BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780728|ref|YP_003065141.1| pilus assembly protein
[Candidatus Liberibacter asiaticus str. psy62]
         (263 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780728|ref|YP_003065141.1| pilus assembly protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040405|gb|ACT57201.1| pilus assembly protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 263

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 263/263 (100%), Positives = 263/263 (100%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV
Sbjct: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG
Sbjct: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
           LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID
Sbjct: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180

Query: 181 HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQ 240
           HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQ
Sbjct: 181 HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQ 240

Query: 241 EEGKEIQIIKAGVIVNKDGEGIS 263
           EEGKEIQIIKAGVIVNKDGEGIS
Sbjct: 241 EEGKEIQIIKAGVIVNKDGEGIS 263


>gi|315121892|ref|YP_004062381.1| pilus assembly protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495294|gb|ADR51893.1| pilus assembly protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 267

 Score =  328 bits (840), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 164/266 (61%), Positives = 213/266 (80%), Gaps = 3/266 (1%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK TRLMG+VVSG+FAL+AGIIAMRLVS HH+Q EE++ +   +  NVL++K +L VGMV
Sbjct: 1   MKFTRLMGLVVSGLFALLAGIIAMRLVSHHHLQKEEIVAQPSIRLSNVLMAKSNLKVGMV 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +TP++LEWVAFP ENV  GF+DDV +PNA++EL G +VR+PILKGDPIR EKLVD G  G
Sbjct: 61  ITPDVLEWVAFPAENVVVGFVDDVSRPNAIEELKGSIVRIPILKGDPIRFEKLVDHGQHG 120

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
           +SSLL KGKRA  +DIS+S+AVGG++KPNDHVDV+MVR + ERK    VVLSN+RV+AID
Sbjct: 121 VSSLLSKGKRAVALDISVSNAVGGLVKPNDHVDVLMVRLIGERKTKTDVVLSNVRVLAID 180

Query: 181 HNIDS--DERVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSDVW 237
             +D+  +   L+G+TATLELTPMQAK L+AAQ +A KL+LVLRSI+D + +  E +D  
Sbjct: 181 QTLDAEGEPNGLIGNTATLELTPMQAKTLLAAQQIASKLTLVLRSISDFHSTDLEIADFN 240

Query: 238 DVQEEGKEIQIIKAGVIVNKDGEGIS 263
             ++ G+ IQ+IK+G+I NKDGE +S
Sbjct: 241 LGEDGGRGIQVIKSGIISNKDGEEMS 266


>gi|222084468|ref|YP_002542997.1| pilus assembly protein [Agrobacterium radiobacter K84]
 gi|221721916|gb|ACM25072.1| pilus assembly protein [Agrobacterium radiobacter K84]
          Length = 270

 Score =  188 bits (477), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 107/261 (40%), Positives = 162/261 (62%), Gaps = 7/261 (2%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHH-VQTEEVITENPAKFINVLISKGDLAVGM 59
           MK  R+M + V+ V A +AG++AM L    + VQ  E + E  A  +NVL++  +L VG 
Sbjct: 1   MKPARIMILAVAVVTAGLAGLLAMHLAGSRNIVQQVETVVEKEAT-VNVLVADANLPVGS 59

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG 119
            +    + W+A+P+  V  G I    +P+A+++L+G +VR+PI +G+PIR EK+ D  + 
Sbjct: 60  RLNEKSIHWMAWPQSGVVKGLITQAERPDALKDLNGAVVRLPIFEGEPIREEKVADASSR 119

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAI 179
            LSSLLP GKRA   +IS+++  GG I PND VDV+MVR    +K     VLSN+R++A+
Sbjct: 120 ILSSLLPSGKRAVATEISVATGAGGFILPNDRVDVIMVRKGDTQKFVTETVLSNVRILAV 179

Query: 180 DHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADL-NPSSSEDS 234
           D  I+  +   + +VG+TATLELTP Q K L  AQ +A +L+L LRS+AD   P ++   
Sbjct: 180 DQQIEEKQDGSKAVVGTTATLELTPDQTKVLAVAQQMADRLTLALRSVADAQQPDTTAAD 239

Query: 235 DVWDVQEEGKEIQIIKAGVIV 255
            +      G  +Q+IK+G I+
Sbjct: 240 YLLSGDNGGAVVQVIKSGAII 260


>gi|325291660|ref|YP_004277524.1| components of type IV pilus [Agrobacterium sp. H13-3]
 gi|325059513|gb|ADY63204.1| components of type IV pilus [Agrobacterium sp. H13-3]
          Length = 268

 Score =  184 bits (468), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 114/270 (42%), Positives = 165/270 (61%), Gaps = 10/270 (3%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHV--QTEEVITENPAKFINVLISKGDLAVG 58
           MK +R++ + V+ V A +AGI+AM++     V  + E +I + P   +NVL+S  +L VG
Sbjct: 1   MKPSRIVILSVALVAAGLAGIVAMQISGAKQVIEKAETIIEKEPT--VNVLVSSVNLPVG 58

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN 118
             +  + + W  +P  NV D FI +   PNA+ EL G +VR+P+ +G+P+R EK+VD   
Sbjct: 59  SRLNDSSVHWTPWPTGNVIDSFITEAKNPNAITELSGAVVRLPLFQGEPVRPEKVVDSST 118

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIA 178
             +SSLLP GKRA   +IS+S+  GG + PND VDV+MVR           VL+N+RV+A
Sbjct: 119 RIMSSLLPAGKRAVATEISVSTGAGGFVLPNDRVDVIMVRKGDSGHFLTENVLNNVRVLA 178

Query: 179 IDHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDS 234
           ID  I   E     +VG+TATLELTP QAK +  AQ +A +L+L LRS+AD   + +  +
Sbjct: 179 IDQQIKEGEDGTSAVVGATATLELTPEQAKIITVAQQMADRLTLALRSVADAQENDTLSA 238

Query: 235 DVWDVQEEGK-EIQIIKAGVIVNKDGEGIS 263
                   G+ EIQ+IK+G IV K G+G S
Sbjct: 239 GYLLNGGSGQPEIQVIKSGSIV-KAGQGAS 267


>gi|227823970|ref|YP_002827943.1| pilus assembly protein CpaB [Sinorhizobium fredii NGR234]
 gi|227342972|gb|ACP27190.1| pilus assembly protein CpaB [Sinorhizobium fredii NGR234]
          Length = 271

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 105/264 (39%), Positives = 164/264 (62%), Gaps = 7/264 (2%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLV-SPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK  R++ + V+   A +AG++AM+L  SP     E ++ + P+  INVL++   L VG 
Sbjct: 1   MKPVRIIILAVAVGSAAMAGLLAMKLTRSPAQRMAEPLVEQAPS--INVLVASKSLPVGS 58

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG 119
            +  + + W+A+P++ V +G I + ++P A+ +L G +VR+P+  G+P+R EK+ D  N 
Sbjct: 59  RLGADSIHWLAWPKDGVAEGMITEENRPAAIDDLAGAVVRLPLFDGEPVRQEKIADPSNR 118

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAI 179
            +SSLLP GKRA   +I++++  GG I PND VDV+MVR           VLSN+RV+AI
Sbjct: 119 IMSSLLPAGKRAVATEITVATGAGGFILPNDRVDVIMVRKSDGDVYLTETVLSNVRVLAI 178

Query: 180 DHNI---DSDERVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSD 235
           D  +   D   + ++G+TATLELTP Q+K +  AQ +A ++SL LRS+AD   + +E +D
Sbjct: 179 DQQVEEKDDGSKSVIGTTATLELTPDQSKVMTVAQQMAERISLALRSVADAQEADTEAAD 238

Query: 236 VWDVQEEGKEIQIIKAGVIVNKDG 259
                +    IQ+IK+G IV  DG
Sbjct: 239 YLLSGDGQPSIQVIKSGSIVKNDG 262


>gi|15887574|ref|NP_353255.1| components of type IV pilus [Agrobacterium tumefaciens str. C58]
 gi|15155111|gb|AAK86040.1| components of type IV pilus [Agrobacterium tumefaciens str. C58]
          Length = 268

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 114/270 (42%), Positives = 166/270 (61%), Gaps = 10/270 (3%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHV--QTEEVITENPAKFINVLISKGDLAVG 58
           MK +R++ + V+ V A +AG++AM++     V  + E +I + P   +NVLIS  +L VG
Sbjct: 1   MKPSRIVILSVALVAAGLAGLVAMQISGAKQVIEKAETIIQKEPT--VNVLISSVNLPVG 58

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN 118
             +  + + W  +P+ NV D FI    +P+A+ EL G +VR+P+ +G+PIR EK+VD   
Sbjct: 59  SRLNDSSMRWTPWPQGNVVDSFITQAKRPDAITELAGTVVRLPLFEGEPIRPEKVVDSST 118

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIA 178
             +SSLLP GKRA   +IS+S+  GG + PND VDV+MVR           VL+N+RV+A
Sbjct: 119 RIMSSLLPAGKRAVATEISVSTGAGGFVLPNDRVDVIMVRKGENGNFLTENVLNNVRVLA 178

Query: 179 IDHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDS 234
           ID  I   E     +VG+TATLELTP QAK +  AQ +A +L+L LRS+AD   + +  +
Sbjct: 179 IDQQIKEGEDGIAAVVGATATLELTPEQAKIITVAQQMADRLTLALRSVADAQENDTLSA 238

Query: 235 DVWDVQEEGK-EIQIIKAGVIVNKDGEGIS 263
                   G+ EIQ+IK+G IV K G+G S
Sbjct: 239 GHLLSGSSGQPEIQVIKSGSIV-KSGQGAS 267


>gi|15963893|ref|NP_384246.1| putative pilus assembly signal peptide protein [Sinorhizobium
           meliloti 1021]
 gi|307315790|ref|ZP_07595304.1| Flp pilus assembly protein CpaB [Sinorhizobium meliloti BL225C]
 gi|307320425|ref|ZP_07599842.1| Flp pilus assembly protein CpaB [Sinorhizobium meliloti AK83]
 gi|15073068|emb|CAC41527.1| Putative pilus assembly signal peptide protein [Sinorhizobium
           meliloti 1021]
 gi|306893991|gb|EFN24760.1| Flp pilus assembly protein CpaB [Sinorhizobium meliloti AK83]
 gi|306898558|gb|EFN29231.1| Flp pilus assembly protein CpaB [Sinorhizobium meliloti BL225C]
          Length = 269

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 107/263 (40%), Positives = 161/263 (61%), Gaps = 5/263 (1%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+  R++ + V+   A +AG++AM+L      QT E + E  A  INVL++   L VG  
Sbjct: 1   MRPVRIIILAVAIGSAAMAGLLAMKLTRAPAPQTAEPVIEQ-APTINVLVAGKSLPVGSR 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +  + + W A+P++ V +G I + ++P A+++L G +VR+PI  G+P+R EK+ D  N  
Sbjct: 60  LGADSIHWKAWPKDGVAEGMITEENRPAAVEDLAGAVVRLPIFTGEPVRQEKIADASNRI 119

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
           +SSLLP GKRA   +I++++  GG I PND VDV+MVR           VLSN+RV+AID
Sbjct: 120 MSSLLPAGKRAVATEITVATGAGGFILPNDRVDVIMVRKSDGDLYLTETVLSNVRVLAID 179

Query: 181 HNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSDV 236
             I+  E   + +VG+TATLELTP Q+K +  AQ +A ++SL LRS+AD     +  +D 
Sbjct: 180 QQIEEKEDGSKAVVGTTATLELTPDQSKVMTVAQQMADRISLALRSVADAQEPDTTAADY 239

Query: 237 WDVQEEGKEIQIIKAGVIVNKDG 259
               +    IQ+IK+G IV  DG
Sbjct: 240 LLNGDGRPSIQVIKSGSIVKGDG 262


>gi|222147183|ref|YP_002548140.1| component of type IV pilus [Agrobacterium vitis S4]
 gi|221734173|gb|ACM35136.1| component of type IV pilus [Agrobacterium vitis S4]
          Length = 269

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 99/232 (42%), Positives = 146/232 (62%), Gaps = 7/232 (3%)

Query: 33  QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQE 92
           Q+E V+T+ P     VLI+   L VG  +T   + W+ +P+ ++ DGF+ + ++P A+ +
Sbjct: 36  QSEPVVTKEPT--TKVLIAAASLPVGARLTDKAMRWMDWPKTDLVDGFVTEENRPQALSD 93

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHV 152
           L G++VR+PI +G+PIR+EK+ D  +  LS+LLP GKRA + +IS+++  GG I PND V
Sbjct: 94  LAGLVVRLPIFEGEPIRIEKIADASSRTLSALLPAGKRAISTEISVATGAGGFILPNDRV 153

Query: 153 DVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE---RVLVGSTATLELTPMQAKALVA 209
           DV+MVR           VLSN+RV+AID  I+      R ++G+TATLELTP Q K L  
Sbjct: 154 DVIMVRKGDNDNHLTETVLSNVRVLAIDQQIEEKNDGTRSVIGTTATLELTPEQTKVLTV 213

Query: 210 AQSVA-KLSLVLRSIADLNPS-SSEDSDVWDVQEEGKEIQIIKAGVIVNKDG 259
           AQ +A +LSL LRS+AD     +S  S +      G ++Q+IK+G IV   G
Sbjct: 214 AQQMAERLSLALRSVADAQEQDNSSASYLLSGDSGGPQVQVIKSGQIVKSAG 265


>gi|150398540|ref|YP_001329007.1| SAF domain-containing protein [Sinorhizobium medicae WSM419]
 gi|150030055|gb|ABR62172.1| SAF domain protein [Sinorhizobium medicae WSM419]
          Length = 269

 Score =  178 bits (451), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 106/264 (40%), Positives = 160/264 (60%), Gaps = 7/264 (2%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLV-SPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK  R++ + V+   A +AG++AM+L  +P     E VI + P   INVL++   L VG 
Sbjct: 1   MKPVRIIILAVAVGSAAMAGLLAMKLTRAPAARMAEPVIEQAPT--INVLVAGKSLPVGS 58

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG 119
            +  + + W A+P++ + +G I +  +P+A+ +L G +VR+PI  G+P+R EK+ D  N 
Sbjct: 59  RLGADSIHWKAWPKDGIAEGMITEETRPSAVDDLAGAVVRLPIFTGEPVRQEKIADASNR 118

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAI 179
            +SSLLP GKRA   +I++++  GG I PND VDV+MVR           VLSN+RV+AI
Sbjct: 119 IMSSLLPAGKRAVATEITVATGAGGFILPNDRVDVIMVRKSDGDLYLTETVLSNVRVLAI 178

Query: 180 DHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSD 235
           D  I+  E   + +VG+TATLELTP Q+K +   Q +A ++SL LRS+AD     +  +D
Sbjct: 179 DQQIEEKEDGTKAVVGTTATLELTPDQSKVMTVTQQMADRISLALRSVADAQEPDTTAAD 238

Query: 236 VWDVQEEGKEIQIIKAGVIVNKDG 259
                +    IQ+IK+G IV  DG
Sbjct: 239 HLLNGDGQPSIQVIKSGSIVKGDG 262


>gi|209551758|ref|YP_002283675.1| Flp pilus assembly protein CpaB [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537514|gb|ACI57449.1| Flp pilus assembly protein CpaB [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 271

 Score =  175 bits (443), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 104/244 (42%), Positives = 150/244 (61%), Gaps = 10/244 (4%)

Query: 21  IIAMRLVSPHHV--QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFD 78
            +AM++     V  Q + VI + P   +N+L+S  +LAVG  +    + W+ +P+  V  
Sbjct: 21  FLAMQMAGNGGVVTQVQSVIEKEPT--VNILVSSANLAVGERLDDKSVHWMPWPQGGVVP 78

Query: 79  GFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISI 138
           G I +  +P+A+++L G +VR+PI +G+PIR EK+ D  +  LSSLLP GKRA   +IS+
Sbjct: 79  GLITEADKPDAIKDLQGAVVRLPIFEGEPIRPEKVADSNSRILSSLLPAGKRAVATEISV 138

Query: 139 SSAVGGMIKPNDHVDVVMVRSLSERKPTVT-VVLSNIRVIAIDHNI---DSDERVLVGST 194
           ++  GG I PND VDV+MVR  +E    +T  VLSN+RV+AID  I   D   + +VG+T
Sbjct: 139 ATGAGGFILPNDRVDVIMVRKGTEANKLITETVLSNVRVLAIDQQIQEKDDGSKAVVGTT 198

Query: 195 ATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSDVWDVQEEGKE-IQIIKAG 252
           ATLELTP Q K L  AQ +A +LSL LRS+AD     +  +D     + G   IQ+IK+G
Sbjct: 199 ATLELTPDQTKVLAVAQQMADRLSLALRSVADAQEQDTSAADYLLSGDNGSAIIQVIKSG 258

Query: 253 VIVN 256
            IV 
Sbjct: 259 AIVT 262


>gi|190889880|ref|YP_001976422.1| pilus assembly protein [Rhizobium etli CIAT 652]
 gi|218509313|ref|ZP_03507191.1| pilus assembly protein [Rhizobium etli Brasil 5]
 gi|190695159|gb|ACE89244.1| pilus assembly protein [Rhizobium etli CIAT 652]
 gi|327194695|gb|EGE61541.1| pilus assembly protein [Rhizobium etli CNPAF512]
          Length = 271

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 152/244 (62%), Gaps = 10/244 (4%)

Query: 24  MRLVSPHHV--QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFI 81
           MR+     V  Q + VI + P   +NVL+S G+LAVG  +    + W+A+P+  V  G I
Sbjct: 24  MRMAGSGGVVTQVQSVIEKEPT--VNVLVSSGNLAVGQRLEEGSVHWMAWPQGGVVPGLI 81

Query: 82  DDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSA 141
            ++ +P+A+++L G +VR+PI +G+PIR EK+ D  +  LSSLLP GKRA   +IS+++ 
Sbjct: 82  TEIEKPDAIKDLQGAVVRLPIFEGEPIRPEKVADSSSRILSSLLPAGKRAVATEISVATG 141

Query: 142 VGGMIKPNDHVDVVMVRSLSERKPTVT-VVLSNIRVIAIDHNI---DSDERVLVGSTATL 197
            GG I PND VDV+MVR  +E    +T  VLSN+RV+AID  I   D   + +VG+TATL
Sbjct: 142 AGGFILPNDRVDVIMVRKGTEANKLITETVLSNVRVLAIDQQIQEKDDGSKAVVGTTATL 201

Query: 198 ELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSDVWDVQEEGKE-IQIIKAGVIV 255
           ELTP Q K L  AQ +A +LSL LRS+AD     +  +D     + G   IQ+IK+G IV
Sbjct: 202 ELTPDQTKVLAVAQQMADRLSLALRSVADAQEQDTSAADYLLSGDNGSAIIQVIKSGSIV 261

Query: 256 NKDG 259
              G
Sbjct: 262 TDAG 265


>gi|163757626|ref|ZP_02164715.1| pilus assembly protein [Hoeflea phototrophica DFL-43]
 gi|162285128|gb|EDQ35410.1| pilus assembly protein [Hoeflea phototrophica DFL-43]
          Length = 269

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 102/245 (41%), Positives = 154/245 (62%), Gaps = 12/245 (4%)

Query: 22  IAMRLVSP----HHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVF 77
           +AM L +P    + +    VI + P   ++VL+    L VG  +    +EW  +PE+ V 
Sbjct: 22  LAMNLTAPTVQVNEISATPVIEKMPT--LDVLVVSASLPVGARLNEETMEWKGWPEDAVT 79

Query: 78  DGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDIS 137
           +G I    +P+A+ EL G +VR+P+  G+P+R EK+VD  +  +SSLLP GKRA   +IS
Sbjct: 80  EGLIRRESRPDAITELTGSIVRLPLFTGEPLRPEKIVDSSSRIMSSLLPAGKRAIATEIS 139

Query: 138 ISSAVGGMIKPNDHVDVVMVRSLSERKPTVT-VVLSNIRVIAIDHNIDSD---ERVLVGS 193
           ++++ GG I PND VDV+MVR  +E++  +T V+LSNIRV+AID  I+ D    R  VG+
Sbjct: 140 VATSAGGFILPNDRVDVIMVRRKTEQEGFLTEVILSNIRVLAIDQRIEEDAQGNRTAVGT 199

Query: 194 TATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSDVWDVQEEGKE-IQIIKA 251
           TATLELTP Q+K +  AQ +A +L+L LRS+AD+    ++ +      E+G   IQ+I++
Sbjct: 200 TATLELTPDQSKIITVAQQMADRLTLALRSVADVQEPDTDGAKHLLSGEDGTSAIQLIRS 259

Query: 252 GVIVN 256
           G I N
Sbjct: 260 GAITN 264


>gi|86355863|ref|YP_467755.1| pilus assembly protein [Rhizobium etli CFN 42]
 gi|86279965|gb|ABC89028.1| pilus assembly protein [Rhizobium etli CFN 42]
          Length = 271

