HHsearch results for GI: 254780728 and protein with PDBid: 2wqp_A

>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transferase; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A
Probab=97.07  E-value=0.00058  Score=40.42  Aligned_cols=59  Identities=19%  Similarity=0.239  Sum_probs=47.5

Q ss_pred             EEEEEEECCCCCCCCEECHHHEEEEECCHHH-CCCHHCCCCCCCCCCHHCCCCEEECCCCCCCCCCHHHC
Q ss_conf             0489997263688966275341315525133-79200002112454000035044202278871255550
Q gi|254780728|r   45 FINVLISKGDLAVGMVVTPNILEWVAFPEEN-VFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL  113 (263)
Q Consensus        45 ~v~V~va~~di~~G~~It~~dl~~~~~p~~~-~p~~a~~~~~~~~~~~~~~G~~~~~~i~~G~~i~~~~l  113 (263)
                      ..+-++|+++|++|+.|+.+|+...+ |... +++         ...+.+.|+.+++++.+|++|..++|
T Consensus       289 ~~rs~~a~k~i~kG~~i~~~~i~~~R-p~~g~l~~---------~~~~~i~Gk~~~~~i~~~~~i~~~di  348 (349)
T 2wqp_A          289 AFASVVADKDIKKGELLSGDNLWVKR-PGNGDFSV---------NEYETLFGKVAACNIRKGAQIKKTDI  348 (349)
T ss_dssp             HSCEEEESSCBCTTCBCCTTTEEEES-CTTSSSBG---------GGGGGGTTCBBSSCBCTTCBCCGGGB
T ss_pred             HCEEEEEECCCCCCCEECHHHEEEEC-CCCCCCCH---------HHHHHHCCCEECCCCCCCCCCCHHHC
T ss_conf             14689994613889895689957878-97998499---------99998669177554589796897887