HHsearch results for GI: 254780728 and protein with PDBid: 3k3s_A

>3k3s_A Altronate hydrolase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 2.15A {Shigella flexneri 2a str}
Probab=91.12  E-value=0.12  Score=26.79  Aligned_cols=52  Identities=23%  Similarity=0.199  Sum_probs=36.1

Q ss_pred             CEEEEEEECCCCCCCCEECHHHEEEEECCHHHCCCHHCCCCCCCCCCHHCCCCEEECCCCCCCCCCHHH
Q ss_conf             704899972636889662753413155251337920000211245400003504420227887125555
Q gi|254780728|r   44 KFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEK  112 (263)
Q Consensus        44 ~~v~V~va~~di~~G~~It~~dl~~~~~p~~~~p~~a~~~~~~~~~~~~~~G~~~~~~i~~G~~i~~~~  112 (263)
                      +.=+|.||-+||++|+.|.-++....-  .+.+|.+               =|++..+|.+|++|.+.-
T Consensus        29 p~DNVaVAl~dl~~G~~v~~~~~~i~l--~~~Ip~G---------------HKiAl~dI~~Ge~IiKYG   80 (105)
T 3k3s_A           29 ALDNVAVALADLAEGTEVSVDNQTVTL--RQDVARG---------------HKFALTDIAKGANVIKYG   80 (105)
T ss_dssp             TTCSEEEESSCBCTTCEEEETTEEEEC--SSCBCTT---------------CEEESSCBCTTCEEEETT
T ss_pred             CCCCEEEECCCCCCCCEEEECCEEEEE--CCCCCCC---------------CEEEEEECCCCCEEEECC
T ss_conf             999899967636999999559917998--8668888---------------999841037999759999