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 152/244 (62%), Gaps = 10/244 (4%)

Query: 24  MRLVSPHHV--QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFI 81
           MR+     V  Q + VI + P   +N+L+S  +L VG  +  + + W+A+P+E V  GFI
Sbjct: 24  MRMAGSGGVVTQVQSVIKKEPT--VNILVSNKNLPVGARLGDDSVHWMAWPKEGVVQGFI 81

Query: 82  DDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSA 141
            +  +P+A+++L G +VR+PI +G+PIR EK+ D  +  LSSLLP GKRA   +IS+++ 
Sbjct: 82  TEADRPDAIKDLQGAVVRLPIFEGEPIRPEKVADSSSRILSSLLPAGKRAVATEISVATG 141

Query: 142 VGGMIKPNDHVDVVMVRSLSERKPTVT-VVLSNIRVIAIDHNI---DSDERVLVGSTATL 197
            GG I PND VDV+MVR  +E    +T  VLSN+RV+AID  I   D   + +VG+TATL
Sbjct: 142 AGGFILPNDRVDVIMVRKGTEANKLITETVLSNVRVLAIDQQIQEKDDGSKTVVGTTATL 201

Query: 198 ELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSDVWDVQEEGKE-IQIIKAGVIV 255
           ELTP Q K L  AQ +A +LSL LRS+AD     +  +D     + G   IQ+IK+G IV
Sbjct: 202 ELTPDQTKVLAVAQQMADRLSLALRSVADAQEQDTSAADYLLSGDNGSAIIQVIKSGAIV 261

Query: 256 NKDG 259
              G
Sbjct: 262 TDAG 265


>gi|241207156|ref|YP_002978252.1| Flp pilus assembly protein CpaB [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861046|gb|ACS58713.1| Flp pilus assembly protein CpaB [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 271

 Score =  168 bits (426), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 102/233 (43%), Positives = 146/233 (62%), Gaps = 8/233 (3%)

Query: 33  QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQE 92
           Q   V+ + P   +N+L+S G+L+VG  +    + W+A+P+  V  G I +  +P+A+++
Sbjct: 35  QVRSVVEKEPT--VNILVSSGNLSVGARLDDQAVHWMAWPQGGVVPGLITETDKPDAIKD 92

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHV 152
           L G +VR+PI +G+PIR EK+ D  +  LSSLLP GKRA   +IS+++  GG I PND V
Sbjct: 93  LQGAVVRLPIFEGEPIRPEKIADSSSRILSSLLPAGKRAVATEISVATGAGGFILPNDRV 152

Query: 153 DVVMVRSLSERKPTVT-VVLSNIRVIAIDHNI---DSDERVLVGSTATLELTPMQAKALV 208
           DV+MVR  +E    +T  VLSN+RV+AID  I   D   + +VG+TATLELTP Q K L 
Sbjct: 153 DVIMVRKGAEADKLITETVLSNVRVLAIDQQIQEKDDGSKSVVGTTATLELTPDQTKVLA 212

Query: 209 AAQSVA-KLSLVLRSIADLNPSSSEDSDVWDVQEEGKE-IQIIKAGVIVNKDG 259
            AQ +A +LSL LRS+AD     +  +D     + G   IQ+IK+G IV   G
Sbjct: 213 VAQQMADRLSLALRSVADAQEQDTSAADYLLSGDNGSAIIQVIKSGAIVTDAG 265


>gi|116249980|ref|YP_765818.1| pilus assembly protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254628|emb|CAK05702.1| putative pilus assembly protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 271

 Score =  165 bits (417), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 144/230 (62%), Gaps = 8/230 (3%)

Query: 33  QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQE 92
           Q   V+ + P   +N+L+S  +L+VG  +    + W+A+P+  V  G I +  +P+A+++
Sbjct: 35  QVRSVVEKEPT--VNILVSSANLSVGARLDDQSVHWMAWPQGGVVPGLITEADKPDAVKD 92

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHV 152
           L G +VR+PI +G+PIR EK+ D  +  LSSLLP GKRA   +IS+++  GG I PND V
Sbjct: 93  LQGAVVRLPIFEGEPIRPEKIADSSSRILSSLLPAGKRAVATEISVATGAGGFILPNDRV 152

Query: 153 DVVMVRSLSERKPTVT-VVLSNIRVIAIDHNI---DSDERVLVGSTATLELTPMQAKALV 208
           DV+MVR  +E    +T  VLSN+RV+AID  I   D   + +VG+TATLELTP Q K L 
Sbjct: 153 DVIMVRKGAEADKLITETVLSNVRVLAIDQQIQEKDDGSKSVVGTTATLELTPDQTKVLA 212

Query: 209 AAQSVA-KLSLVLRSIADLNPSSSEDSDVWDVQEEGKE-IQIIKAGVIVN 256
            AQ +A +LSL LRS+AD     +  +D     + G   IQ+IK+G IV 
Sbjct: 213 VAQQMADRLSLALRSVADAQEQDTSAADYLLSGDNGSAIIQVIKSGAIVT 262


>gi|218671060|ref|ZP_03520731.1| Flp pilus assembly protein CpaB [Rhizobium etli GR56]
          Length = 214

 Score =  159 bits (402), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 132/203 (65%), Gaps = 6/203 (2%)

Query: 64  NILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSS 123
           + + W+A+P++ V  GFI +  +P+A+++L G +VR+PI +G+PIR EK+ D  +  LSS
Sbjct: 7   DTVHWMAWPKDGVVQGFITEADKPDAIKDLQGAVVRLPIFEGEPIRPEKVADSSSRILSS 66

Query: 124 LLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT-VVLSNIRVIAIDHN 182
           LLP GKRA   +IS+++  GG I PND VDV+MVR  +E    +T  VLSN+RV+AID  
Sbjct: 67  LLPAGKRAVATEISVATGAGGFILPNDRVDVIMVRKGTEANKLITETVLSNVRVLAIDQQ 126

Query: 183 I---DSDERVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSDVWD 238
           I   D   + +VG+TATLELTP Q K L  AQ +A +LSL LRS+AD     +  +D   
Sbjct: 127 IQEQDDGSKAVVGTTATLELTPDQTKVLAVAQQMADRLSLALRSVADAQEQDTSAADYLL 186

Query: 239 VQEEGKE-IQIIKAGVIVNKDGE 260
             + G   IQ+IK+G IV   GE
Sbjct: 187 SGDNGSAIIQVIKSGSIVTDAGE 209


>gi|153008058|ref|YP_001369273.1| SAF domain-containing protein [Ochrobactrum anthropi ATCC 49188]
 gi|151559946|gb|ABS13444.1| SAF domain protein [Ochrobactrum anthropi ATCC 49188]
          Length = 271

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 99/250 (39%), Positives = 136/250 (54%), Gaps = 24/250 (9%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  RL+ + V+ + A  AG IAM L +P              K  +VL++  +L VG  
Sbjct: 1   MKSARLLILGVAVLAAGGAGYIAMNLAAPPPAPVVVAPETPQMKLEDVLVATENLGVGAE 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +T   + W  +P E V DG+I    +P+A+ +L G  VR+    G+PIR  KL+  G   
Sbjct: 61  LTSQ-MRWQPWPAEAVSDGYITRASEPDAINQLSGATVRLQFFTGEPIRKTKLIGPGQSF 119

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP----------TVTVV 170
           +SS+LP G RA    I+  S+ GG I PND VDV+M R    RKP          T   V
Sbjct: 120 MSSILPPGMRAVATQINAESSAGGFILPNDFVDVIMTR----RKPDNGDKSLTPFTTETV 175

Query: 171 LSNIRVIAIDHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADL 226
           L N+RV+AID  I  DE   +V+VG TATLE+TP QA+ +  AQ +A +L+L LRS  D+
Sbjct: 176 LQNVRVLAIDQAIQEDEQGRKVMVGQTATLEVTPEQAEIITVAQQMADRLTLALRSTQDV 235

Query: 227 NPSSSEDSDV 236
                ED D+
Sbjct: 236 -----EDKDI 240


>gi|239833238|ref|ZP_04681567.1| Flp pilus assembly protein CpaB [Ochrobactrum intermedium LMG 3301]
 gi|239825505|gb|EEQ97073.1| Flp pilus assembly protein CpaB [Ochrobactrum intermedium LMG 3301]
          Length = 279

 Score =  148 bits (374), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 97/250 (38%), Positives = 136/250 (54%), Gaps = 24/250 (9%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  RL+ + V+ + A  AG IAM L +P              K  +VL++  +L VG  
Sbjct: 9   MKSARLLILGVAVLAAGGAGYIAMNLATPPPAPVVAAPEAPQIKLEDVLVATENLGVGAE 68

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +T   + W  +P E + +G+I    +P+A+ +L G  VR+    G+PIR  KL+  G   
Sbjct: 69  LTSQ-MRWQPWPAEAISEGYITRASEPDAINQLSGATVRLQFFTGEPIRKAKLIGPGQSF 127

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP----------TVTVV 170
           +SS+LP G RA    I+  S+ GG I PND VDV+M R    RKP          T   V
Sbjct: 128 MSSILPPGMRAVATQINAESSAGGFILPNDFVDVIMTR----RKPDNGDKSLTPFTTETV 183

Query: 171 LSNIRVIAIDHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADL 226
           L N+RV+AID  I  DE   +V+VG TATLE+TP QA+ +  AQ +A +L+L LRS  D+
Sbjct: 184 LQNVRVLAIDQAIQEDEQGRKVMVGQTATLEVTPEQAEIITVAQQMADRLTLALRSTQDV 243

Query: 227 NPSSSEDSDV 236
                ED D+
Sbjct: 244 -----EDRDI 248


>gi|92116014|ref|YP_575743.1| Flp pilus assembly CpaB [Nitrobacter hamburgensis X14]
 gi|91798908|gb|ABE61283.1| Flp pilus assembly CpaB [Nitrobacter hamburgensis X14]
          Length = 260

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 143/257 (55%), Gaps = 31/257 (12%)

Query: 14  VFALVAGIIAMRLVS-----PHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEW 68
             A+ AG +A  L S     P   QT ++ T      ++VL++K D+ +G  VT N + W
Sbjct: 10  TIAVGAGGLAAYLASGSDKKPQPAQTAQLQT------VDVLVAKSDIPLGQAVTANDVAW 63

Query: 69  VAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD-RGNGGLSSLLPK 127
            A+P  +    FI    +P+A  +L G + R P + G+PIR  KLV  +G+G ++++LP 
Sbjct: 64  QAWPANSASSSFIRRDQRPDATTQLAGSIARSPFIAGEPIRELKLVSAKGSGFMAAILPT 123

Query: 128 GKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP--------TVTVVLSNIRVIAI 179
           G RA + +IS  +  GG I PND VDV++  S  ++ P            +LSN+RV+A+
Sbjct: 124 GMRAISTEISPETGAGGFILPNDRVDVIL--SQRDKNPDHPNANSVNSETILSNVRVLAV 181

Query: 180 DHNID--SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLN-PSSSEDSDV 236
           D  I+  + ++V+VG TATLEL P QA+ L  ++ +  LSL LRS+AD N P SS D   
Sbjct: 182 DQTIEEKNGQKVVVGKTATLELKPEQAEMLARSRQMGTLSLALRSLADANAPESSTDDQR 241

Query: 237 WDVQEEGKEIQIIKAGV 253
            D       I I++ GV
Sbjct: 242 RD------SINIVRYGV 252


>gi|90419763|ref|ZP_01227672.1| Flp pilus assembly protein CpaB [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335804|gb|EAS49552.1| Flp pilus assembly protein CpaB [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 293

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 130/223 (58%), Gaps = 11/223 (4%)

Query: 40  ENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVR 99
           E P K   VL++  DL++G  V    L+W ++PE+ +    I    +P+A++ L G L R
Sbjct: 63  EPPIKLAEVLVTSRDLSMGEAVD-EALDWQSWPEDGIGPTLIRKSDRPDALETLKGSLAR 121

Query: 100 VPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS 159
                G+P+R  KL+    G +S++LP GKRA  + I+  ++ GG + PNDHVDV+M R 
Sbjct: 122 QSFFAGEPVRESKLIRSDQGFMSAVLPAGKRAVAVQIAAETSAGGFVLPNDHVDVIMTRR 181

Query: 160 LSERKPT-----VTVVLSNIRVIAIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQS 212
           +S  +          VL N+RV+AID  I     E+V+VGSTATLE+ P QA+AL AAQ 
Sbjct: 182 VSSSENRGDQVLTETVLRNLRVLAIDQTIQEKDGEKVVVGSTATLEVDPEQAEALTAAQQ 241

Query: 213 VA-KLSLVLRSIADLNPSSSEDSDVWDVQEEGK--EIQIIKAG 252
           +A +L L LRS+AD  P S   +     QE  +  +I++++ G
Sbjct: 242 IADRLVLSLRSLADSVPGSPGYAAFLLAQENARNGKIRVVRYG 284


>gi|110636320|ref|YP_676528.1| pilus assembly protein cpaB [Mesorhizobium sp. BNC1]
 gi|110287304|gb|ABG65363.1| pilus assembly protein cpaB [Chelativorans sp. BNC1]
          Length = 270

 Score =  145 bits (366), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 93/242 (38%), Positives = 136/242 (56%), Gaps = 13/242 (5%)

Query: 22  IAMRLVSPHHVQTEEVITENPA-KFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGF 80
           +A  L SP  V       E P     +VL+   D+ VG  +    + W A+P E+V D F
Sbjct: 22  LAKNLASPQKVAAVAPTPEKPPVSLTDVLVLTQDVPVGEPINGAAM-WQAWPAESVMDAF 80

Query: 81  IDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISS 140
           I    +P+A++ +   + R+P+  G+P+R  KLV  G+  L+++LP GKRA    I+  +
Sbjct: 81  ITREREPDALETIRNAVARLPLFAGEPVRRSKLVGEGDSFLAAILPPGKRAVATRIAADT 140

Query: 141 AVGGMIKPNDHVDVVMVRSLSE-RKPT---VTVVLSNIRVIAIDHNIDSDE---RVLVGS 193
           + GG I PND VDV+M R   E   P       VL NIRV+AID  I  DE   RV +G 
Sbjct: 141 SAGGFILPNDRVDVIMTRRADEGSSPNGFITETVLENIRVLAIDQTIHEDEEGRRVKLGE 200

Query: 194 TATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSDVWDVQEEGK--EIQIIK 250
           TATLELTP +A+ +  AQ +A +L+L LRS+AD N  ++ D  +  V   G+   +++IK
Sbjct: 201 TATLELTPEEAEVITVAQQLADRLTLSLRSVADSNEEAT-DRGLHLVTGTGRGDSVRLIK 259

Query: 251 AG 252
           +G
Sbjct: 260 SG 261


>gi|75674500|ref|YP_316921.1| Flp pilus assembly CpaB [Nitrobacter winogradskyi Nb-255]
 gi|74419370|gb|ABA03569.1| Flp pilus assembly CpaB [Nitrobacter winogradskyi Nb-255]
          Length = 275

 Score =  145 bits (365), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 145/253 (57%), Gaps = 23/253 (9%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPE 73
             A+ AG +A  L S    +T+ V TE   + ++VL++K D+ +G  VT N + W  +P 
Sbjct: 25  TIAVGAGGLAAYLASGSDKETQPVQTEQ-LRTVDVLVAKSDIPLGQAVTANDVAWQTWPA 83

Query: 74  ENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD-RGNGGLSSLLPKGKRAA 132
           ++    FI    +P+A  +L G + R P + G+PIR  KLV  +G+G ++++LP G RA 
Sbjct: 84  DSASHSFIRRDQRPDATTQLAGSIARSPFIAGEPIRELKLVSAKGSGFMAAILPTGMRAI 143

Query: 133 TMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTV----------TVVLSNIRVIAIDHN 182
           + +IS  +  GG I PND VDV+    LS+R+               VL N+RV+AID  
Sbjct: 144 STEISPETGAGGFILPNDRVDVI----LSKREKNADHASGDSVNSETVLGNVRVLAIDQT 199

Query: 183 ID--SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQ 240
           I+  + ++V+VG TATLEL P QA+ L  ++ +  LSL LRS+AD N   + + D+ D +
Sbjct: 200 IEEKNGQKVVVGRTATLELKPEQAETLARSRQMGTLSLALRSLADAN---APEGDINDRR 256

Query: 241 EEGKEIQIIKAGV 253
            +   I +++ GV
Sbjct: 257 RD--SINVVRYGV 267


>gi|316933040|ref|YP_004108022.1| Flp pilus assembly protein CpaB [Rhodopseudomonas palustris DX-1]
 gi|315600754|gb|ADU43289.1| Flp pilus assembly protein CpaB [Rhodopseudomonas palustris DX-1]
          Length = 266

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 129/223 (57%), Gaps = 16/223 (7%)

Query: 44  KFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPIL 103
           + + VL++K D+ +G  V P  L+W  +P       FI    QPNA  +L G + R P +
Sbjct: 47  QTVEVLVAKNDIPLGQAVAPGDLQWQTWPSATASSHFIRRNDQPNATTDLAGSIARSPFI 106

Query: 104 KGDPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV-RSLS 161
            G+PIR +KLV   G+G ++++LP G RA + +IS  +  GG I PND VDV++  R  +
Sbjct: 107 AGEPIREQKLVKANGSGFMAAILPSGMRAISTEISPETGAGGFILPNDRVDVILSKREKN 166

Query: 162 ERKPT-----VTVVLSNIRVIAIDHNID--SDERVLVGSTATLELTPMQAKALVAAQSVA 214
             +P+       ++LSN+RV+A+D  I+  + ++V+VG TATLEL P QA+ L  A+   
Sbjct: 167 SDRPSGEQIVSEIILSNVRVLAVDQTIEEKNGQKVVVGKTATLELKPEQAEYLARARQSG 226

Query: 215 KLSLVLRSIADL-NPSSSEDSDVWDVQEEGKEIQIIKAGVIVN 256
            L+L LRS+AD   PS++E+    D       + I++ GV   
Sbjct: 227 TLALALRSLADAGQPSTTENDAKRD------SVNIVRYGVTTQ 263


>gi|13474659|ref|NP_106228.1| pilus assembly protein cpaB [Mesorhizobium loti MAFF303099]
 gi|14025414|dbj|BAB52014.1| pilus assembly protein; CpaB [Mesorhizobium loti MAFF303099]
          Length = 271

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 84/216 (38%), Positives = 128/216 (59%), Gaps = 12/216 (5%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
           +VL+  GD+A+G  +  NI  W ++P + V   FI   + P+A+++L G + RVP+  G+
Sbjct: 49  DVLVLSGDVAMGNALQNNI-SWQSWPADGVNANFITKANAPDALEKLKGSIARVPMYAGE 107

Query: 107 PIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT 166
           P+R  KL+  G   +SS+LP G RA    IS  ++ GG I PND VDV+M R       +
Sbjct: 108 PVRRSKLIGEGQSFMSSILPSGMRAVATTISADTSAGGFILPNDFVDVIMTRRADANSGS 167

Query: 167 ----VTVVLSNIRVIAIDHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSL 218
                  +L NIRV+AID  I  DE   +  VG TATLELTP QA+ +  AQ +A +L+L
Sbjct: 168 TGFNTETILKNIRVLAIDQTIQEDEEGKKTRVGQTATLELTPKQAEIITVAQQMADRLTL 227

Query: 219 VLRSIADLNPSSSEDSDVWDVQEEGKE--IQIIKAG 252
            LR++AD    +  ++D + V   G++  +++IK+G
Sbjct: 228 ALRAVADTQEKNVGEAD-YLVSGNGRKGTVRLIKSG 262


>gi|218661134|ref|ZP_03517064.1| pilus assembly protein [Rhizobium etli IE4771]
          Length = 205

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 84/184 (45%), Positives = 119/184 (64%), Gaps = 8/184 (4%)

Query: 24  MRLVSPHHV--QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFI 81
           MR+     V  Q + VI + P   +NVL+S G+LAVG  +    + W+A+P+  V  G I
Sbjct: 24  MRMAGSGGVVTQVQSVIEKEPT--VNVLVSSGNLAVGQRLEEGSVHWMAWPQGGVVPGLI 81

Query: 82  DDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSA 141
            +  +P+A+++L G +VR+PI +G+PIR EK+ D  +  LSSLLP GKRA   +IS+++ 
Sbjct: 82  TEAEKPDAIKDLQGAVVRLPIFEGEPIRPEKVADSSSRILSSLLPAGKRAVATEISVATG 141

