HHsearch alignment for GI: 254780728 and conserved domain: PRK12617

>PRK12617 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed.
Probab=98.81  E-value=1.6e-08  Score=68.53  Aligned_cols=67  Identities=13%  Similarity=0.164  Sum_probs=61.7

Q ss_pred             EEEEEEECCCCCCCCEECHHHEEEEECCHHHCCCHHCCCCCCCCCCHHCCCCEEECCCCCCCCCCHHHCCCCC
Q ss_conf             0489997263688966275341315525133792000021124540000350442022788712555500146
Q gi|254780728|r   45 FINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG  117 (263)
Q Consensus        45 ~v~V~va~~di~~G~~It~~dl~~~~~p~~~~p~~a~~~~~~~~~~~~~~G~~~~~~i~~G~~i~~~~l~~~~  117 (263)
T Consensus        88 ~~~vvVaar~L~rG~~Ita~Dl~~~~~dl~~l~~g~~td~------~~~iG~~~rr~l~aG~~l~~~~L~~p~  154 (214)
T PRK12617         88 NQDVLVLRRGISAGETISLADISIEKRDAARIVGAVLADP------VAAVGKTARRILPAGSLLSANDLVTQR  154 (214)
T ss_pred             EEEEEEECCCCCCCCCCCHHHCEEEEEEHHHCCCCCCCCH------HHHCCHHEEECCCCCCCCCHHHCCCCC
T ss_conf             8889999031398999588993899982544487634898------896174338415898965867648621