373

Query: 302 TGAT--SVTTHDYGVVLHFTPTVLSPG-----RIGLRIQT-EVSEPVIGVNAGDMPSYRV 353
             A   S+TT   G +L  TP ++         + L IQ  + S      +  D P   V
Sbjct: 374 KVAKLESITT---GSLLRVTPRLIDDNGTQKVMLNLNIQDGQQSATQ---SETD-PLPEV 426

Query: 354 RKADTTVE--LPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNS 401
           + ++   +  L +G +++L G ++D   + +  IPLL  IP++G LFR++
Sb