Query: 142 VGGMIKPNDHVDVVMVRSLSERKPTVT-VVLSNIRVIAIDHNI---DSDERVLVGSTATL 197
            GG I PND VDV+MVR  +E    +T  VLSN+RV+AID  I   D   + +VG+TATL
Sbjct: 142 AGGFILPNDRVDVIMVRKGTEANKLITETVLSNVRVLAIDQQIQEKDDGSKAVVGTTATL 201

Query: 198 ELTP 201
           ELTP
Sbjct: 202 ELTP 205


>gi|170740622|ref|YP_001769277.1| Flp pilus assembly protein CpaB [Methylobacterium sp. 4-46]
 gi|168194896|gb|ACA16843.1| Flp pilus assembly protein CpaB [Methylobacterium sp. 4-46]
          Length = 268

 Score =  141 bits (356), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 116/202 (57%), Gaps = 12/202 (5%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKG 105
           ++VL++  DL +G  + P  L W A+P+ +V DGFI     P A+++  G  VR P L G
Sbjct: 46  VDVLVAAADLPMGQTLKPADLRWQAWPKGSVNDGFIQRGQNPRALEDTVGSFVRGPFLGG 105

Query: 106 DPIRLEKLVD-RGNGGLSSLLPKGKRAA--TMDISISSAVGGMIKPNDHVDVVMVRSLSE 162
           +PIR EKL+   G+G LS++LP G RA   ++D   S+  GG I PND VDV+      E
Sbjct: 106 EPIRREKLIRANGSGFLSAILPSGMRAVAISIDARGSNTAGGFILPNDRVDVLRTYRDDE 165

Query: 163 RKPTVT-------VVLSNIRVIAIDHNID--SDERVLVGSTATLELTPMQAKALVAAQSV 213
                T        +L N+RV+A+   +   + ERV+ G TATLELTP Q + +  AQ V
Sbjct: 166 ASRATTSDVQVSETILQNVRVLAVGQTVQERNGERVVTGDTATLELTPAQTEQITLAQKV 225

Query: 214 AKLSLVLRSIADLNPSSSEDSD 235
            +LSL LRSIAD   S  E+ +
Sbjct: 226 GQLSLALRSIADAGISQPENPE 247


>gi|146338124|ref|YP_001203172.1| putative pilus assembly protein CpaB [Bradyrhizobium sp. ORS278]
 gi|146190930|emb|CAL74935.1| Putative pilus assembly protein, cpaB [Bradyrhizobium sp. ORS278]
          Length = 248

 Score =  141 bits (356), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 125/220 (56%), Gaps = 17/220 (7%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKG 105
           ++VL++K D+ +G  + P +L+W ++P       FI    +P    E+ G + R P + G
Sbjct: 26  VDVLVAKADIGLGQSIKPELLQWQSWPASTASSSFIRRNERPEGQNEVTGTIARAPFIAG 85

Query: 106 DPIRLEKLVDR-GNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK 164
           +PIR +KLV   G+G ++++LP G RA + +IS  +  GG I PND VDV++  S  ER 
Sbjct: 86  EPIREQKLVKSDGSGFMAAILPAGMRAVSTEISPETGAGGFILPNDRVDVIL--SKRERN 143

Query: 165 P---------TVTVVLSNIRVIAIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSV 213
           P         +  ++L+NIRV+AID        +  +VG T TLEL P QA+ L  A+  
Sbjct: 144 PDQPNAGDVVSSEIILANIRVLAIDQAPKEKDGQTTVVGKTVTLELKPEQAETLARARQT 203

Query: 214 AKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAGV 253
             LSL LRSIAD+N  + + SD  D +  G  + +++ G+
Sbjct: 204 GTLSLALRSIADVN-MAEQRSD--DNRRRGDSVAVVRFGI 240


>gi|85713504|ref|ZP_01044494.1| Flp pilus assembly CpaB [Nitrobacter sp. Nb-311A]
 gi|85699408|gb|EAQ37275.1| Flp pilus assembly CpaB [Nitrobacter sp. Nb-311A]
          Length = 260

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 90/254 (35%), Positives = 147/254 (57%), Gaps = 25/254 (9%)

Query: 14  VFALVAGIIAMRLVS-----PHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEW 68
             A+ AG +A  L S     P   QT ++ T      ++VL++K D+ +G  VT N + W
Sbjct: 10  TIAVGAGGLAAYLASGSDKKPQIAQTVQLPT------VDVLVAKSDIQLGQTVTANDVAW 63

Query: 69  VAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD-RGNGGLSSLLPK 127
             +P ++  + FI    +P+A  +L G + R P + G+PIR  KLV  +G+G ++++LP 
Sbjct: 64  QTWPADSASNSFIRRDRRPDATTQLAGSIARSPFIAGEPIREPKLVSAKGSGFMAAILPT 123

Query: 128 GKRAATMDISISSAVGGMIKPNDHVDVVMVRS-LSERKPT-----VTVVLSNIRVIAIDH 181
           G RA + +IS  +  GG I PND VDV++ R   +   P+        +LSN+RV+A+D 
Sbjct: 124 GMRAISTEISPETGAGGFILPNDRVDVILSRRDRNADHPSGDSVNSETILSNVRVLAVDQ 183

Query: 182 NID--SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDV 239
            I+  + ++V+VG TATLEL P QA+ L  ++ +  LSL LRS+AD N   + +S++ D 
Sbjct: 184 TIEEKNGQKVVVGRTATLELKPEQAETLARSRQMGTLSLALRSLADAN---APESNIDDR 240

Query: 240 QEEGKEIQIIKAGV 253
           + +   I +++ GV
Sbjct: 241 RRD--SISVVRYGV 252


>gi|299132282|ref|ZP_07025477.1| Flp pilus assembly protein CpaB [Afipia sp. 1NLS2]
 gi|298592419|gb|EFI52619.1| Flp pilus assembly protein CpaB [Afipia sp. 1NLS2]
          Length = 273

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 122/197 (61%), Gaps = 9/197 (4%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
           +VL++K D+ +G  +T + ++W ++P       F+    + +A++++ G +VR P L G+
Sbjct: 45  DVLVAKSDIPLGQTITADDMKWQSWPAATASSSFVKKSERADAIKDMTGSIVRSPFLAGE 104

Query: 107 PIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP 165
           PIR  KLV   G+G ++++LP G RA + +IS  +  GG I PNDHVDV++ R    R+ 
Sbjct: 105 PIRETKLVKANGSGFMAAILPSGMRAISTEISPETGAGGFILPNDHVDVLLSRRQKSREG 164

Query: 166 -----TVTVVLSNIRVIAIDHNID--SDERVLVGSTATLELTPMQAKALVAAQSVAKLSL 218
                +  ++LS++RV+AID  ++  + ++V+VG TATLEL P QA+ L  ++    LSL
Sbjct: 165 NGESVSSEIILSDVRVLAIDQTVEEKNGQKVVVGKTATLELKPAQAETLARSRQSGTLSL 224

Query: 219 VLRSIADLN-PSSSEDS 234
            LRS+ D N P   ED+
Sbjct: 225 ALRSLVDANKPGKVEDA 241


>gi|220922778|ref|YP_002498080.1| Flp pilus assembly protein CpaB [Methylobacterium nodulans ORS
           2060]
 gi|219947385|gb|ACL57777.1| Flp pilus assembly protein CpaB [Methylobacterium nodulans ORS
           2060]
          Length = 267

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 81/205 (39%), Positives = 119/205 (58%), Gaps = 15/205 (7%)

Query: 43  AKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPI 102
           A  ++VL++  DL +G ++ P  L W A+P+ ++ DGF+      NA+++  G  VR P 
Sbjct: 42  ADTVDVLVAAADLPMGQILKPGDLRWQAWPKTSLNDGFLQREQNANALEDTLGSFVRSPF 101

Query: 103 LKGDPIRLEKLVD-RGNGGLSSLLPKGKRAA--TMDISISSAVGGMIKPNDHVDVVMV-- 157
           L G+PIR EKL+   G+G LS++LP G RA   ++D   S+  GG I PND VDV+    
Sbjct: 102 LGGEPIRREKLIKANGSGFLSAILPSGMRAVAISIDARGSNTAGGFILPNDRVDVLRTHR 161

Query: 158 -----RSLSERKPTVTVVLSNIRVIAIDHNID--SDERVLVGSTATLELTPMQAKALVAA 210
                R+          +L N+RV+A+   +   + ERV+ G TATLELTP QA+ +  A
Sbjct: 162 DEEAARATKSDVQVTETILKNVRVLAVGQTVQERNGERVVTGDTATLELTPAQAEQITLA 221

Query: 211 QSVAKLSLVLRSIAD---LNPSSSE 232
           Q V +LSL LRS++D   + P S E
Sbjct: 222 QKVGQLSLALRSLSDAGQVQPESPE 246


>gi|218513094|ref|ZP_03509934.1| pilus assembly protein [Rhizobium etli 8C-3]
          Length = 202

 Score =  138 bits (347), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 81/181 (44%), Positives = 117/181 (64%), Gaps = 8/181 (4%)

Query: 24  MRLVSPHHV--QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFI 81
           MR+     V  Q + VI + P   +NVL+S G+LAVG  +    + W+A+P+  V  G I
Sbjct: 24  MRMAGSGGVVTQVQSVIEKEPT--VNVLVSSGNLAVGQRLEEGSVHWMAWPQGGVVPGLI 81

Query: 82  DDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSA 141
            ++ +P+A+++L G +VR+PI +G+PIR EK+ D  +  LSSLLP GKRA   +IS+++ 
Sbjct: 82  TEIEKPDAIKDLQGAVVRLPIFEGEPIRPEKVADSSSRILSSLLPAGKRAVATEISVATG 141

Query: 142 VGGMIKPNDHVDVVMVRSLSERKPTVT-VVLSNIRVIAIDHNI---DSDERVLVGSTATL 197
            GG I PND VDV+MVR  +E    +T  VLSN+RV+AID  I   D   + +VG+TATL
Sbjct: 142 AGGFILPNDRVDVIMVRKGTEANKLITETVLSNVRVLAIDQQIQEKDDGSKAVVGTTATL 201

Query: 198 E 198
           E
Sbjct: 202 E 202


>gi|260461950|ref|ZP_05810195.1| Flp pilus assembly protein CpaB [Mesorhizobium opportunistum
           WSM2075]
 gi|259032197|gb|EEW33463.1| Flp pilus assembly protein CpaB [Mesorhizobium opportunistum
           WSM2075]
          Length = 271

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 82/216 (37%), Positives = 125/216 (57%), Gaps = 12/216 (5%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
           +VL+  GD+A+G  +  NI  W  +P + +   FI     P+A+++L G + RV +  G+
Sbjct: 49  DVLVLSGDVAMGNQLENNI-AWQPWPADGINPNFITKATAPDALEKLKGSIARVGMYAGE 107

Query: 107 PIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT 166
           P+R  KL+  G   +SS+LP G RA    IS  ++ GG I PND VDV+M R       +
Sbjct: 108 PVRRSKLIGEGQSFMSSILPSGMRAVATTISADTSAGGFILPNDFVDVIMTRRADANSGS 167

Query: 167 ----VTVVLSNIRVIAIDHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSL 218
                  +L NIRV+AID  I  DE   +  VG TATLELTP QA+ +  AQ +A +L+L
Sbjct: 168 TGFNTETILKNIRVLAIDQTIQEDEEGKKTRVGQTATLELTPKQAEIITVAQQMADRLTL 227

Query: 219 VLRSIADLNPSSSEDSDVWDVQEEGKE--IQIIKAG 252
            LR+I D    + +++D + V   G++  +++IK+G
Sbjct: 228 ALRAITDTQEKNVDEAD-YLVSGNGRKGTVRLIKSG 262


>gi|27375778|ref|NP_767307.1| CtpC protein [Bradyrhizobium japonicum USDA 110]
 gi|27348916|dbj|BAC45932.1| CtpC protein [Bradyrhizobium japonicum USDA 110]
          Length = 270

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 135/258 (52%), Gaps = 16/258 (6%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVI-TENPAKFINVLISKGDLAVGMVVTPNILEWVAFP 72
           V AL AG +A  L S +  +    +        + VL++K D+ +G  V P  L+W ++P
Sbjct: 10  VIALGAGGVAAYLASGYDNKPAPALPVAEKLPTVEVLVAKNDIQLGQAVKPEDLQWQSWP 69

Query: 73  EENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD-RGNGGLSSLLPKGKRA 131
                  FI    +P A  ++ G + RVP+++G+PIR +KLV   G+G ++++LP G RA
Sbjct: 70  AATASGAFIRRDSRPEAQTQIAGSIARVPLMQGEPIREQKLVRAEGSGFMAAILPSGMRA 129

Query: 132 ATMDISISSAVGGMIKPNDHVDVVMVRSLSE---RKPTV-------TVVLSNIRVIAIDH 181
            + D++  ++ GG I PND VD+V+ R L       PT         V+L+NIRV+AID 
Sbjct: 130 VSTDVTAETSAGGFILPNDRVDIVLTRRLKNPDVNGPTAGNDLILSEVILTNIRVLAIDQ 189

Query: 182 NIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDV 239
                  +  +VG T TLEL P Q   L AA+    L L LRSI D N +     D+   
Sbjct: 190 APKEKDGQNAVVGKTVTLELKPDQVATLTAARQGGTLQLALRSIVDANATELTAEDLAIK 249

Query: 240 QEEGKEIQIIKAGVIVNK 257
           +  G  + +I+ GV V +
Sbjct: 250 RSGG--VNVIRYGVQVRQ 265


>gi|114705457|ref|ZP_01438365.1| pilus assembly protein cpaB [Fulvimarina pelagi HTCC2506]
 gi|114540242|gb|EAU43362.1| pilus assembly protein cpaB [Fulvimarina pelagi HTCC2506]
          Length = 282

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 136/237 (57%), Gaps = 16/237 (6%)

Query: 33  QTEEVI-----TENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQP 87
           Q E VI      + P K  +VLIS GD+ +GM    N L W  +P + + +GFI    +P
Sbjct: 40  QQEPVIITAAPAQPPVKLEDVLISSGDVPMGMRFD-NGLSWQKWPVDGIGEGFILKNDRP 98

Query: 88  NAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIK 147
            A+ EL+G + R     G+P+R  KL+   +G +S+LLP GKRA  + I+ ++A GG I 
Sbjct: 99  EAIDELNGSIARQAFFAGEPVRSSKLIQSDSGFMSALLPAGKRAVAVQIAAATAAGGFIL 158

Query: 148 PNDHVDVVMVRSL-----SERKPTVTVVLSNIRVIAIDHNIDSDE--RVLVGSTATLELT 200
           PNDHVDV+M R +     +  K     VL N+RV+AID  I+  E  R +VGS ATLE+ 
Sbjct: 159 PNDHVDVIMTRRVEGDGGANAKILTETVLRNLRVLAIDQTIEDAEGQRNVVGSVATLEVD 218

Query: 201 PMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSDVWDVQEEGKE--IQIIKAGVI 254
             QA+AL AAQ +A +  L LRS+AD  P S   +     +E+ +   ++I++ G +
Sbjct: 219 GEQAEALTAAQQIADRFVLSLRSLADSIPGSPGYAAFLLAEEKARRGPVRIVRYGKV 275


>gi|148256956|ref|YP_001241541.1| putative pilus assembly protein CpaB [Bradyrhizobium sp. BTAi1]
 gi|146409129|gb|ABQ37635.1| Putative pilus assembly protein cpaB [Bradyrhizobium sp. BTAi1]
          Length = 266

 Score =  135 bits (339), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 92/252 (36%), Positives = 137/252 (54%), Gaps = 15/252 (5%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITENPAKF--INVLISKGDLAVGMVVTPNILEWVAF 71
             AL AG +A  LVS    Q + V     A+   + VL++K D+ +G  + P  L W  +
Sbjct: 10  TIALGAGGVAAYLVSTSESQ-QPVAVAPVAQLPTVEVLVAKNDIGLGQAIKPGDLVWQTW 68

Query: 72  PEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR-GNGGLSSLLPKGKR 130
           PE    + FI    +P A  +L G + R P + G+PIR +KLV   G+G ++++LP G R
Sbjct: 69  PEA-ASNIFIRRGDRPEAANQLVGTIARAPFVIGEPIREQKLVKSDGSGFMAAILPAGMR 127

Query: 131 AATMDISISSAVGGMIKPNDHVDVVMV-RSLSERKP------TVTVVLSNIRVIAIDHNI 183
           A + +IS  +  GG I PND VDV++  R  +  KP      +  ++LSN+RV+AID   
Sbjct: 128 AISTEISPETGAGGFILPNDRVDVILSKRDKNPDKPGGPDYVSSEIILSNVRVLAIDQAP 187

Query: 184 DSDE--RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQE 241
              E    +VG T TLEL P QA+ L  A+    L+L LRSIAD+N +    ++   +  
Sbjct: 188 KEKEGQNTVVGKTVTLELKPEQAETLARARQSGSLALALRSIADVNAADGNKNET-QMAR 246

Query: 242 EGKEIQIIKAGV 253
            G  I+II+ G+
Sbjct: 247 RGNAIEIIRYGI 258


>gi|146342077|ref|YP_001207125.1| putative pilus assembly protein CpaB [Bradyrhizobium sp. ORS278]
 gi|146194883|emb|CAL78908.1| Putative pilus assembly protein cpaB [Bradyrhizobium sp. ORS278]
          Length = 269

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 133/253 (52%), Gaps = 14/253 (5%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITE-NPAKFINVLISKGDLAVGMVVTPNILEWVAFP 72
             AL AG +A  LVS    Q    +        + VL++K D+ +G  + P  L W  +P
Sbjct: 10  TIALGAGGVAAYLVSSSESQQPAPVAPVAQLPTVEVLVAKADIGLGQAIKPGDLIWQTWP 69

Query: 73  EENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR-GNGGLSSLLPKGKRA 131
           E    + FI    +P A  +L G + R P + G+PIR +KLV   G+G ++++LP G RA
Sbjct: 70  EA-ASNIFIRRGDRPEAATQLVGSIARAPFVIGEPIREQKLVKSDGSGFMAAILPAGMRA 128

Query: 132 ATMDISISSAVGGMIKPNDHVDVVMV-RSLSERKPTVT------VVLSNIRVIAIDHNID 184
            + +IS  +  GG I PND VDV++  R  +  KP         ++LSN+RV+AID    
Sbjct: 129 ISTEISPETGAGGFILPNDRVDVILSRREKNPDKPAAADSIVSEIILSNVRVLAIDQAPK 188

Query: 185 SDE--RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQ-- 240
             E    +VG T TLEL P QA+ L  A+    L+L LRSIAD+N   +  ++    Q  
Sbjct: 189 EKEGQNTVVGKTVTLELKPEQAETLSRARQAGTLALALRSIADINAPDTGKTETEQQQMA 248

Query: 241 EEGKEIQIIKAGV 253
             G  I+II+ GV
Sbjct: 249 RRGNAIEIIRYGV 261


>gi|86748908|ref|YP_485404.1| Flp pilus assembly CpaB [Rhodopseudomonas palustris HaA2]
 gi|86571936|gb|ABD06493.1| Flp pilus assembly CpaB [Rhodopseudomonas palustris HaA2]
          Length = 265

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 121/201 (60%), Gaps = 15/201 (7%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKG 105
           + VL++K D+ +G  V P+ ++W  +P       FI    +P+A  +L G + R P + G
Sbjct: 44  VEVLVAKSDIPLGQPVGPSDVQWQTWPAATASSNFILRSERPDASVQLAGSIARSPFIAG 103

Query: 106 DPIRLEKLV-DRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK 164
           +PIR +KLV   G+G ++++LP G RA + +IS  +  GG I PND VDV++  S  ++ 
Sbjct: 104 EPIREQKLVKSNGSGFMAAILPTGMRAISTEISPETGAGGFILPNDRVDVIL--SKRDQN 161

Query: 165 P---------TVTVVLSNIRVIAIDHNID--SDERVLVGSTATLELTPMQAKALVAAQSV 213
           P            ++LSNIR++AID  ++  + ++V+VG TATLEL P QA+ L  A+  
Sbjct: 162 PDRVKGGDVVNSEIILSNIRILAIDQTVEEKNGQKVVVGKTATLELKPDQAEFLARARQS 221

Query: 214 AKLSLVLRSIADLN-PSSSED 233
             LSL LRS+AD N P+ +E+
Sbjct: 222 GTLSLALRSLADANAPARTEE 242


>gi|319785609|ref|YP_004145085.1| Flp pilus assembly protein CpaB [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317171497|gb|ADV15035.1| Flp pilus assembly protein CpaB [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 270

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 82/216 (37%), Positives = 122/216 (56%), Gaps = 12/216 (5%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
           +VL+  GD+ +G  +  NI  W ++P + V   FI    +P A+ +L G + RV +  G+
Sbjct: 48  DVLVLSGDVPMGSPIQNNI-AWQSWPADGVNANFITRTAEPEALDKLKGSIARVAMYAGE 106

