HHsearch results for GI: 254780728 and protein with PDBid: 1wvo_A

>1wvo_A Sialic acid synthase; antifreeze protein like domain, N-acetylneuraminic acid phosphate synthase, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=97.99  E-value=4.6e-06  Score=52.74  Aligned_cols=62  Identities=19%  Similarity=0.174  Sum_probs=51.4

Q ss_pred             EEEEECCCCCCCCEECHHHEEEEECCHHHCCCHHCCCCCCCCCCHHCCCCEEECCCCCCCCCCHHHCCCCC
Q ss_conf             89997263688966275341315525133792000021124540000350442022788712555500146
Q gi|254780728|r   47 NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG  117 (263)
Q Consensus        47 ~V~va~~di~~G~~It~~dl~~~~~p~~~~p~~a~~~~~~~~~~~~~~G~~~~~~i~~G~~i~~~~l~~~~  117 (263)
                      .=+||+++|++|+.|+.+|+....-|..-+++..         .+++.|+.+..++.+|++|+.++|...+
T Consensus         7 ~SivA~~~I~kG~~it~~~l~~kr~p~~Gi~p~~---------~~~iiGkk~~~di~~ge~I~~~~i~n~~   68 (79)
T 1wvo_A            7 GSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPED---------IFNLVGKKVLVTVEEDDTIMEELVDNHG   68 (79)
T ss_dssp             CEEEESSCBCTTCBCCGGGEEEETTCCCSSCSSS---------HHHHTTCBBSSCBCTTCBCCGGGBCCCC
T ss_pred             EEEEECCCCCCCCCCCHHHCCCCCCCCCCCCHHH---------HHHHHCHHHHCCCCCCCCCCHHHHHHCC
T ss_conf             8688898338989914865604358999879899---------9998162744233895915899986046