RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780727|ref|YP_003065140.1| putative pilus assembly protein [Candidatus Liberibacter asiaticus str. psy62] (474 letters) >1b35_D CRPV, protein (cricket paralysis virus, VP4); insect picorna-like virus, icosahedral virus; 2.40A {Cricket paralysis virus} (D:) Length = 57 Score = 27.8 bits (61), Expect = 3.0 Identities = 10/21 (47%), Positives = 15/21 (71%) Query: 378 IQQLKEGIPLLSKIPILGALF 398 + Q+ EG+ LS IP+LG +F Sbjct: 18 LGQISEGLTTLSHIPVLGNIF 38 >3dy5_A Allene oxide synthase-lipoxygenase protein; fusion protein, BI-functional enzyme, calcium, cytoplasm, dioxygenase, fatty acid biosynthesis; HET: HEM; 3.51A {Plexaura homomalla} (A:494-583,A:761-1066) Length = 396 Score = 27.7 bits (61), Expect = 3.1 Identities = 6/53 (11%), Positives = 15/53 (28%), Gaps = 10/53 (18%) Query: 232 ADFGGKFVSEGGDFSVKGVLDRFS-------FETVLHALERATAI---RTLAE 274 + + + + + F + + H + A+ R LA Sbjct: 56 RSYQESRKAALVNLGIGSLFTMFENWDSYDDYHILTHLTTESFALSTWRNLAS 108 >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (A:1221-1330,A:1541-1688) Length = 258 Score = 27.5 bits (61), Expect = 3.3 Identities = 14/77 (18%), Positives = 21/77 (27%), Gaps = 15/77 (19%) Query: 392 PILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYS--VEDDAKAFFFNRVN 449 P L +R + E +I K +L +D F R Sbjct: 22 PNLNMKYRKRQLVTREAQI---------KDWVENELEALKLEAEEIPSEDQNEFLLERTR 72 Query: 450 KIYGPKEAS--EVEGQN 464 +I+ EA Q Sbjct: 73 EIH--NEAESQLRAAQQ 87 >2d73_A Alpha-glucosidase SUSB; glycoside hydrolase family 97, TIM barrel; 1.60A {Bacteroides thetaiotaomicron vpi-5482} PDB: 2zq0_A* 2jke_A* 2jka_A* 2jkp_A* (A:1-309) Length = 309 Score = 27.6 bits (61), Expect = 3.6 Identities = 15/92 (16%), Positives = 28/92 (30%), Gaps = 10/92 (10%) Query: 321 TVLSP-GRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQ 379 + SP + + Q V++ P+Y + + V PS + L Sbjct: 24 KLTSPDNNLVMTFQ---------VDSKGAPTYELTYKNKVVIKPSTLGLELKKEDNTRTD 74 Query: 380 QLKEGIPLLSKIPILGALFRNSRFNREETEIF 411 L+K+ L+ +T F Sbjct: 75 FDWVDRRDLTKLDSKTNLYDGFEVKDTQTATF 106 >3a24_A Alpha-galactosidase; glycoside hydrolase family 97, retaining glycosidase; HET: MES; 2.30A {Bacteroides thetaiotaomicron} (A:1-270) Length = 270 Score = 26.4 bits (58), Expect = 7.5 Identities = 6/36 (16%), Positives = 11/36 (30%), Gaps = 4/36 (11%) Query: 333 QTEVSEP----VIGVNAGDMPSYRVRKADTTVELPS 364 + P + GD +Y + + PS Sbjct: 1 RHMELSPDGNLKTTITIGDRLTYDITCNGRQILTPS 36 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (B:144-317,B:429-553) Length = 299 Score = 26.6 bits (58), Expect = 7.8 Identities = 16/130 (12%), Positives = 32/130 (24%), Gaps = 16/130 (12%) Query: 254 FSFETVLH-ALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDY 312 S+E+ + T + + A S + K + + + + Sbjct: 144 DSWESFFVSVRKAITVLFFIGVRCYEAYPNTSHLLVPASDLINKDLVKNNVSFNAKDIQI 203 Query: 313 GVVLHFTPTVLSPGRIGLR---IQTEVSEPV---IGVNAGDMPSYRVRKADTTVELPSGG 366 V F + L + + + PV A ++ GG Sbjct: 204 PVYDTFDGSDLRVLSGSISERIVDCIIRLPVKWETTTQFK---------ATHILDFGPGG 254 Query: 367 TIVLAGLLKD 376 L L Sbjct: 255 ASGLGVLTHR 264 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.318 0.135 0.372 Gapped Lambda K H 0.267 0.0578 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 3,323,958 Number of extensions: 147050 Number of successful extensions: 413 Number of sequences better than 10.0: 1 Number of HSP's gapped: 413 Number of HSP's successfully gapped: 14 Length of query: 474 Length of database: 4,956,049 Length adjustment: 92 Effective length of query: 382 Effective length of database: 1,845,989 Effective search space: 705167798 Effective search space used: 705167798 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 56 (25.7 bits)