Query: 107 PIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT 166
           P+R  KL+  G   +SS+LP G RA    IS  ++ GG I PND VDV+M R        
Sbjct: 107 PLRRSKLIGEGQSFMSSILPSGMRAVATAISADTSAGGFILPNDFVDVIMTRRADAASGA 166

Query: 167 ----VTVVLSNIRVIAIDHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSL 218
                  +L NIRV+AID  I  DE   +  VG TATLELTP QA+ +  AQ +A +L+L
Sbjct: 167 AGFNTETILKNIRVLAIDQTIQEDEEGKKTRVGQTATLELTPKQAEIITVAQQMADRLTL 226

Query: 219 VLRSIADLNPSSSEDSDVWDVQEEGKE--IQIIKAG 252
            LR++AD    +  ++D + V   G+   +++IK+G
Sbjct: 227 ALRAVADTQEKNVGEAD-YLVSGNGRRGTVRLIKSG 261


>gi|90425196|ref|YP_533566.1| Flp pilus assembly CpaB [Rhodopseudomonas palustris BisB18]
 gi|90107210|gb|ABD89247.1| Flp pilus assembly CpaB [Rhodopseudomonas palustris BisB18]
          Length = 265

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 87/252 (34%), Positives = 137/252 (54%), Gaps = 16/252 (6%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPE 73
             A+ AG +A  L S    Q            ++VL++K D+ +G  +TP  ++W  +P 
Sbjct: 10  TIAVGAGGVAAYLASGADQQPPPAAPVAQLPTVDVLVAKSDIPLGQALTPGDVQWQVWPA 69

Query: 74  ENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD-RGNGGLSSLLPKGKRAA 132
               + FI    +P+A  ++ G + R   + G+PIR  KLV   G+G ++++LP G RA 
Sbjct: 70  ATASEMFIRRNVRPDATTQIVGSIARSAFIAGEPIRDLKLVKANGSGFMAAILPSGMRAV 129

Query: 133 TMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT---------VVLSNIRVIAIDHNI 183
           + +IS  +  GG I PND VDV++  S  E+ P            ++LSNIRV+AID  I
Sbjct: 130 STEISPETGAGGFILPNDRVDVIL--SKREKNPDARASGDGVNSEIILSNIRVLAIDQTI 187

Query: 184 D--SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQE 241
           +  + ++V+VG TATLEL P Q++ L  A+    LSL LRS+AD N + ++  D  D   
Sbjct: 188 EEKNGQKVVVGKTATLELKPEQSEGLARARQSGTLSLALRSLADANSAVADTPD--DRSA 245

Query: 242 EGKEIQIIKAGV 253
           +   I +++ GV
Sbjct: 246 KRDSINVVRFGV 257


>gi|148258234|ref|YP_001242819.1| putative pilus assembly protein CpaB [Bradyrhizobium sp. BTAi1]
 gi|146410407|gb|ABQ38913.1| Putative pilus assembly protein, cpaB [Bradyrhizobium sp. BTAi1]
          Length = 249

 Score =  132 bits (331), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 122/220 (55%), Gaps = 16/220 (7%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKG 105
           + VL++K D+ +G  + P  L+W ++P       FI    +     E+ G++ R P + G
Sbjct: 26  VEVLVAKSDINLGQSLKPEHLQWQSWPAATTSSSFIQRKDRSKGDAEVTGMIARAPFIAG 85

Query: 106 DPIRLEKLVDR-GNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK 164
           +PIR +KLV   G+G ++++LP G RA + +IS  +  GG I PND VDV++  S  ER 
Sbjct: 86  EPIREQKLVKADGSGFMAAILPAGMRAVSTEISPETGAGGFILPNDRVDVLL--SKRERN 143

Query: 165 P---------TVTVVLSNIRVIAIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSV 213
           P         +  ++LSNIRV+AID        +  +VG T TLEL P QA+ L  A+  
Sbjct: 144 PEQPNAGDVISSEIILSNIRVLAIDQAPKEKDGQTTVVGKTVTLELKPEQAETLARARQS 203

Query: 214 AKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAGV 253
             LSL LRSIAD+N   +E+    + +  G  + +I+ G+
Sbjct: 204 GTLSLALRSIADIN--VAENRSDENSRRRGDSVAVIRFGI 241


>gi|304392385|ref|ZP_07374326.1| Flp pilus assembly protein CpaB [Ahrensia sp. R2A130]
 gi|303295489|gb|EFL89848.1| Flp pilus assembly protein CpaB [Ahrensia sp. R2A130]
          Length = 286

 Score =  132 bits (331), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 133/236 (56%), Gaps = 13/236 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHH---VQTEE--VITENPAKFINVLISKGDL 55
           MK  +L+ I V+ V +L AG + M +  P     VQT+    I   P +   VL++  D+
Sbjct: 14  MKPVQLVLIAVALVASLGAGYLVMNMSEPPAQVVVQTDNGPAIPTIPTRL--VLVAVADV 71

Query: 56  AVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD 115
             G  ++ N + +  +PE  V   F+     P A+++  G + R     G+PIR  K+V 
Sbjct: 72  PQGTTLSENNMRFEEWPETGVRPSFVTQKDAPEAIKDFSGAIARSSFFAGEPIRDAKIVR 131

Query: 116 RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL-SERKPTVT-VVLSN 173
             +G LS++LP GKRA  ++I+ SS+ GG I PNDHVDV+M R    E+   +T  +L N
Sbjct: 132 SDSGYLSAILPAGKRAVAIEITASSSAGGFILPNDHVDVIMARQQDGEQNVIITDTILQN 191

Query: 174 IRVIAIDHNIDSDE--RVLVGSTATLELTPMQAKALVAAQSVAK--LSLVLRSIAD 225
           IRV+A+D  I+ +E  +  VG T TLELT  Q + + AAQ + +  L+L LRS+ D
Sbjct: 192 IRVLALDQLIEEEEGKKSTVGETVTLELTAEQVEIVAAAQQINRRGLTLALRSVED 247


>gi|91977984|ref|YP_570643.1| Flp pilus assembly CpaB [Rhodopseudomonas palustris BisB5]
 gi|91684440|gb|ABE40742.1| Flp pilus assembly CpaB [Rhodopseudomonas palustris BisB5]
          Length = 266

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 117/202 (57%), Gaps = 16/202 (7%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKG 105
           + VL++K D+ +G  V P  ++W  +P       FI    +P A  +L G + R   + G
Sbjct: 44  VEVLVAKSDIPLGQPVGPGDMQWQTWPAATASANFIRRNERPEATTQLAGSIARSQFIAG 103

Query: 106 DPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK 164
           +PIR +KLV   G+G ++++LP G RA + +IS  +  GG I PND VDV++  S  ++ 
Sbjct: 104 EPIREQKLVKANGSGFMAAILPTGMRAVSTEISPETGAGGFILPNDRVDVIL--SKRDKN 161

Query: 165 P----------TVTVVLSNIRVIAIDHNID--SDERVLVGSTATLELTPMQAKALVAAQS 212
           P              +LSN+RV+AID  I+  + ++V+VG TATLEL P QA+ L  A+ 
Sbjct: 162 PDRAGSGGDVVNSETILSNVRVLAIDQAIEEKNGQKVVVGKTATLELKPEQAEFLARARQ 221

Query: 213 VAKLSLVLRSIADLN-PSSSED 233
              LSL LRS+ D N P+++E+
Sbjct: 222 SGTLSLALRSLVDANAPTATEE 243


>gi|27376551|ref|NP_768080.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
 gi|27349692|dbj|BAC46705.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
          Length = 269

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 108/192 (56%), Gaps = 11/192 (5%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKG 105
           ++VL++K D+ +G  V P  ++W  +P       FI    +P  + ++ G + R P ++G
Sbjct: 46  VDVLVAKNDIGLGQTVKPEDVQWQTWPAATASATFIRRNERPEGVTQVTGSIARAPFIQG 105

Query: 106 DPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK 164
           +PIR +KLV   G+G ++++LP G RA + +IS  +  GG I PND VDV++ R L    
Sbjct: 106 EPIRDQKLVKAEGSGFMAAILPTGMRAISTEISPETGAGGFILPNDRVDVLLTRRLKNPD 165

Query: 165 P--------TVTVVLSNIRVIAIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVA 214
           P        T  ++L+NIRV+AID        +  +VG T TLEL P Q   L AA+   
Sbjct: 166 PSNGAPDIVTSEIILANIRVLAIDQAPKEKDGQNTVVGKTVTLELNPTQTATLSAARQSG 225

Query: 215 KLSLVLRSIADL 226
            LSL LRSI D+
Sbjct: 226 TLSLALRSIVDV 237


>gi|192292976|ref|YP_001993581.1| Flp pilus assembly protein CpaB [Rhodopseudomonas palustris TIE-1]
 gi|192286725|gb|ACF03106.1| Flp pilus assembly protein CpaB [Rhodopseudomonas palustris TIE-1]
          Length = 270

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 121/205 (59%), Gaps = 11/205 (5%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKG 105
           ++VL++K ++A+G +VTP+ + W ++P ++  + F+     PN    L G + R P + G
Sbjct: 46  VDVLVAKSNIALGQLVTPSDVRWQSWPADSASEHFLRRDKMPNTEAFLAGTIARSPFVAG 105

Query: 106 DPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV-RSLSER 163
           +PIR  KLV   G+G ++++LP G RA + +IS  ++ GG I PND VDV++  R  S  
Sbjct: 106 EPIREVKLVKPNGSGFMAAILPTGMRAVSTEISPETSAGGFILPNDKVDVILTKRDKSSD 165

Query: 164 KP------TVTVVLSNIRVIAIDHNIDSDE--RVLVGSTATLELTPMQAKALVAAQSVAK 215
            P      T T +L+N+RV+AID      E   V+VG TATLELT  QA+ L  A+    
Sbjct: 166 IPGAKDTVTSTTILTNVRVLAIDQLPKEREGQNVVVGKTATLELTGDQAEVLTRARQSGT 225

Query: 216 LSLVLRSIADLNPSSSEDSDVWDVQ 240
           LSL LRSIAD     +E SD  D Q
Sbjct: 226 LSLALRSIADAR-VVAEASDQGDKQ 249


>gi|39937141|ref|NP_949417.1| Flp pilus assembly CpaB [Rhodopseudomonas palustris CGA009]
 gi|39650999|emb|CAE29522.1| possible pilus assembly protein cpaB [Rhodopseudomonas palustris
           CGA009]
          Length = 270

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 115/190 (60%), Gaps = 10/190 (5%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKG 105
           ++VL++K ++A+G +VTP+ + W ++P ++  + F+     PN    L G + R P + G
Sbjct: 46  VDVLVAKSNIALGQLVTPSDVRWQSWPADSASEHFLRRDKMPNTEAFLAGTIARSPFVAG 105

Query: 106 DPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV-RSLSER 163
           +PIR  KLV   G+G ++++LP G RA + +IS  ++ GG I PND VDV++  R  S  
Sbjct: 106 EPIREVKLVKPNGSGFMAAILPTGMRAVSTEISPETSAGGFILPNDKVDVILTKRDKSSD 165

Query: 164 KP------TVTVVLSNIRVIAIDHNIDSDE--RVLVGSTATLELTPMQAKALVAAQSVAK 215
            P      T T +L+N+RV+AID      E   V+VG TATLELT  QA+ L  A+    
Sbjct: 166 IPGAKDTVTSTTILTNVRVLAIDQLPKEREGQNVVVGKTATLELTGDQAEVLTRARQSGT 225

Query: 216 LSLVLRSIAD 225
           LSL LRSIAD
Sbjct: 226 LSLALRSIAD 235


>gi|209886527|ref|YP_002290384.1| Flp pilus assembly protein CpaB [Oligotropha carboxidovorans OM5]
 gi|209874723|gb|ACI94519.1| Flp pilus assembly protein CpaB [Oligotropha carboxidovorans OM5]
          Length = 272

 Score =  129 bits (324), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 71/192 (36%), Positives = 112/192 (58%), Gaps = 13/192 (6%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
           +VL++K D+ +G  +    + W  +P       FI    + +A+ +L G + R P L G+
Sbjct: 44  DVLVAKADIPLGQTIKAEDMTWQTWPAATASSSFIRKSERASAVADLTGSIARSPFLAGE 103

Query: 107 PIRLEKLV-DRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP 165
           PIR  KLV   G+G ++++LP G RA + +IS  +  GG I PND VDV++ R   +R P
Sbjct: 104 PIRETKLVKSNGSGFMAAILPSGMRAVSTEISPETGAGGFILPNDRVDVMLSR--RQRNP 161

Query: 166 --------TVTVVLSNIRVIAIDHNID--SDERVLVGSTATLELTPMQAKALVAAQSVAK 215
                   +  ++LS++RV+AID  I+  + ++V+VG TATLEL P QA+ L  ++    
Sbjct: 162 DSNGGEMVSSEIILSDVRVLAIDQTIEEKNGQKVVVGKTATLELKPAQAEMLTRSRQSGT 221

Query: 216 LSLVLRSIADLN 227
           L+L LRS+ D N
Sbjct: 222 LTLALRSLVDAN 233


>gi|218530653|ref|YP_002421469.1| Flp pilus assembly protein CpaB [Methylobacterium chloromethanicum
           CM4]
 gi|218522956|gb|ACK83541.1| Flp pilus assembly protein CpaB [Methylobacterium chloromethanicum
           CM4]
          Length = 261

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 126/234 (53%), Gaps = 14/234 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLV-----SPHHVQTEEVITENPAKFINVLISKGDL 55
           MK  RL    V G+ ALVAG  A  L+     +P  V   +     P     VL++  +L
Sbjct: 1   MKPARL---AVLGI-ALVAGCGAALLMQGEEKAPEAVPVAKAEPVAPVPMSEVLVAAAEL 56

Query: 56  AVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD 115
            +G  + P  L W+A+PE+ +  G I+    P  +++  G ++R      +PIR E+LV 
Sbjct: 57  PMGQTLKPEDLRWLAWPEQAISPGLIERRAAPKGLEDAVGAIIRTGFSANEPIRPERLVK 116

Query: 116 RGNGGLSSLLPKGKRAA--TMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSN 173
            G+G +S++LP G RA   T D   SS+ GG + PNDHVDV+   +    +   T +L++
Sbjct: 117 AGSGFMSAILPPGMRAVAITTDTRGSSSAGGFVLPNDHVDVIKTSNEGTEQFAET-LLTD 175

Query: 174 IRVIAIDHNIDSDE--RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           +RV+A+   +       V+   TATL LTP QA+ +  AQ V +LSLVLRSI D
Sbjct: 176 VRVLAVGQIVQEKNGANVVTAETATLALTPSQAETVTLAQKVGQLSLVLRSIQD 229


>gi|163851902|ref|YP_001639945.1| Flp pilus assembly protein CpaB [Methylobacterium extorquens PA1]
 gi|254561620|ref|YP_003068715.1| pilus assembly protein cpaB [Methylobacterium extorquens DM4]
 gi|163663507|gb|ABY30874.1| Flp pilus assembly protein CpaB [Methylobacterium extorquens PA1]
 gi|254268898|emb|CAX24859.1| pilus assembly protein cpaB [Methylobacterium extorquens DM4]
          Length = 261

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 91/264 (34%), Positives = 140/264 (53%), Gaps = 20/264 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVS-------PHHVQTEEVITENPAKFINVLISKG 53
           MK  RL    V G+ ALVAG  A  L+        P  V   E +   P     VL++  
Sbjct: 1   MKPARL---AVLGI-ALVAGCGAALLMQGEEKAPEPAPVAKAEPVA--PVPMSEVLVAAA 54

Query: 54  DLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL 113
           +L +G  + P  L W+A+PE+ +  G I+    P  +++  G ++R      +PIR E+L
Sbjct: 55  ELPMGQTLKPEDLRWIAWPEQAISPGLIERRAAPKGLEDSVGAIIRTGFSANEPIRPERL 114

Query: 114 VDRGNGGLSSLLPKGKRAA--TMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVL 171
           V  G+G +S++LP G RA   T D   SS+ GG + PNDHVDV+   +    +     +L
Sbjct: 115 VKAGSGFMSAILPPGMRAVAITTDTRGSSSAGGFVLPNDHVDVIKTSNEGTEQ-FAETLL 173

Query: 172 SNIRVIAIDHNIDSDE--RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
           +++RV+A+   +       V+   TATL LTP QA+ +  AQ V +LSLVLRSI D +  
Sbjct: 174 TDVRVLAVGQIVQEKNGANVVTAETATLALTPSQAETVTLAQKVGQLSLVLRSIQD-SAR 232

Query: 230 SSEDSDVWDVQEEGKEIQIIKAGV 253
           ++  S+  D+  EG  + +++ GV
Sbjct: 233 TAALSEEADMPPEGP-MTVVRFGV 255


>gi|240139025|ref|YP_002963500.1| pilus assembly protein cpaB [Methylobacterium extorquens AM1]
 gi|240008997|gb|ACS40223.1| pilus assembly protein cpaB [Methylobacterium extorquens AM1]
          Length = 261

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 91/264 (34%), Positives = 140/264 (53%), Gaps = 20/264 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVS-------PHHVQTEEVITENPAKFINVLISKG 53
           MK  RL    V G+ ALVAG  A  L+        P  V   E +   P     VL++  
Sbjct: 1   MKPARL---AVLGI-ALVAGCGAALLMQGEEKAPEPAPVAKAEPVV--PVPMSEVLVAAA 54

Query: 54  DLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL 113
           +L +G  + P  L W+A+PE+ +  G I+    P  +++  G ++R      +PIR E+L
Sbjct: 55  ELPMGQTLKPEDLRWIAWPEQAISPGLIERRAAPKGLEDSVGAIIRTGFSANEPIRPERL 114

Query: 114 VDRGNGGLSSLLPKGKRAA--TMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVL 171
           V  G+G +S++LP G RA   T D   SS+ GG + PNDHVDV+   +    +     +L
Sbjct: 115 VKAGSGFMSAILPPGMRAVAITTDTRGSSSAGGFVLPNDHVDVIKTSNEGTEQ-FAETLL 173

Query: 172 SNIRVIAIDHNIDSDE--RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
           +++RV+A+   +       V+   TATL LTP QA+ +  AQ V +LSLVLRSI D +  
Sbjct: 174 TDVRVLAVGQIVQEKNGANVVTAETATLALTPSQAETVTLAQKVGQLSLVLRSIQD-SAR 232

Query: 230 SSEDSDVWDVQEEGKEIQIIKAGV 253
           ++  S+  D+  EG  + +++ GV
Sbjct: 233 TAALSEEADMPPEGP-MTVVRFGV 255


>gi|115526291|ref|YP_783202.1| Flp pilus assembly CpaB [Rhodopseudomonas palustris BisA53]
 gi|115520238|gb|ABJ08222.1| putative pilus assembly protein cpaB [Rhodopseudomonas palustris
           BisA53]
          Length = 268

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 111/194 (57%), Gaps = 10/194 (5%)

Query: 44  KFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPIL 103
           K ++VL++K +LA+G +V P+ ++W  +P ++    FI     PN    + G + R P +
Sbjct: 44  KTVDVLVAKTNLALGQLVGPSDVQWQNWPADSANSNFIRRDQHPNFDTTVAGSIARSPFV 103

Query: 104 KGDPIRLEKLV-DRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVR---- 158
            G+PIR  KLV   G+G ++++LP G RA + +IS  +  GG I PND VDV++ +    
Sbjct: 104 AGEPIREVKLVRPNGSGFMAAILPSGMRAISTEISPETGAGGFILPNDRVDVILSKRERN 163

Query: 159 ---SLSERKPTVTVVLSNIRVIAIDHNIDSDE--RVLVGSTATLELTPMQAKALVAAQSV 213
                S+   T   +L+N+RV+AID      E   V VG TATLEL P QA+ L  A+  
Sbjct: 164 SDSESSKENVTSVTILTNVRVLAIDQLPKEREGQNVAVGKTATLELLPEQAEQLARARQS 223

Query: 214 AKLSLVLRSIADLN 227
             LSL LRS+ D N
Sbjct: 224 GTLSLALRSMVDSN 237


>gi|254293213|ref|YP_003059236.1| Flp pilus assembly protein CpaB [Hirschia baltica ATCC 49814]
 gi|254041744|gb|ACT58539.1| Flp pilus assembly protein CpaB [Hirschia baltica ATCC 49814]
          Length = 321

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 73/194 (37%), Positives = 112/194 (57%), Gaps = 12/194 (6%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKG 105
           + VL++  DL VG  V    L W ++PEE+    F  +   P+A++ + G +VR  ++ G
Sbjct: 54  LKVLVATTDLKVGQFVKEGQLSWQSWPEESNTSSFFTEEMSPDAIEAMQGAVVRTNMMAG 113

Query: 106 DPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK 164
           +P+  EK+V  G  G ++++L  G RA  ++IS  +A GG I PNDHVDV++   +   +
Sbjct: 114 EPLTSEKVVHPGEAGFMAAVLTPGMRAVAVEISAETAAGGFIFPNDHVDVLLTFEVDVER 173

Query: 165 PT-------VTVVLSNIRVIAIDHNIDSDER----VLVGSTATLELTPMQAKALVAAQSV 213
           PT       +  +L+N+RV+AID      E      +VG  ATLEL+   A  L+AAQ  
Sbjct: 174 PTGITEETAIDTILNNVRVLAIDGYYRPVEEEAGDAVVGHRATLELSKQDAMVLMAAQER 233

Query: 214 AKLSLVLRSIADLN 227
             LSLVLRSI++L+
Sbjct: 234 GDLSLVLRSISELS 247


>gi|300021853|ref|YP_003754464.1| Flp pilus assembly protein CpaB [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299523674|gb|ADJ22143.1| Flp pilus assembly protein CpaB [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 267

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 87/263 (33%), Positives = 143/263 (54%), Gaps = 16/263 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  +L+G  V+   A +A  IA   ++P     + V  E       VL++  D++VG +
Sbjct: 1   MKRAQLVGFSVAFAAAALAYYIASAFMTP----PKTVTVEKQVDSTEVLVAATDISVGQI 56

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQ-PNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG 119
           V      W  +P+  V   ++   +  P    E  G + R  IL G+P+  +KL+  G G
Sbjct: 57  VNEGNFHWATWPKSAVTADYVTKANSGPGKAHEFTGAVARSAILSGEPVTTQKLIKAGQG 116

Query: 120 G-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM---VRSLSERKPTVT-VVLSNI 174
           G L+++LP+G RA +  I   +A G +I PNDHVDV++   VRS S ++ TV   +  N+
Sbjct: 117 GVLAAILPQGMRAISTKIKAETAAGSLILPNDHVDVILIRHVRSRSGQEETVADTLFRNV 176

Query: 175 RVIAIDHNIDSDERV----LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           RV+AI   I++ +      +  STATLEL P QA+ +  A S+ +++L LRS+ADL+ S 
Sbjct: 177 RVMAIGQQIETKDGKKSADISASTATLELMPKQAEMMALANSMGEITLSLRSVADLS-SD 235

Query: 231 SEDSDVWDVQE-EGKEIQIIKAG 252
            E +   D+ + +   ++I++ G
Sbjct: 236 PERAGNLDLNKPQNNSVRIVRYG 258


>gi|254473714|ref|ZP_05087109.1| Flp pilus assembly protein CpaB [Pseudovibrio sp. JE062]
 gi|211957100|gb|EEA92305.1| Flp pilus assembly protein CpaB [Pseudovibrio sp. JE062]
          Length = 259

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 124/230 (53%), Gaps = 6/230 (2%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK +RL+ ++++     +A  + +   S    QT  V+ E     + +L++  DL VG  
Sbjct: 1   MKASRLLVLIIALSAGGLAAWLNLSSGSREPAQTI-VVQEQEIPSLEILVAAQDLKVGTA 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +T   L W  +PEE+V DG I     P A +E  G +++  +  G+PIR E+L++   G 
Sbjct: 60  LTEGDLSWAKWPEESVSDGVILRSSSPQADEEFLGQIIKAAMFSGEPIRAERLINTDKGF 119

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTV--TVVLSNIRVIA 178
           L+++LPKGKRA  + +   S  GG I P D VDV++     +R        +L NI+V+A
Sbjct: 120 LAAILPKGKRAVAVPVDAVSTAGGFILPGDKVDVLISMQAKKRDEGFISETLLENIKVLA 179

Query: 179 IDHNI---DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           ID      +S++ +    TATLEL P +A+ +  A  +  LSL LRS AD
Sbjct: 180 IDTTTASENSEKAMSPDQTATLELFPHEAETIARATQMGTLSLSLRSAAD 229


>gi|188581659|ref|YP_001925104.1| Flp pilus assembly protein CpaB [Methylobacterium populi BJ001]
 gi|179345157|gb|ACB80569.1| Flp pilus assembly protein CpaB [Methylobacterium populi BJ001]
          Length = 260

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 87/261 (33%), Positives = 139/261 (53%), Gaps = 15/261 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLV----SPHHVQTEEVITENPAKFINVLISKGDLA 56
           MK  RL    V G+ ALVAG  A  L+    +P      +     P     VL++  +L 
Sbjct: 1   MKPARL---AVLGI-ALVAGCGAALLMGGEKAPEPAPVVKAEPPPPIPMSEVLVAAAELP 56

Query: 57  VGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR 116
           +G  + P  L W+ +PE+ +  G ID    P  +++  G ++R      +PIR E+L+  
Sbjct: 57  MGQTLKPEDLRWIPWPEQAIAPGLIDRRAAPKGLEDAVGAIIRTGFSANEPIRPERLIKA 116

Query: 117 GNGGLSSLLPKGKRAA--TMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNI 174
           G+G +S++LP G RA   T D   SS+ GG I PNDHVD++   +    +     +L+++
Sbjct: 117 GSGFMSAILPPGMRAVAITTDTRGSSSAGGFILPNDHVDIIKTSNEGSDQ-FAETLLTDV 175

Query: 175 RVIAIDHNID--SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSE 232
           RV+A+   +   +   V+   TAT+ LTP QA+ +  AQ V +LSLVLRSI D +  ++ 
Sbjct: 176 RVLAVGQIVQDKNGANVVTAETATVALTPAQAETVTLAQKVGQLSLVLRSIQD-SARTAA 234

Query: 233 DSDVWDVQEEGKEIQIIKAGV 253
            S+  D+  EG  + +++ GV
Sbjct: 235 LSEEADLPPEGP-MTVVRFGV 254


>gi|227818614|ref|YP_002822585.1| CpaB2, Flp pilus assembly protein CpaB [Sinorhizobium fredii
           NGR234]
 gi|36958870|gb|AAQ87295.1| Pilus assembly protein, CpaB [Sinorhizobium fredii NGR234]
 gi|227337613|gb|ACP21832.1| CpaB2, Flp pilus assembly protein CpaB [Sinorhizobium fredii
           NGR234]
          Length = 263

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 84/223 (37%), Positives = 123/223 (55%), Gaps = 15/223 (6%)

Query: 14  VFALVAG----IIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWV 69
           +FAL +G     +A+       V+  EV  ++P++   VL++  +LA G  +    L W 
Sbjct: 8   LFALASGGAASWLALGFADQPTVEAAEV-QQSPSQ--EVLVAAQELARGTTLEEPHLRWQ 64

Query: 70  AFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGK 129
           A+ E  +   FI    +P+A + L G+L +   + G+PIR +KL  RG G LSS+LP GK
Sbjct: 65  AW-EGEIPPVFISRSARPDAKESLKGLLAQSSFVAGEPIREDKLAQRGAGFLSSMLPSGK 123

Query: 130 RAATMDISISSAVGGMIKPNDHVDVVMV-----RSLSERKPTVTVVLSNIRVIAIDHNID 184
           RA  + ++  S  GG I PNDHVDV+        S  + K     VLSNIRV+A+D  I 
Sbjct: 124 RAIAVRVTAESTAGGFILPNDHVDVIHTVARPDSSGKDGKVVSRAVLSNIRVLAVDQTIS 183

Query: 185 --SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
             +D   +VG TATLE  P Q   + AA++   +SL LR++AD
Sbjct: 184 EGADGTSVVGKTATLEADPGQIDIIAAAEASGTVSLALRAVAD 226


>gi|328545280|ref|YP_004305389.1| Flp pilus assembly CpaB [polymorphum gilvum SL003B-26A1]
 gi|326415022|gb|ADZ72085.1| Flp pilus assembly CpaB [Polymorphum gilvum SL003B-26A1]
          Length = 258

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 83/234 (35%), Positives = 130/234 (55%), Gaps = 14/234 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLV----SPHHVQTEEVITENPAKFINVLISKGDLA 56
           MK  RLM   + GV A+ AG++A R+V    +P   QT E + E   + + VL++  D+ 
Sbjct: 1   MKYARLM---ILGV-AMGAGLLAARMVMTTKAPEVPQTVERV-EPEKQTVAVLVATRDIR 55

Query: 57  VGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR 116
           +G  +  + + W  +PE  V  G I   +QP+A + + G + + PI  G+PIR ++L+  
Sbjct: 56  LGDHLAASDISWAEWPENVVPQGAITRQNQPDAEELMVGQIAKAPIYSGEPIRGQRLIRT 115

Query: 117 GNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT--VVLSNI 174
             G ++++LPKGKRA  + +   +  GG I P D VDV++ RS    +       +L N+
Sbjct: 116 DRGFMAAILPKGKRAIAVGVEAETTAGGFILPGDKVDVILTRSSDSNRSNARSETILENV 175

Query: 175 RVIAIDHNI--DSDERVLV-GSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           RV+AID     + DE+ L    TATLEL+  QA+ +  AQ +  +SL LRS  D
Sbjct: 176 RVLAIDTTTAGEQDEKSLSPDRTATLELSLEQAEVVAQAQQIGTISLALRSAQD 229


>gi|254502627|ref|ZP_05114778.1| Flp pilus assembly protein CpaB [Labrenzia alexandrii DFL-11]
 gi|222438698|gb|EEE45377.1| Flp pilus assembly protein CpaB [Labrenzia alexandrii DFL-11]
          Length = 256

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 85/261 (32%), Positives = 140/261 (53%), Gaps = 22/261 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLV-----SPHHVQTEEVITENPAKFINVLISKGDL 55
           MK  R++ + +    A+ AG++A R+V     S        V  E       VL +  D+
Sbjct: 3   MKFARILVLAI----AVAAGVLAFRMVMMSGGSSDQASNAPVPLEQAKG--QVLTAATDI 56

Query: 56  AVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD 115
            +G  +T   + W  +PEE V  G +     P+A +EL G + + PI KG+PIR E+L++
Sbjct: 57  LLGAKLTAEDMVWTDWPEEAVPIGAVTKQVNPSASEELMGQIAKTPIFKGEPIRPERLIN 116

Query: 116 RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIR 175
              G +S++LPKGKRA  + +   +  GG I P D VDV++ R   +   + T +L NIR
Sbjct: 117 TDKGFMSAILPKGKRAIAVSVEAETTAGGFILPGDKVDVILTRRTDDTAISET-ILENIR 175

Query: 176 VIAIDHNI--DSDERVLV-GSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSE 232
           V+AID     + D++ L    TATLELT  Q++ +  +Q V  ++L LRS  D    S++
Sbjct: 176 VLAIDTTTAGEQDQKNLSPQRTATLELTLGQSEVVAQSQQVGAIALALRSAQD----SAD 231

Query: 233 DSDVWDVQEEGKEIQIIKAGV 253
           D++  + +   + + ++K G+
Sbjct: 232 DAEPTETR---RGVNLVKYGI 249


>gi|323137424|ref|ZP_08072502.1| Flp pilus assembly protein CpaB [Methylocystis sp. ATCC 49242]
 gi|322397411|gb|EFX99934.1| Flp pilus assembly protein CpaB [Methylocystis sp. ATCC 49242]
          Length = 267

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 110/203 (54%), Gaps = 10/203 (4%)

Query: 33  QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQE 92
           Q   V+   P     VL++  DL  G  +    + WV +P+ +V  G +     PNA +E
Sbjct: 31  QAPVVVAPPPMNTEQVLVATRDLTYGTEIVDQDMAWVEWPKTSVPVGSLTKTESPNAQEE 90

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGNGGL-SSLLPKGKRAATMDISISSAVGGMIKPNDH 151
           +    VR+PI  G+PIR ++L+     GL S++L  GKRA  +D+++++  GG I PND 
Sbjct: 91  VKSSYVRIPIAGGEPIRKDRLIKGVTAGLMSTMLSPGKRAIAIDVTLNNTAGGFILPNDR 150

Query: 152 VDVV-------MVRSLSERKPTVTVVLSNIRVIAIDHNIDSD--ERVLVGSTATLELTPM 202
           VDV+         + L        VVLSN+RV+A+   I+    E V+ GSTATLEL P 
Sbjct: 151 VDVLRTYRDTEATKDLGHEVYNSEVVLSNVRVLAMGQTIEKKGAEPVVTGSTATLELDPR 210

Query: 203 QAKALVAAQSVAKLSLVLRSIAD 225
           QA+ +V AQ   +L L LR I D
Sbjct: 211 QAELVVLAQRTGQLVLSLRPITD 233


>gi|307943144|ref|ZP_07658489.1| Flp pilus assembly protein CpaB [Roseibium sp. TrichSKD4]
 gi|307773940|gb|EFO33156.1| Flp pilus assembly protein CpaB [Roseibium sp. TrichSKD4]
          Length = 256

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 82/233 (35%), Positives = 124/233 (53%), Gaps = 14/233 (6%)

Query: 1   MKLTRL--MGIVVSGVFALVAGIIAMRLVSPHHVQTEEV--ITENPAKFINVLISKGDLA 56
           MK  RL  +G+ V       AG++A RLVS    + E V  +T    +   VL++  D+ 
Sbjct: 1   MKYARLAILGVAVG------AGLLAARLVSTSAPEPEPVAEVTAPTIEKTEVLVASSDIT 54

Query: 57  VGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR 116
           +G  +  +   W ++P E +  G +     P AM+ L G + R PI  G+PIR E+L+  
Sbjct: 55  LGSKLGGSDFTWASWPTEALPAGVLTKDDDPEAMERLVGQVTRTPIFSGEPIREERLIRT 114

Query: 117 GNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT-VVLSNIR 175
             G ++++LPKG RA  + +   +  GG I P D VDV++ ++  E    V+  +L N+R
Sbjct: 115 DKGFMAAILPKGMRAIAVSVEAETTAGGFILPGDKVDVILTKASGETGSAVSNTILENVR 174

Query: 176 VIAIDHNI--DSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           V+AID     D DE+ V    TATLEL   Q++ +  AQ V  +SL LRS  D
Sbjct: 175 VLAIDAVTAGDQDEKNVSPDRTATLELNLPQSEIISQAQQVGTISLALRSAQD 227


>gi|307304372|ref|ZP_07584123.1| Flp pilus assembly protein CpaB [Sinorhizobium meliloti BL225C]
 gi|307318079|ref|ZP_07597515.1| Flp pilus assembly protein CpaB [Sinorhizobium meliloti AK83]
 gi|306896120|gb|EFN26870.1| Flp pilus assembly protein CpaB [Sinorhizobium meliloti AK83]
 gi|306902574|gb|EFN33168.1| Flp pilus assembly protein CpaB [Sinorhizobium meliloti BL225C]
          Length = 263

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 109/200 (54%), Gaps = 10/200 (5%)

Query: 38  ITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVL 97
           + E P++   VL++  +L  G VV  N L W  + E  +   FI    +P+A   L G L
Sbjct: 35  VQETPSQ--EVLVAAAELKRGAVVEENQLRWQPW-EGEIPPVFISRSSRPDATTALKGSL 91

Query: 98  VRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV 157
                + G+PIR +KL   G G LSSLLP GKRA  + ++  S  GG I PNDHVDV+  
Sbjct: 92  ALSGFVAGEPIRDDKLAQGGTGYLSSLLPSGKRAIAVRVTAESTAGGFILPNDHVDVIHT 151

Query: 158 -----RSLSERKPTVTVVLSNIRVIAIDHNID--SDERVLVGSTATLELTPMQAKALVAA 210
                 S    K     +LSNIRV+A+D  +   SD   ++G TATLE+ P Q  A+ AA
Sbjct: 152 VARPDASGDAGKVVSRAILSNIRVLAVDQTVSQASDGASVIGKTATLEVDPEQISAVAAA 211

Query: 211 QSVAKLSLVLRSIADLNPSS 230
           ++   +SL LR+I D + +S
Sbjct: 212 EASGTVSLALRAITDNHEAS 231


>gi|16263309|ref|NP_436102.1| CpaB2 pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|14523988|gb|AAK65514.1| CpaB2 pilus assembly protein [Sinorhizobium meliloti 1021]
          Length = 263

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 77/200 (38%), Positives = 109/200 (54%), Gaps = 10/200 (5%)

Query: 38  ITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVL 97
           + E P++   VL++  +L  G V+  N L W  + E  +   FI    +P+A   L G L
Sbjct: 35  VQETPSQ--EVLVAAAELKRGAVIEENQLRWQPW-EGEIPPVFISRSSRPDATTALKGSL 91

Query: 98  VRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV 157
                + G+PIR +KL   G G LSSLLP GKRA  + ++  S  GG I PNDHVDV+  
Sbjct: 92  ALSGFVAGEPIRDDKLAQGGTGYLSSLLPSGKRAIAVRVTAESTAGGFILPNDHVDVIHT 151

Query: 158 -----RSLSERKPTVTVVLSNIRVIAIDHNID--SDERVLVGSTATLELTPMQAKALVAA 210
                 S    K     +LSNIRV+A+D  +   SD   ++G TATLE+ P Q  A+ AA
Sbjct: 152 VARPDASGDAGKVVSRAILSNIRVLAVDQTVSQASDGASVIGKTATLEVDPEQISAVAAA 211

Query: 211 QSVAKLSLVLRSIADLNPSS 230
           ++   +SL LR+I D + +S
Sbjct: 212 EASGTVSLALRAITDNHEAS 231


>gi|83859356|ref|ZP_00952877.1| Flp pilus assembly CpaB [Oceanicaulis alexandrii HTCC2633]
 gi|83852803|gb|EAP90656.1| Flp pilus assembly CpaB [Oceanicaulis alexandrii HTCC2633]
          Length = 268

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 115/213 (53%), Gaps = 4/213 (1%)

Query: 44  KFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPIL 103
           + + VL++  D++    V+     W  +P E V   FI    +P+AM EL G + R   +
Sbjct: 45  EVVQVLVAARDMSPSSRVSGADFRWTNWPVEAVIPAFITREARPDAMDELSGAVTRAAFV 104

Query: 104 KGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE 162
            G+PI   KLV  G  G +++++  G RA  + IS  S  GG I PND VDV++  S  +
Sbjct: 105 DGEPILPGKLVQPGEAGFMAAVIDPGMRAVAVPISAESGAGGFILPNDRVDVLVTTSARD 164

Query: 163 RKPTVTVVLSNIRVIAIDHN-IDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
                 V++ N+RV+AID   +D  E V++GSTATLELTP Q  ++    +   + L LR
Sbjct: 165 MGYISEVLVENVRVLAIDQTYVDDGEGVVLGSTATLELTPQQTSSVALGVAEGDIVLALR 224

Query: 222 SIADL--NPSSSEDSDVWDVQEEGKEIQIIKAG 252
           S+AD    P     +D    +  G+E++II+ G
Sbjct: 225 SVADREGGPRLPNGADDEAGERRGREVRIIRYG 257


>gi|154250688|ref|YP_001411512.1| SAF domain-containing protein [Parvibaculum lavamentivorans DS-1]
 gi|154154638|gb|ABS61855.1| SAF domain protein [Parvibaculum lavamentivorans DS-1]
          Length = 250

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 76/225 (33%), Positives = 125/225 (55%), Gaps = 16/225 (7%)

Query: 35  EEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELD 94
           E+ + E P     VL++  +L +G  +    L W  +P+ ++   +I     P A++E  
Sbjct: 35  EQKVVEAPT--TEVLVASSNLQLGQRIGGGDLRWQRWPDTSLNGAYITRNQSPAALEEYT 92

Query: 95  GVLVRVPILKGDPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVD 153
           G + R  +L G+P+  EKLV   G G +S+L+  G RA  + I+  ++ GG I PND VD
Sbjct: 93  GSVARASLLSGEPVTSEKLVTLTGAGFMSALIEPGMRATAISITPETSAGGFILPNDRVD 152

Query: 154 VVMVRSLSERKPTVTVVLSNIRVIAIDHNID--SDERVLVGSTATLELTPMQAKALVAAQ 211
           +V    L++ +     +L NIRV+AID   D  + E+V VG TATLELTP Q + +  A+
Sbjct: 153 IV---DLAKGQ----TILRNIRVLAIDQRFDEKAGEQVAVGRTATLELTPAQVEVVSVAE 205

Query: 212 SVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAGVIVN 256
           +  ++ L LRS+A+ + + SE +    V E G  +++++ G   N
Sbjct: 206 AEGRIGLSLRSMAEQDLAGSEKT----VAEGGSVVKVVRYGTAQN 246


>gi|110632966|ref|YP_673174.1| putative CpaB2 pilus assembly protein [Mesorhizobium sp. BNC1]
 gi|110283950|gb|ABG62009.1| putative CpaB2 pilus assembly protein [Chelativorans sp. BNC1]
          Length = 267

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 80/222 (36%), Positives = 116/222 (52%), Gaps = 10/222 (4%)

Query: 14  VFAL----VAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWV 69
           +FAL    +A  +AM    P   Q    + +       VL++  DL  G V+  + L W 
Sbjct: 8   LFALGSGGIAAWLAMGTAEPTASQPAAAVEQEADPAREVLVAGADLVHGSVLDESHLRWQ 67

Query: 70  AFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGK 129
            +    V   FI    +P+A Q L G LVR   + G+PIR ++L   G G LS  LP GK
Sbjct: 68  PWTAGTVPAVFISRAAKPDAPQALKGSLVRGGFVAGEPIREDRLALPGAGFLSGQLPSGK 127

Query: 130 RAATMDISISSAVGGMIKPNDHVDVVMVRSLSER----KPTVTVVLSNIRVIAIDHNI-- 183
           RA  + ++  SA GG I PND VD++    LS +    + +   +LSNIRV+A+D N   
Sbjct: 128 RAIAVRVTAESAAGGFILPNDRVDLIHTSVLSGQSGGEQVSSRTILSNIRVLAVDQNASG 187

Query: 184 DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           +SD   +V  TATLE+ P Q   + AA++   +SL LR+ +D
Sbjct: 188 ESDGEAVVAKTATLEVEPDQIPIVTAAEASGTISLALRAASD 229


>gi|114799072|ref|YP_761692.1| pilus assembly protein CpaB [Hyphomonas neptunium ATCC 15444]
 gi|114739246|gb|ABI77371.1| pilus assembly protein CpaB [Hyphomonas neptunium ATCC 15444]
          Length = 281

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/200 (37%), Positives = 111/200 (55%), Gaps = 18/200 (9%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKG 105
           I VL +  DL +G  +    L+W  +PE  V +G   +   P A++EL G +V++PI K 
Sbjct: 51  IKVLTASRDLTIGEQIKAEDLQWSIWPELGVAEGQYTETAAPGAVEELTGAVVKMPIYKL 110

Query: 106 DPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK 164
           +PI  +++V RG  G L  L+ +  RA ++ IS  SA GG I PND VD+++     E+ 
Sbjct: 111 EPIMPQRVVKRGEAGLLPVLMGEDMRAVSIGISPESASGGFILPNDRVDLILTY---EQT 167

Query: 165 PTVT-----------VVLSNIRVIAIDHNI---DSDERVLVGSTATLELTPMQAKALVAA 210
           P+ T            VL N+RV+AID      + +E   +G TATLE+ P +A+ +  +
Sbjct: 168 PSATNGLTSARTVSMTVLQNVRVLAIDQTYAPGEPEESTRIGQTATLEVLPSEAELVALS 227

Query: 211 QSVAKLSLVLRSIADLNPSS 230
           QS  +LSL LR + DL  SS
Sbjct: 228 QSKGQLSLALRPLNDLAVSS 247


>gi|118589702|ref|ZP_01547107.1| Flp pilus assembly CpaB [Stappia aggregata IAM 12614]
 gi|118437788|gb|EAV44424.1| Flp pilus assembly CpaB [Stappia aggregata IAM 12614]
          Length = 256

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 62/190 (32%), Positives = 107/190 (56%), Gaps = 4/190 (2%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
            VL+++ D+ +G  ++P+ + W  +PE+ V  G +     P A +E  G + R PI  G+
Sbjct: 47  QVLVAQRDIPLGAKLSPDDMSWANWPEDAVPFGAVTKEAAPLANEEYAGRIARAPIFAGE 106

Query: 107 PIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT 166
           P+R E+L++   G ++++LPKGKRA  + +   ++ GG I P D VDV++ R  S+    
Sbjct: 107 PVRPERLINTDKGFMAAILPKGKRAIAVSVEEETSAGGFILPGDKVDVILTRK-SDTSAV 165

Query: 167 VTVVLSNIRVIAIDHNIDSDER---VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSI 223
              +L NIRV+AID     ++    +    TATLEL+  Q++ +  +Q +  ++L LRS 
Sbjct: 166 SETILENIRVLAIDSTTAGEQEQKNLSPKRTATLELSLPQSEIIAQSQQIGTIALALRSA 225

Query: 224 ADLNPSSSED 233
            D    + +D
Sbjct: 226 QDSADDAEDD 235


>gi|296444396|ref|ZP_06886361.1| Flp pilus assembly protein CpaB [Methylosinus trichosporium OB3b]
 gi|296258043|gb|EFH05105.1| Flp pilus assembly protein CpaB [Methylosinus trichosporium OB3b]
          Length = 264

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 124/229 (54%), Gaps = 13/229 (5%)

Query: 9   IVVSGVFALVAGIIAMRLVS--PHHVQTEEVITENPAKFIN-VLISKGDLAVGMVVTPNI 65
           I V GV A+VAG  A  ++S  P   Q   ++   P +  + VL++  DL  G  +    
Sbjct: 6   IAVLGV-AIVAGGGAFMMLSTEPTPPQPMHLVAPPPPRTTDQVLVAARDLPFGAALAEAD 64

Query: 66  LEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGL-SSL 124
             W+ +P   V  G +     P   ++++G  VR P+  G+PIR E+L+     GL S++
Sbjct: 65  TSWIEWPISAVPPGVLRKSEAPEIKKDIEGAFVRTPLANGEPIRRERLIKGQTPGLMSTM 124

Query: 125 LPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTV------TVVLSNIRVIA 178
           +  G+RA  +D+S ++  GG I PNDHVDV+ +    ++   +       V+L N+RV+A
Sbjct: 125 ISAGRRAVAIDVSPNTTAGGFILPNDHVDVIRLYRDPDQGGQIGSDMNSEVILRNVRVLA 184

Query: 179 ID--HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           +       + E  + G+TATL+L P QA+ ++ AQ   +L+L+LR IAD
Sbjct: 185 MGPVFQTKNGESSVTGATATLDLEPRQAELVILAQRSGQLALMLRPIAD 233


>gi|150377241|ref|YP_001313836.1| SAF domain-containing protein [Sinorhizobium medicae WSM419]
 gi|150031788|gb|ABR63903.1| SAF domain protein [Sinorhizobium medicae WSM419]
          Length = 263

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 79/200 (39%), Positives = 112/200 (56%), Gaps = 10/200 (5%)

Query: 38  ITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVL 97
           + E PA+   VL++  +L  G  +  N L W  + E  +   FI    + +A  EL G L
Sbjct: 35  VEEAPAQ--EVLVAAAELKRGAAIEENHLRWQPW-EGEIPPVFISRSSRADATTELKGSL 91

Query: 98  VRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVV-- 155
                + G+PIR +KL  RG G LSSLLP GKRA  + ++  S  GG I PNDHVDVV  
Sbjct: 92  ALSDFVAGEPIREDKLAQRGTGYLSSLLPSGKRAIAVRVTAESTAGGFILPNDHVDVVHT 151

Query: 156 MVR---SLSERKPTVTVVLSNIRVIAIDHNID--SDERVLVGSTATLELTPMQAKALVAA 210
            VR   +    K     +LSNIRV+A+D  +   +D   ++G TATLE+ P Q  A+ AA
Sbjct: 152 AVRPDAAGDAGKVVSRAILSNIRVLAVDQTVSQAADGTSVIGKTATLEVNPEQIAAVAAA 211

Query: 211 QSVAKLSLVLRSIADLNPSS 230
           ++   +SL LR+I+D + +S
Sbjct: 212 EASGTVSLALRAISDNHEAS 231


>gi|114568969|ref|YP_755649.1| Flp pilus assembly CpaB [Maricaulis maris MCS10]
 gi|114339431|gb|ABI64711.1| Flp pilus assembly CpaB [Maricaulis maris MCS10]
          Length = 278

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 110/190 (57%), Gaps = 11/190 (5%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKG 105
           + +L ++ D+ +G  ++     W A+P+E +  G+I + ++   + +  G +VR PI +G
Sbjct: 44  VRILAARRDVEIGERISAADFYWQAWPDEALAPGYIVE-NRGQTIADFAGSVVRAPISQG 102

Query: 106 DPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV------- 157
           +PI   +LV  G+ G ++++L  G RA  + IS  +  GG I PND VDV++        
Sbjct: 103 EPITGRRLVQPGDAGFMAAVLTPGMRAVAVPISAETGAGGFILPNDRVDVIVSFEEETEG 162

Query: 158 RSLSERKPTVTVVLSNIRVIAIDHNIDS--DERVLVGSTATLELTPMQAKALVAAQSVAK 215
           R  + R      ++ N RV+AID +  S  D+ V VG TATLELTP QA+A+  A +  +
Sbjct: 163 RRGAGRAFVARTIVENARVLAIDQSFSSEADDEVAVGETATLELTPDQARAVSVAVARGE 222

Query: 216 LSLVLRSIAD 225
           ++LVLRS+ D
Sbjct: 223 IALVLRSLTD 232


>gi|170750188|ref|YP_001756448.1| Flp pilus assembly protein CpaB [Methylobacterium radiotolerans JCM
           2831]
 gi|170656710|gb|ACB25765.1| Flp pilus assembly protein CpaB [Methylobacterium radiotolerans JCM
           2831]
          Length = 271

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 118/220 (53%), Gaps = 13/220 (5%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
           +VL++  D+ +G V+    L W  +P+  V +G++     P A++E  G  VR   L G+
Sbjct: 46  DVLVAAIDMPMGQVLRAADLRWQPWPDGAVANGYMTRKINPKALEETVGASVRSGFLTGE 105

Query: 107 PIRLEKLVDRGNGGLSSLLPKGKRAATM--DISISSAVGGMIKPNDHVDVV-MVRSLSER 163
           PIR +KLV   +G ++++LP G RA  +  D   +++ GG I PND VDV+   R  S  
Sbjct: 106 PIRAQKLVRPESGFMAAILPPGMRAVAIVTDSRGTNSAGGFILPNDRVDVIRTFRDESNS 165

Query: 164 KPTVT------VVLSNIRVIAIDHNIDSDE--RVLVGSTATLELTPMQAKALVAAQSVAK 215
           +   +       +L++IRV+AI   +       V+ G TATL +TP QA+ L  AQ V  
Sbjct: 166 RANNSDVQLSQTILTDIRVLAIGQLVQEKNGTNVVTGETATLAVTPAQAETLALAQKVGA 225

Query: 216 LSLVLRSIADLN--PSSSEDSDVWDVQEEGKEIQIIKAGV 253
           L+L LRS+AD    P ++  ++    Q     + +++ GV
Sbjct: 226 LTLSLRSLADAGRPPEATPLAEASAAQMPEPALTVVRFGV 265


>gi|326388865|ref|ZP_08210447.1| Flp pilus assembly CpaB [Novosphingobium nitrogenifigens DSM 19370]
 gi|326206465|gb|EGD57300.1| Flp pilus assembly CpaB [Novosphingobium nitrogenifigens DSM 19370]
          Length = 347

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 128/240 (53%), Gaps = 22/240 (9%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVS----PHHVQTEEVITENPAKFINVLISKGDLA 56
           M   +L+ +V + +FA+   + A  L++    P  +   +V+ + P     VL+++  L 
Sbjct: 1   MDRKKLILLVGALIFAIATSLAARALLTGGSTPQAIAAAKVL-DGP----KVLVAQRALP 55

Query: 57  VGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR 116
           VG ++T + + + A+P++ V D +   +     MQ+L G +VR PI  G PI    LV  
Sbjct: 56  VGTIITADAVSYQAWPKDLVQDAYF--LQDKTDMQKLLGTVVRNPITAGQPITTGSLVAP 113

Query: 117 GNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL-----SERKPTVTVV 170
           G+ G L++ L  G RA T+ +S  + V G + P DHVD+++ +S+     S+       +
Sbjct: 114 GDRGFLAAALGPGMRAVTIPVSTRTGVAGFVFPGDHVDLLLTQSVKGDGESQALKATETI 173

Query: 171 LSNIRVIAIDHN-----IDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           L N+RV+A D +     +D   RV   S  T+E TP  A+ L  A+S+  +SL LRSIAD
Sbjct: 174 LKNLRVLATDQSTDQETVDGHTRVKGFSLVTVEATPKIAEELAVAESIGTISLSLRSIAD 233


>gi|167648153|ref|YP_001685816.1| Flp pilus assembly protein CpaB [Caulobacter sp. K31]
 gi|167350583|gb|ABZ73318.1| Flp pilus assembly protein CpaB [Caulobacter sp. K31]
          Length = 296

 Score =  102 bits (254), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 138/292 (47%), Gaps = 44/292 (15%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENP--AKFINVLISKGDLAVG 58
           M   R+M ++++ V A+   ++  +++S             P       VL++K DLA+G
Sbjct: 1   MNPLRVMIVLIAAVSAIGLAVVMQKMMSGKAPSAPIAQASAPVGKPMTQVLVAKRDLAIG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFI--------------------DDVHQP-----NAMQEL 93
             +T   + W  +P + +   FI                     DV +         + +
Sbjct: 61  QRLTAADVTWQPWPSDTINAAFITNGAADPVPAKATAKAAKAVGDVAEGMIGGVTPEKAV 120

Query: 94  DGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHV 152
           +G +VR PIL G+PI   K+V  G GG LS +L  GKRA  + ++  +AVGG + P D V
Sbjct: 121 EGAIVRDPILAGEPITSRKIVRGGEGGYLSVVLSPGKRAMAVPVTSETAVGGFVLPGDRV 180

Query: 153 DVVMVR---------SLSERKPTVTVVLSNIRVIAIDHNI--DSDERVLVGSTATLELTP 201
           DV+  R           S +      ++ N+RV+A+D     + D + +V +TATLE+ P
Sbjct: 181 DVIQTREAQSVGEGEGASGKHTIAETIVQNVRVLALDQATAAEKDAKTIVATTATLEVGP 240

Query: 202 MQAKALVAAQSVAKLSLVLRSIADL-NPSS----SEDSDVWDVQEEGKEIQI 248
           ++A+AL  A++   ++L LR+  DL  PS     S+++ V  +   G+   I
Sbjct: 241 IEAEALTRAKAAGPVTLTLRAYTDLGGPSGLAVRSQEASVVRINRGGETSNI 292


>gi|87199102|ref|YP_496359.1| Flp pilus assembly CpaB [Novosphingobium aromaticivorans DSM 12444]
 gi|87134783|gb|ABD25525.1| Flp pilus assembly CpaB [Novosphingobium aromaticivorans DSM 12444]
          Length = 342

 Score =  102 bits (253), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 73/236 (30%), Positives = 126/236 (53%), Gaps = 14/236 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   +LM +V + + A+     A  L + +     E   + P     VL+++  L VG +
Sbjct: 1   MDKRKLMLLVGALIVAIGTAFAARSLFAGNSTPQAEAAAKVPTG-PKVLVAQRALPVGTI 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +T + + + A+P++ V D +   V     MQ+L G +VR PI  G+P+    LV  G+ G
Sbjct: 60  ITADSINFQAWPKDMVQDAYF--VEGEADMQKLLGTVVRNPITAGEPVTKGNLVAPGDRG 117

Query: 121 -LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTV-----VLSNI 174
            L++ L  G RA T+ +S  + V G + P DH+D+V+ +++      + +     +L N+
Sbjct: 118 FLAAALGAGMRAVTIPVSARTGVAGFVFPGDHIDLVLTQTVKGTGEGMALKASETILKNL 177

Query: 175 RVIAIDHNIDSDE-----RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           RV+A D + + ++     RV   ST TLE+TP  A+ +  AQ++  +SL LRS+AD
Sbjct: 178 RVLATDQSTEQEQVEGKTRVRTFSTVTLEVTPKIAEKIAVAQTIGTISLSLRSLAD 233


>gi|85707703|ref|ZP_01038769.1| pilus assembly protein CpaB [Erythrobacter sp. NAP1]
 gi|85689237|gb|EAQ29240.1| pilus assembly protein CpaB [Erythrobacter sp. NAP1]
          Length = 365

 Score =  102 bits (253), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 107/189 (56%), Gaps = 12/189 (6%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
            VL++   L  G ++T + + +  +PEE V D +   +   + M +L G +VR P+  G+
Sbjct: 45  KVLVANRALPAGTIITADAMGYQMWPEELVQDAYF--IEGESDMSQLLGTVVRFPVTAGE 102

Query: 107 PIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS-ERK 164
           P+    LV  G+ G L++ L  G RA T+ +S  + V G + P D VDVV+ +++S E +
Sbjct: 103 PVTQGSLVSPGDRGFLAAALGPGMRAVTVPVSAKTGVAGFVFPGDRVDVVLTQTVSGEGR 162

Query: 165 P--TVTVVLSNIRVIAIDH---NIDSDER---VLVGSTATLELTPMQAKALVAAQSVAKL 216
           P      VL N+RV+A D     + +DE    V    T TLE+TP  A+ +  AQ++ +L
Sbjct: 163 PLNAAETVLRNLRVLATDQTTEQVTNDEGKTVVRAFRTVTLEVTPQIAEKVAVAQTIGQL 222

Query: 217 SLVLRSIAD 225
           +LVLRSIAD
Sbjct: 223 TLVLRSIAD 231


>gi|16127176|ref|NP_421740.1| pilus assembly protein CpaB [Caulobacter crescentus CB15]
 gi|221235977|ref|YP_002518414.1| pilus assembly protein CpaB [Caulobacter crescentus NA1000]
 gi|7208424|gb|AAF40191.1|AF229646_3 CpaB [Caulobacter crescentus CB15]
 gi|13424572|gb|AAK24908.1| pilus assembly protein CpaB [Caulobacter crescentus CB15]
 gi|220965150|gb|ACL96506.1| pilus assembly protein CpaB [Caulobacter crescentus NA1000]
          Length = 297

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 78/266 (29%), Positives = 133/266 (50%), Gaps = 39/266 (14%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVI-----TENPAK-FINVLISKGD 54
           M   RL+ ++++ V A+   ++  R +     +   ++        P K    VL++K D
Sbjct: 1   MSPVRLLIVLIAAVSAIGLAVVLQRALGGAPAKPTGLVEAPGGPAAPGKPMTQVLVAKRD 60

Query: 55  LAVGMVVTPNILEWVAFPEENVFDGFIDDVHQP------------------------NAM 90
           L VG  +    + W A+P +++   FI +   P                        +  
Sbjct: 61  LPVGTRLVATDVGWQAWPSDSINAAFITNGSAPVTPDGKVEAAKAVVAATADQMIGGDPA 120

Query: 91  QELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPN 149
           + ++G +VR PIL G+PI   K+V  G GG LS +L  GKRA ++ ++  +AVGG I P 
Sbjct: 121 KIVEGAIVRDPILIGEPITPRKIVRGGEGGYLSVVLTPGKRAMSVPVTSDTAVGGFILPG 180

Query: 150 DHVDVVMVR---SLSERKPTVTV---VLSNIRVIAIDHNI--DSDERVLVGSTATLELTP 201
           D VDV+  R   +  ++   V +   VL NIRV+A+D     + D + +V +TATLE+ P
Sbjct: 181 DRVDVLSTRDAPAAGDQGGKVMIAETVLQNIRVLALDQATAAEKDAKSIVAATATLEVGP 240

Query: 202 MQAKALVAAQSVAKLSLVLRSIADLN 227
           ++A+AL  A++   ++L LR+  D+ 
Sbjct: 241 VEAEALARAKAGGPITLALRAYTDMG 266


>gi|220923695|ref|YP_002498997.1| Flp pilus assembly protein CpaB [Methylobacterium nodulans ORS
           2060]
 gi|219948302|gb|ACL58694.1| Flp pilus assembly protein CpaB [Methylobacterium nodulans ORS
           2060]
          Length = 264

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 70/221 (31%), Positives = 115/221 (52%), Gaps = 22/221 (9%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
           +VL+   +LA G  +T   + W  +PE  +   ++    +P A+ E  G  +R  +  G+
Sbjct: 43  DVLVVSTELAQGERLTKENMRWQPWPESALNSAYVTRSARPAALDEFAGSTLRSRMAPGE 102

Query: 107 PIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVV-----MVRSLS 161
           P++  KL     G L+++LP GKRA  + IS  +  GG I P+D VDV+       +   
Sbjct: 103 PVQDGKLAGLNAGFLATVLPSGKRAVAVRISAENTAGGFILPSDRVDVIHTFAPQAQGEG 162

Query: 162 ERKPTVTVVLSNIRVIAIDHNIDSDER--------VLVGSTATLELTPMQAKALVAAQSV 213
            R+     +L N+ V+AID  +D  ++        V++G TATLEL   QA+ L AA++ 
Sbjct: 163 AREHRSRTILKNVPVLAIDQTVDEAQKADKGKGKSVVIGKTATLELDSRQAEILAAAEAA 222

Query: 214 AKLSLVLRSIADLN--PSSSEDSDVWDVQEEGKEIQIIKAG 252
             LSL LRS AD N  P+++        +E  + +++I+ G
Sbjct: 223 GTLSLSLRSAADSNEVPTAA-------TEERIQTVRVIRGG 256


>gi|329890997|ref|ZP_08269340.1| flp pilus assembly protein CpaB [Brevundimonas diminuta ATCC 11568]
 gi|328846298|gb|EGF95862.1| flp pilus assembly protein CpaB [Brevundimonas diminuta ATCC 11568]
          Length = 310

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 93/154 (60%), Gaps = 9/154 (5%)

Query: 81  IDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISIS 139
           + +++ P A  +  G +VR PIL G+P+   K+V  G+ G +++ L  G RA  + +++ 
Sbjct: 119 VAELNTPGAKSDYIGAVVREPILAGEPLVARKIVRAGDSGYMAAYLEPGMRAMAIRVTVE 178

Query: 140 SAVGGMIKPNDHVDVVMVRSLSER------KPTVTVVLSNIRVIAIDHNIDS--DERVLV 191
           +A GG I P D VDV++ R +         K +   V+ N++V+AID +  +  DE+ +V
Sbjct: 179 TAAGGFILPGDRVDVLLTREVKGSGDDGGTKYSAATVMRNVKVLAIDQSTRAAEDEQAVV 238

Query: 192 GSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           G+TATLELT   A+ L  A+S  +LSLVLRS AD
Sbjct: 239 GATATLELTGRDAEVLALAKSEGELSLVLRSYAD 272


>gi|302381757|ref|YP_003817580.1| Flp pilus assembly protein CpaB [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192385|gb|ADK99956.1| Flp pilus assembly protein CpaB [Brevundimonas subvibrioides ATCC
           15264]
          Length = 310

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 84/302 (27%), Positives = 128/302 (42%), Gaps = 50/302 (16%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSP--HHVQTEEVITENPAKFINVLISKGDLAVG 58
           MK  R+  I ++ V A+    +   + SP                    VL++  DLA G
Sbjct: 1   MKPARIAVICIAAVSAIGLAFVVRAMGSPSGEPTAVATAAPAPTRPMAKVLVAARDLAPG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQP------------------------------- 87
             +    LEW  +P + V   FI D   P                               
Sbjct: 61  QRLVEADLEWKDWPVDEVNPAFITDGSVPVPAAAAPEGEAAPATTDTTAESAVARVTRAA 120

Query: 88  ------NAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISS 140
                  A  +  G +VR PIL G+PI   K+V  G+ G +++ L  G RA  + +S+ S
Sbjct: 121 NDLTTGGAKADYFGSVVREPILAGEPIVGRKIVRAGDSGYMAAYLEPGMRAMAIGVSVES 180

Query: 141 AVGGMIKPNDHVDVVMV--------RSLSERKPTVTVVLSNIRVIAIDHNIDS--DERVL 190
           A GG I P D VDV++               K    +V+ N++V+AID +  +  D++ +
Sbjct: 181 AAGGFILPGDRVDVIVTVEQQAGNDDDAGRAKFASRIVMQNVKVLAIDQSTRAGDDQQAV 240

Query: 191 VGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIK 250
           VG+TATLE+ P  A+ +  A++   LSLVLRS AD +  S   S      E    I++ +
Sbjct: 241 VGATATLEVAPQDAEVVALAKAAGTLSLVLRSYADTSGPSGRVSMPPRASERSTAIRVFR 300

Query: 251 AG 252
            G
Sbjct: 301 GG 302


>gi|197106458|ref|YP_002131835.1| pilus assembly protein CpaB [Phenylobacterium zucineum HLK1]
 gi|196479878|gb|ACG79406.1| pilus assembly protein CpaB [Phenylobacterium zucineum HLK1]
          Length = 287

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 59/180 (32%), Positives = 103/180 (57%), Gaps = 4/180 (2%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
            VL++   L  G ++ P+ + W A+P +    G++       A  ++ G +VR  +  G 
Sbjct: 51  QVLVAAQALPPGTILKPSHVRWQAWPADAPTAGYLTSAASGPA--QIAGAVVRGELQPGQ 108

Query: 107 PIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP 165
           P+    +V  G+   L+++L  G RA T+++S +S V G I P D VD+V+ R + + + 
Sbjct: 109 PLTTTGVVQPGDRSFLAAVLKPGHRAVTVNVSAASGVAGFIFPGDRVDLVLSRRIGDDRH 168

Query: 166 TVTVVLSNIRVIAIDHNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
               VL+++RV+ ID  + ++++ V+V  TATLE+TP QA+ +     + KLSL LRS+A
Sbjct: 169 VSETVLTDVRVVGIDQRVANEKQEVVVPQTATLEVTPKQAEIVALMPELGKLSLSLRSLA 228


>gi|304320646|ref|YP_003854289.1| CtpC protein [Parvularcula bermudensis HTCC2503]
 gi|303299548|gb|ADM09147.1| CtpC protein [Parvularcula bermudensis HTCC2503]
          Length = 253

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 98/186 (52%), Gaps = 4/186 (2%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V+ S  D+  G +++  +++WV +P  NV + FI    Q + +  L     R+ I    P
Sbjct: 49  VMFSAKDIPQGAILSEGMVKWVKWPSANVPEFFITKDDQ-DFIDNLGLRRARLRIDANQP 107

Query: 108 IRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT 166
           I     V  G+ G L+S+L  G RA T  + +    GG I P D VD+       + +  
Sbjct: 108 IYGVNTVAHGDRGMLASILTPGMRAVTARMGLEETSGGFILPGDRVDIFATGIGDDGQME 167

Query: 167 VTVVLSNIRVIAIDH--NIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
            + +L NIRV+AID   N+  ++  L GST T EL+P Q  + + A+   +L+LVLRS+ 
Sbjct: 168 TSAILRNIRVLAIDQVTNVTDEQTALNGSTVTFELSPAQVPSFIGARDNKQLTLVLRSVY 227

Query: 225 DLNPSS 230
           DL+P +
Sbjct: 228 DLSPET 233


>gi|296284551|ref|ZP_06862549.1| Flp pilus assembly protein CpaB [Citromicrobium bathyomarinum
           JL354]
          Length = 353

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 105/185 (56%), Gaps = 9/185 (4%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
            VL+++  L VG ++T + + + A+P+E V D +  D      + +L G +VR  I  G+
Sbjct: 48  RVLVAQRSLPVGTIITQDAISYQAWPQELVRDAYFIDGEA--DVSKLLGTVVRYQITAGE 105

Query: 107 PIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP 165
           P+    LV  G+ G L++ L  G RA T+ ++  ++V G + P D VD++M       K 
Sbjct: 106 PVTQGALVAPGDRGFLAAALGPGMRAITVPVNAQTSVAGFVFPGDRVDLMMTHETEGVKA 165

Query: 166 TVTVVLSNIRVIAIDHNIDSD----ERVLVG-STATLELTPMQAKALVAAQSVAKLSLVL 220
           T T+ L N+RV+A D +   +    + V+ G ST TLE+TP  A+ +  AQ+V  LSL L
Sbjct: 166 TETI-LRNLRVLATDQSTSQNTVDGQTVVNGFSTVTLEVTPKIAEKIAVAQTVGTLSLSL 224

Query: 221 RSIAD 225
           RSIAD
Sbjct: 225 RSIAD 229


>gi|85373132|ref|YP_457194.1| pilus assembly protein CpaB [Erythrobacter litoralis HTCC2594]
 gi|84786215|gb|ABC62397.1| pilus assembly protein CpaB [Erythrobacter litoralis HTCC2594]
          Length = 371

 Score = 93.2 bits (230), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 73/229 (31%), Positives = 121/229 (52%), Gaps = 19/229 (8%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
            VL+++  L VG ++T + L +  +PEE V D +   +   + + +L G +VR P+  G+
Sbjct: 46  KVLVAQRGLPVGTIITADALGFQMWPEELVQDAYF--IEGESDITQLLGTVVRHPVTAGE 103

Query: 107 PIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL----S 161
           P+    LV  G+ G L++ L  G RA T+ +S ++ V G + P D VD+++ +++    +
Sbjct: 104 PLTQGTLVSPGDRGFLAAALGPGMRAITVPVSANTGVAGFVFPGDRVDLMLTQAVKGEET 163

Query: 162 ERKPTVTVVLSNIRVIAIDHNIDSDER------VLVGSTATLELTPMQAKALVAAQSVAK 215
           + K T T+ L N+RV+A D   +          V    T TLE+TP  A+ +  AQ++  
Sbjct: 164 DLKATETI-LRNLRVLATDQTTEQTTNEAGKTVVRAFRTVTLEVTPKIAEKVAVAQTLGT 222

Query: 216 LSLVLRSIADLNPS-----SSEDSDVWDVQEEGKEIQIIKAGVIVNKDG 259
           LSL LRSIAD         +S D  + D     +E +II+A +    DG
Sbjct: 223 LSLALRSIADNQAELERAIASGDVKIPDGASPEEEERIIQAAMNRPNDG 271


>gi|149186254|ref|ZP_01864568.1| pilus assembly protein CpaB [Erythrobacter sp. SD-21]
 gi|148830285|gb|EDL48722.1| pilus assembly protein CpaB [Erythrobacter sp. SD-21]
          Length = 361

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 101/188 (53%), Gaps = 11/188 (5%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
            VL+++  L  G ++T + + +  +PEE V D +  D      + +L G +VR P+  G+
Sbjct: 47  KVLVAQRALPTGTIITADAIGYQLWPEELVQDAYFLDGE--ADVSKLIGTVVRHPVTAGE 104

Query: 107 PIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP 165
           P+    LV  G+ G L++ L  G RA T+ +   S V G + P D VD+V+ +++S    
Sbjct: 105 PVTQGSLVSPGDRGFLAAALTPGMRAITVPVDAKSGVAGFVFPGDRVDMVLTQAVSGEGQ 164

Query: 166 TVT---VVLSNIRVIAIDHN-----IDSDERVLVGSTATLELTPMQAKALVAAQSVAKLS 217
            +     +L N+RV+A D +     +D   +V    T TLE+TP  A+ +  AQ++  LS
Sbjct: 165 ALKASETILRNLRVLATDQSTTQTTVDGKTQVRAFRTVTLEVTPTIAEKVAVAQTLGTLS 224

Query: 218 LVLRSIAD 225
           L LR +AD
Sbjct: 225 LALRPLAD 232


>gi|254418623|ref|ZP_05032347.1| Flp pilus assembly protein CpaB [Brevundimonas sp. BAL3]
 gi|196184800|gb|EDX79776.1| Flp pilus assembly protein CpaB [Brevundimonas sp. BAL3]
          Length = 305

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 93/180 (51%), Gaps = 14/180 (7%)

Query: 87  PNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGM 145
           P A  +  G +VR PIL G+PI   K+V  G+ G L++ L  G RA  + +++ SA GG 
Sbjct: 118 PGAKSDYIGSVVREPILAGEPIVGRKIVRAGDSGYLAAYLEPGMRAMAIAVTVESAAGGF 177

Query: 146 IKPNDHVDVVMV-----------RSLSERKPTVTVVLSNIRVIAIDHNIDS--DERVLVG 192
           I P D VDVV+               +  K +   V+ N++V+AID +  +  D + +VG
Sbjct: 178 ILPGDRVDVVLTVQNEGGGSAVEGGGATAKYSSATVMQNVKVLAIDQSTRAGDDAQAVVG 237

Query: 193 STATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAG 252
           +TATLE+ P  A  L  A+S  +LSL LRS AD    S        V    + +++ + G
Sbjct: 238 ATATLEVRPQDAVLLAQAKSEGELSLSLRSYADTAGPSGATRAPRAVASASRSVRVYRGG 297


>gi|83749639|ref|ZP_00946622.1| TRANSMEMBRANE PILUS ASSEMBLY PROTEIN; cpaB1 [Ralstonia solanacearum
           UW551]
 gi|207728107|ref|YP_002256501.1| pilus assembly protein cpab [Ralstonia solanacearum MolK2]
 gi|207744157|ref|YP_002260549.1| pilus assembly protein cpab [Ralstonia solanacearum IPO1609]
 gi|83723700|gb|EAP70895.1| TRANSMEMBRANE PILUS ASSEMBLY PROTEIN; cpaB1 [Ralstonia solanacearum
           UW551]
 gi|206591352|emb|CAQ56964.1| pilus assembly protein cpab [Ralstonia solanacearum MolK2]
 gi|206595561|emb|CAQ62488.1| pilus assembly protein cpab [Ralstonia solanacearum IPO1609]
          Length = 284

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 130/244 (53%), Gaps = 28/244 (11%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  R++ +++    A +AG+ A+   S    Q      ++ +    V+++  D+ +G  
Sbjct: 1   MKNLRILSMLL---IATIAGLAAVVFASRWLSQ------QSSSGITKVVVAAADIDLGQR 51

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           ++P+ ++ V +P  ++  G I D H       LDG +VR  +++G+P+   KL  +G  G
Sbjct: 52  LSPDFIKTVDWPSASLPPGAISDTH------ALDGRVVRTSLIRGEPVLESKLTPQGTAG 105

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM--VRSLSERKPT---------VT 168
           GLS+++  GKRA T+ ++    V G   P  +VD+++  ++   + K T           
Sbjct: 106 GLSAVIADGKRAITVRVNDVVGVAGFALPGSYVDIIVNTIQDSKDAKATGGDRADQSISK 165

Query: 169 VVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLN 227
           +VL  I V+A+   ++ D+ +  V +  TLE+TP QA+ L  A+SV  LSLVLR+  D +
Sbjct: 166 IVLEKILVLAVAQEVNRDDTKPKVVNAVTLEVTPDQAEKLDLARSVGTLSLVLRNQVDPH 225

Query: 228 PSSS 231
           P+ +
Sbjct: 226 PADT 229


>gi|300704929|ref|YP_003746532.1| pilus assembly (cpab), transmembrane protein [Ralstonia
           solanacearum CFBP2957]
 gi|299072593|emb|CBJ43943.1| Putative pilus assembly (cpaB), transmembrane protein [Ralstonia
           solanacearum CFBP2957]
          Length = 284

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/245 (29%), Positives = 132/245 (53%), Gaps = 30/245 (12%)

Query: 1   MKLTRLMG-IVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK  R++  ++++ +  L A + A R +S    Q+   IT+       V+++  D+ +G 
Sbjct: 1   MKNLRILSMLLIATIAGLAAVVFASRWLSQ---QSNSGITK-------VVVAAADIDLGQ 50

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
            ++P+ ++ V +P  ++  G I D H       LDG +VR  +++G+P+   KL  +G  
Sbjct: 51  RLSPDFIKTVDWPSASLPPGAISDTH------ALDGRVVRTSLIRGEPVLESKLTPQGTA 104

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM--VRSLSERKPT---------V 167
           GGLS+++  GKRA T+ ++    V G   P  +VD+++  ++   + K T          
Sbjct: 105 GGLSAVIADGKRAITVRVNDVVGVAGFALPGSYVDIIVNTIQDSKDAKATGGDRADQSIS 164

Query: 168 TVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADL 226
            +VL  I V+A+   ++ D+ +  V +  TLE+TP QA+ L  A+SV  LSLVLR+  D 
Sbjct: 165 KIVLEKILVLAVAQEVNRDDTKPKVVNAVTLEVTPDQAEKLDLARSVGTLSLVLRNQVDP 224

Query: 227 NPSSS 231
           +P+ +
Sbjct: 225 HPADT 229


>gi|221067359|ref|ZP_03543464.1| Flp pilus assembly protein CpaB [Comamonas testosteroni KF-1]
 gi|220712382|gb|EED67750.1| Flp pilus assembly protein CpaB [Comamonas testosteroni KF-1]
          Length = 281

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 65/192 (33%), Positives = 106/192 (55%), Gaps = 14/192 (7%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V+++  D+ +G  + PN+L  V +P  ++ DG   D      MQ+L   +V+V +L+G+ 
Sbjct: 39  VVVAATDIPLGGKILPNMLNTVDWPRGSIPDGAFHD------MQQLQDRVVKVGVLRGEA 92

Query: 108 IRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM------VRSL 160
           +   KL   G  GGL++++  GKRA T+ ++    V G   P ++VDVV+         +
Sbjct: 93  VLEGKLAPVGTKGGLAAVIAPGKRAMTVRVNDVVGVAGFALPGNYVDVVVNAQQEQAGKM 152

Query: 161 SERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLV 219
            + +     VL N+ V+A+    D DE +  V S  TLEL+P  A+ L  A+SV  LSLV
Sbjct: 153 EDSRQISKTVLENVLVLAVAQEADRDETKPKVVSAVTLELSPGDAEKLDLARSVGNLSLV 212

Query: 220 LRSIADLNPSSS 231
           LR+  D +P+S+
Sbjct: 213 LRNQIDKDPTST 224


>gi|299532591|ref|ZP_07045980.1| pilus assembly transmembrane protein [Comamonas testosteroni S44]
 gi|298719394|gb|EFI60362.1| pilus assembly transmembrane protein [Comamonas testosteroni S44]
          Length = 281

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 105/192 (54%), Gaps = 14/192 (7%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V+++  D+ +G  + PN+L  V +P  ++ DG   D      MQ+L   +V+V +L+G+ 
Sbjct: 39  VVVAATDIPLGGKILPNMLNTVDWPRGSIPDGAFHD------MQQLQDRVVKVGVLRGEA 92

Query: 108 IRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS------L 160
           +   KL   G  GGL++++  GKRA T+ ++    V G   P ++VDVV+          
Sbjct: 93  VLEGKLAPVGTKGGLAAVIAPGKRAMTVRVNDVVGVAGFALPGNYVDVVVNAQQEQNGKT 152

Query: 161 SERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLV 219
            E +     VL N+ V+A+    D DE +  V S  TLEL+P  A+ L  A+SV  LSLV
Sbjct: 153 EESRQISKTVLENVLVLAVAQEADRDETKPKVVSAVTLELSPEDAEKLDLARSVGNLSLV 212

Query: 220 LRSIADLNPSSS 231
           LR+  D +P+S+
Sbjct: 213 LRNQIDKDPTST 224


>gi|264678239|ref|YP_003278146.1| pilus assembly transmembrane protein [Comamonas testosteroni CNB-2]
 gi|262208752|gb|ACY32850.1| pilus assembly transmembrane protein [Comamonas testosteroni CNB-2]
          Length = 281

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 105/192 (54%), Gaps = 14/192 (7%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V+++  D+ +G  + PN+L  V +P  ++ DG   D      MQ+L   +V+V +L+G+ 
Sbjct: 39  VVVAATDIPLGGKILPNMLNTVDWPRGSIPDGAFHD------MQQLQDRVVKVGVLRGEA 92

Query: 108 IRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS------L 160
           +   KL   G  GGL++++  GKRA T+ ++    V G   P ++VDVV+          
Sbjct: 93  VLEGKLAPVGTKGGLAAVIAPGKRAMTVRVNDVVGVAGFALPGNYVDVVVNAQQEQNGKT 152

Query: 161 SERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLV 219
            E +     VL N+ V+A+    D DE +  V S  TLEL+P  A+ L  A+SV  LSLV
Sbjct: 153 EESRQISKTVLENVLVLAVAQEADRDETKPKVVSAVTLELSPEDAEKLDLARSVGNLSLV 212

Query: 220 LRSIADLNPSSS 231
           LR+  D +P+S+
Sbjct: 213 LRNQIDKDPTST 224


>gi|315497466|ref|YP_004086270.1| flp pilus assembly protein cpab [Asticcacaulis excentricus CB 48]
 gi|315415478|gb|ADU12119.1| Flp pilus assembly protein CpaB [Asticcacaulis excentricus CB 48]
          Length = 304

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 71/240 (29%), Positives = 116/240 (48%), Gaps = 45/240 (18%)

Query: 34  TEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDD---------- 83
           +++V  E P   + VL++   L VG  +    L W A+PE+ + + +  D          
Sbjct: 38  SQKVAVEAPT--VKVLVAARHLKVGERIAEADLAWKAWPEDGITESYFTDKPVTPVAPAE 95

Query: 84  --VHQPNAMQE----------------------LDGVL---VRVPILKGDPIRLEKLVDR 116
               +  A++E                      +D VL   VR  +L  +PI   K+V  
Sbjct: 96  AKSAEDKALEEKVKNGAAQVADVADKTLNPTRGMDAVLGGVVREEMLANEPIVARKVVRA 155

Query: 117 GNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTV---VLS 172
             GG ++ +L  G RA  + +++ S  GG I P D VD+V+   L     T  V   VL 
Sbjct: 156 DAGGFMAVMLAPGMRAMAVPVTVESTAGGFILPGDRVDIVVSTELQSNGQTTHVAKPVLR 215

Query: 173 NIRVIAIDHNID--SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           N++V+A+D  ++  SD+  ++G+TATLE+ P + +AL  A++   LSL+LRS AD+   S
Sbjct: 216 NVKVLAVDQTVEAKSDQPSVIGATATLEVRPEEGEALAQAKAQGPLSLMLRSYADVGGPS 275


>gi|82703478|ref|YP_413044.1| Flp pilus assembly CpaB [Nitrosospira multiformis ATCC 25196]
 gi|82411543|gb|ABB75652.1| Flp pilus assembly CpaB [Nitrosospira multiformis ATCC 25196]
          Length = 261

 Score = 89.0 bits (219), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 69/225 (30%), Positives = 118/225 (52%), Gaps = 18/225 (8%)

Query: 9   IVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEW 68
           IV+S +  L A ++A R +          I         V+++  D+ VG  +TP++L+ 
Sbjct: 2   IVISLLLGLAAVVVAGRWI----------IDRASVDAATVIVASRDIDVGTRLTPDMLQP 51

Query: 69  VAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPK 127
             +P   V +G   D         LD  +V+V +++G+P+   KL  +G  GGLS ++ +
Sbjct: 52  SDWPRATVPEGSFQDAKL------LDTRVVKVNLVRGEPLLEAKLAPQGAAGGLSGVIAE 105

Query: 128 GKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE 187
           GKRA T+ ++    + G   P ++VD+++       KP   +VL  I V+A+  ++  DE
Sbjct: 106 GKRAITVKVNEIVGLAGFALPGNNVDILVNAKDENDKPISKIVLERILVLAVGQDLGRDE 165

Query: 188 RVLVGSTA-TLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSS 231
                 TA TLE+TP +A+ L  A+S+  LSLVLR+  D +P ++
Sbjct: 166 TKPKAVTAVTLEVTPQEAEKLDLARSIGTLSLVLRNQIDKSPGTT 210


>gi|295690799|ref|YP_003594492.1| Flp pilus assembly protein Cpab [Caulobacter segnis ATCC 21756]
 gi|295432702|gb|ADG11874.1| Flp pilus assembly protein CpaB [Caulobacter segnis ATCC 21756]
          Length = 293

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/219 (32%), Positives = 108/219 (49%), Gaps = 33/219 (15%)

Query: 45  FINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQP----------------- 87
              VL++K DLA+G  +T   ++W A+P ++V   FI +   P                 
Sbjct: 48  MTQVLVAKRDLAIGARLTQADIDWQAWPSDSVNAAFITNGAAPAEGETTSGAVALAKAAV 107

Query: 88  -------NAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISIS 139
                  +  + LDG +VR PIL G+PI   K+V  G GG LS +L  GKRA  + +S  
Sbjct: 108 TGQMIGGDPAKALDGAIVRDPILAGEPITARKIVRGGEGGYLSVVLTPGKRAVAVPVSAD 167

Query: 140 SAVGGMIKPNDHVDVVMVR------SLSERKPTVTVVLSNIRVIAIDHNI--DSDERVLV 191
           +  GG I P D VDV+  R       +  R      VL N+RV+A+D     D D +  +
Sbjct: 168 TTAGGFILPGDRVDVLSTRDAPLPGGVGGRVIIGETVLRNVRVLALDQKTVADKDAKSQI 227

Query: 192 GSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
            ++ATLE+   +A+AL AA++   ++L LR+  D    S
Sbjct: 228 ATSATLEVGAAEAEALAAAKAGGPVTLALRAYTDAGAPS 266


>gi|116626780|ref|YP_828936.1| SAF domain-containing protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116229942|gb|ABJ88651.1| SAF domain [Candidatus Solibacter usitatus Ellin6076]
          Length = 309

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 107/195 (54%), Gaps = 11/195 (5%)

Query: 44  KFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPIL 103
           K + V+++  D+A+G ++  + L+ V +PE+++  G +        +Q  +  +V VP+ 
Sbjct: 35  KTLRVVVASRDMAIGTLLKKSDLKVVNYPEKDIPKGAV------FTLQGAENRVVMVPMN 88

Query: 104 KGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE 162
             +P+   KL D     G++S + KG RA ++ ++  + V G+I+P  HVDV+  R  S 
Sbjct: 89  TNEPVLQGKLSDTTTVEGVASTIEKGYRAVSVQVTDVTGVAGLIQPGSHVDVLFTRPGSM 148

Query: 163 RKPTVTVVLSNIRVIAIDHNIDS----DERVLVGSTATLELTPMQAKALVAAQSVAKLSL 218
            + T + +L N+RVI+   +I +    D R     T TL LTP +A+ L  A++  ++ L
Sbjct: 149 AEATTSTILQNVRVISTGRSITAGQVVDPRAPKSPTVTLVLTPDEAQKLELAKNQGRIGL 208

Query: 219 VLRSIADLNPSSSED 233
            LR+  DLN  +S +
Sbjct: 209 SLRNPLDLNRDASTE 223


>gi|78186672|ref|YP_374715.1| pilus assembly protein CpaB [Chlorobium luteolum DSM 273]
 gi|78166574|gb|ABB23672.1| pilus assembly protein CpaB [Chlorobium luteolum DSM 273]
          Length = 266

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 65/206 (31%), Positives = 109/206 (52%), Gaps = 17/206 (8%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGF---IDDVHQPNAMQELDGVLVRVPIL 103
            V+I+   +  G  +  N L+ V +P   V +G     DDV          G + RV ++
Sbjct: 38  TVVIAARAIDAGTAIAENQLKAVQWPRSTVPEGASARTDDVA---------GRIARVSMI 88

Query: 104 KGDPIRLEKLV-DRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE 162
            G+P+   KL     +GGLSS++P GKRA T+ ++   AV G   P  +VD+++    +E
Sbjct: 89  AGEPVLPGKLAPTNASGGLSSIIPDGKRAITVKVNEVIAVAGFALPGSYVDILVSGRDAE 148

Query: 163 RKPTVTVVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
           R+P    VLS I+V+A+     ++ ++  V +  TLELTP +++ L  A+S+  LSLVLR
Sbjct: 149 RQPFSRTVLSRIKVLAVAQETTAEPDKPKVVNAVTLELTPHESETLDLARSIGVLSLVLR 208

Query: 222 S---IADLNPSSSEDSDVWDVQEEGK 244
           +     ++N +    +D+   Q  G+
Sbjct: 209 NELDTGEINSAGVRLADIIQAQSAGR 234


>gi|325525577|gb|EGD03367.1| Flp pilus assembly protein CpaB [Burkholderia sp. TJI49]
          Length = 277

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 73/231 (31%), Positives = 122/231 (52%), Gaps = 21/231 (9%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK++R + ++V    A++AG  A+   S   VQT        +    + ++  DL +G  
Sbjct: 1   MKISRAVMMLV---IAMIAGFAAVVFASRWLVQTST------SSVTPIAVAATDLNLGEP 51

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           + PN +  V++P  +V  G   D       +ELDG +VR  + +G+P+   KL   G  G
Sbjct: 52  LGPNQVHTVSWPTGSVPPGAFTD------PKELDGRVVRTSLARGEPVIESKLAPVGTKG 105

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM----VRSLSERKPTVTVVLSNIR 175
           GLS+++ +G RA T+ ++    V G   P ++VDV++     +  S+ +    +VL +I 
Sbjct: 106 GLSAVIAEGSRAITVRVNDVVGVAGFALPGNYVDVIVNTQAQQGKSDGQSISKIVLEHIL 165

Query: 176 VIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           V+A+   +  D+    V +  TLE+TP QA+ L  A+SV  LSLVLR+  D
Sbjct: 166 VLAVAQQVSRDDTAPKVVNAVTLEVTPDQAERLDLARSVGTLSLVLRNQID 216


>gi|253996770|ref|YP_003048834.1| Flp pilus assembly protein CpaB [Methylotenera mobilis JLW8]
 gi|253983449|gb|ACT48307.1| Flp pilus assembly protein CpaB [Methylotenera mobilis JLW8]
          Length = 298

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/237 (31%), Positives = 128/237 (54%), Gaps = 23/237 (9%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNI 65
            + IVVS    L A ++A R +S      ++  T   +K   V+++  ++ +G  +TP +
Sbjct: 7   FLMIVVSVGIGLGAVVLASRWIS------QQAATVASSK---VVVAAINIDLGTPLTPQM 57

Query: 66  LEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSL 124
           L+   +P  +V  G  DD+      + LD  +V+  +L+G+P+   KL   G  GGLS++
Sbjct: 58  LKVADWPRGSVPVGATDDI------KTLDARVVKTSLLQGEPVLESKLAPLGATGGLSAV 111

Query: 125 LPKGKRAATMDISISSAVGGMIKPNDHVDVVM------VRSLSERKPTVTVVLSNIRVIA 178
           + +G RA T+ ++    V G   P ++VD+V+      V++ +  K    +VL +I V+A
Sbjct: 112 IAEGNRAMTVRVNDVVGVAGFALPGNYVDIVVNTEDESVKAENVNKSISKIVLEHIMVLA 171

Query: 179 IDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           +    + DE +  V +  TLE+TP QA+ L  A+SV  LSLVLR+  D N  ++E S
Sbjct: 172 VAQEQNRDETKPKVVNAVTLEVTPAQAEKLDLARSVGTLSLVLRNQIDKNVVTTEGS 228


>gi|148557762|ref|YP_001265344.1| SAF domain-containing protein [Sphingomonas wittichii RW1]
 gi|148502952|gb|ABQ71206.1| SAF domain [Sphingomonas wittichii RW1]
          Length = 332

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 96/183 (52%), Gaps = 14/183 (7%)

Query: 55  LAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV 114
           L VG ++ P    +  +P E V   +   +   + +  L+G +VR  I  G P+    LV
Sbjct: 55  LPVGTIIGPESFRYQRWPAELVSKTYF--IKGESDLAALNGSVVRYAITAGAPVTQGALV 112

Query: 115 DRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL---SERKP--TVT 168
             G+ G L++ L  G RA T+ +S  S V G + P D VD+++ + +    +  P     
Sbjct: 113 KPGDRGFLAAALGPGMRAVTISVSAQSGVAGFVFPGDRVDLMLTQEVPGGGDGPPLKAAE 172

Query: 169 VVLSNIRVIAIDH----NIDSDERVLVGSTA--TLELTPMQAKALVAAQSVAKLSLVLRS 222
            ++ NIRV+A D      +D + + +V +T+  TLE TP  A+ +  AQ++ +LSL LRS
Sbjct: 173 TIIRNIRVLAADQRTDKTVDEEGKTVVANTSNVTLEATPKIAEKIAVAQTIGQLSLALRS 232

Query: 223 IAD 225
           IAD
Sbjct: 233 IAD 235


>gi|107028249|ref|YP_625344.1| Flp pilus assembly CpaB [Burkholderia cenocepacia AU 1054]
 gi|116687160|ref|YP_840407.1| Flp pilus assembly CpaB [Burkholderia cenocepacia HI2424]
 gi|105897413|gb|ABF80371.1| Flp pilus assembly CpaB [Burkholderia cenocepacia AU 1054]
 gi|116652875|gb|ABK13514.1| Flp pilus assembly CpaB [Burkholderia cenocepacia HI2424]
          Length = 279

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 115/218 (52%), Gaps = 18/218 (8%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPE 73
           V A+VAG+ A+   S   VQT      + +   +V ++  DL +G  + PN +  V++P 
Sbjct: 11  VVAMVAGLAAVVFASRWLVQT------STSSVTSVAVATTDLNLGEPLGPNQIHMVSWPA 64

Query: 74  ENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAA 132
            +V  G   D       + L+G +VR  + +G+P+   KL   G  GGLS+++  G RA 
Sbjct: 65  GSVPTGAFTDT------KTLEGRVVRTSLARGEPVIESKLAPVGTKGGLSAVIADGSRAI 118

Query: 133 TMDISISSAVGGMIKPNDHVDVVM----VRSLSERKPTVTVVLSNIRVIAIDHNIDSDER 188
           T+ ++    V G   P ++VDV++     +  ++ +    +VL +I V+A+   +  D+ 
Sbjct: 119 TVRVNDVVGVAGFALPGNYVDVIVNTQEQQGKTDGQSISKIVLEHILVLAVAQQVSRDDT 178

Query: 189 V-LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
              V +  TLE+TP QA+ L  A+SV  LSLVLR+  D
Sbjct: 179 APKVVNAVTLEVTPDQAERLDLARSVGTLSLVLRNQVD 216


>gi|170734869|ref|YP_001773983.1| Flp pilus assembly protein CpaB [Burkholderia cenocepacia MC0-3]
 gi|169820907|gb|ACA95488.1| Flp pilus assembly protein CpaB [Burkholderia cenocepacia MC0-3]
          Length = 279

 Score = 83.2 bits (204), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 114/218 (52%), Gaps = 18/218 (8%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPE 73
           V A+VAG+ A+   S   VQT        +   +V ++  DL +G  + PN +  V++P 
Sbjct: 11  VVAMVAGLAAVVFASRWLVQTST------SSVTSVAVASTDLNLGEPLGPNQIHMVSWPA 64

Query: 74  ENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAA 132
            +V  G   D       + L+G +VR  + +G+P+   KL   G  GGLS+++  G RA 
Sbjct: 65  GSVPTGAFTDT------KALEGRVVRTSLARGEPVIESKLAPVGTKGGLSAVIADGSRAI 118

Query: 133 TMDISISSAVGGMIKPNDHVDVVM----VRSLSERKPTVTVVLSNIRVIAIDHNIDSDER 188
           T+ ++    V G   P ++VDV++     +  ++ +    +VL +I V+A+   +  D+ 
Sbjct: 119 TVRVNDVVGVAGFALPGNYVDVIVNTQEQQGKTDGQSISKIVLEHILVLAVAQQVSRDDT 178

Query: 189 V-LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
              V +  TLE+TP QA+ L  A+SV  LSLVLR+  D
Sbjct: 179 APKVVNAVTLEVTPDQAERLDLARSVGTLSLVLRNQVD 216


>gi|332188388|ref|ZP_08390113.1| flp pilus assembly protein CpaB [Sphingomonas sp. S17]
 gi|332011617|gb|EGI53697.1| flp pilus assembly protein CpaB [Sphingomonas sp. S17]
          Length = 329

 Score = 83.2 bits (204), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 107/219 (48%), Gaps = 19/219 (8%)

Query: 37  VITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGV 96
           ++   P     VL++   L VG ++    L++  +P+E V   +   +     + +L G 
Sbjct: 40  IVAPPPETGPEVLVATRALPVGTIIDATALKFQPWPKEMVGGAYY--LKGQADLAKLQGT 97

Query: 97  LVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVV 155
           +VR  I  G P+    +V  G+ G L++ L  G RA T+ +S  + V G + P D +D+V
Sbjct: 98  VVRYAITAGQPLTQGAVVQPGDRGFLAAALTPGMRAVTVPVSAQTGVAGFVFPGDRIDMV 157

Query: 156 MVRSLSERK--PTVTV---VLSNIRVIAIDHNIDSDE------RVLVGSTATLELTPMQA 204
           + + ++     P + V   +L N+RV+A D   DS         +   +T T+E TP  A
Sbjct: 158 LTQDVAGGGDGPPLKVSETILRNVRVLATDQRTDSQSGEDGKTPIQTFTTVTVEATPKMA 217

Query: 205 KALVAAQSVAKLSLVLRSIADL-----NPSSSEDSDVWD 238
           + L  AQ+V  LSL LR++AD      NP++     V D
Sbjct: 218 EQLAVAQTVGTLSLSLRALADRPDDLQNPAAVNAGPVAD 256


>gi|322419945|ref|YP_004199168.1| Flp pilus assembly protein CpaB [Geobacter sp. M18]
 gi|320126332|gb|ADW13892.1| Flp pilus assembly protein CpaB [Geobacter sp. M18]
          Length = 308

 Score = 83.2 bits (204), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 117/217 (53%), Gaps = 14/217 (6%)

Query: 30  HHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNA 89
           H +Q E  +T+   +   ++++  D+ +G  ++   L+  ++P++++  G   DV     
Sbjct: 27  HFLQKEMDMTKA-VQPQTLVVAAADIPIGGTISEPQLKTTSWPKDSIPPGSAADV----- 80

Query: 90  MQELDGVLVRVPILKGDPIRLEKLVDR----GNGGLSSLLPKGKRAATMDISISSAVGGM 145
            + L G +   PI  GD +  +KL  +    G+G ++ ++P G RA T+ ++  + V G 
Sbjct: 81  -KSLVGRVAIRPISNGDAVTEQKLKPKAGAAGSGFMTYIVPLGHRATTVAVNEVAGVAGF 139

Query: 146 IKPNDHVDVVMVRSL--SERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPM 202
           I PND +DVV+   L  S+++    ++L N+ V+A     +  E + +V  T TL+LTP 
Sbjct: 140 ITPNDRIDVVLTTQLPGSQKENISKIILQNVPVLATGQITEQKEGKPVVVPTVTLDLTPE 199

Query: 203 QAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDV 239
            A+ LV A S   L L+LR+IAD  P +++ + +  V
Sbjct: 200 DAEKLVLAGSKGSLQLLLRNIADSAPLNAKGATIAKV 236


>gi|187919323|ref|YP_001888354.1| Flp pilus assembly protein CpaB [Burkholderia phytofirmans PsJN]
 gi|187717761|gb|ACD18984.1| Flp pilus assembly protein CpaB [Burkholderia phytofirmans PsJN]
          Length = 269

 Score = 83.2 bits (204), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 115/221 (52%), Gaps = 21/221 (9%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPE 73
           + A +AG+ A+   S        +++++      V+++  D+ +G  + P+ L+   +P 
Sbjct: 3   LIATLAGLTAVVFAS------RWMVSQSSNATTRVVVAAADINLGQRIGPDYLKLTDWPS 56

Query: 74  ENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAA 132
            +V  G   D+      Q+LDG +++  +L+G+PI   KL   G  GGLS+++ +GKRA 
Sbjct: 57  NSVPPGSYSDI------QKLDGRVLKESLLRGEPILDAKLTPVGTLGGLSAVIGEGKRAI 110

Query: 133 TMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT-------VVLSNIRVIAIDHNIDS 185
           T+ ++    V G   P ++VD+++      R P  T       +VL  I V+A+   +  
Sbjct: 111 TVRVNDVIGVAGFALPGNYVDIIVNTQKDGRDPGATRDQNISKIVLEKILVLAVAQEVGR 170

Query: 186 DE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           DE +  V    TLE+ P QA+ +  A+S+  LSLVLR+  D
Sbjct: 171 DETKPKVVDAVTLEVLPEQAEKIDLARSIGTLSLVLRNQID 211


>gi|103486618|ref|YP_616179.1| Flp pilus assembly CpaB [Sphingopyxis alaskensis RB2256]
 gi|98976695|gb|ABF52846.1| Flp pilus assembly CpaB [Sphingopyxis alaskensis RB2256]
          Length = 345

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 98/195 (50%), Gaps = 21/195 (10%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           +L++   L VG +V P+   +  +P++ V + +   V +   +  L G +VR PI  G P
Sbjct: 48  ILVATRQLPVGTIVGPDSFRFQPWPKDLVENAYF--VKEKTDVNTLVGTVVRHPITAGQP 105

Query: 108 IRLEKLV---DRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL---- 160
           +    LV   DRG   L++ L  G RA T+ +S    V G + P D VDVV+ +++    
Sbjct: 106 LTQGALVHPNDRGF--LAAALGPGMRAITVKVSQEQGVAGFVFPGDRVDVVLTQTIEVEE 163

Query: 161 SERKP-----TVTVVLSNIRVIAIDHNIDSDER-----VLVGSTATLELTPMQAKALVAA 210
               P     T   ++ NIRV+A D   D+++      V    + TLE TP  A+ +  A
Sbjct: 164 GSTYPDDQIFTAETIVRNIRVLATDQRYDAEDETGKTPVRTFGSVTLEATPEIAEKIAVA 223

Query: 211 QSVAKLSLVLRSIAD 225
           Q + +LSL LR +A+
Sbjct: 224 QGMGRLSLALRPLAE 238


>gi|91788410|ref|YP_549362.1| Flp pilus assembly CpaB [Polaromonas sp. JS666]
 gi|91697635|gb|ABE44464.1| Flp pilus assembly CpaB [Polaromonas sp. JS666]
          Length = 284

 Score = 82.0 bits (201), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 79/243 (32%), Positives = 125/243 (51%), Gaps = 28/243 (11%)

Query: 1   MKLTR-LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           M+ TR L+ I V+ V A  A I+A R +S           +  A    V ++  D+++G 
Sbjct: 1   MRNTRALVMIAVAVVLAFGAVIVAARWIS----------AQASADTSKVAVAAVDISLGA 50

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-N 118
            ++P ++  V +P   +  G I D  Q      L+  + R  I +G+P+   KL   G  
Sbjct: 51  RLSPEMVRMVDWPASAMPPGAITDAKQ------LETRVTRTSIQRGEPVMEGKLAPPGTQ 104

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE-------RKPTVT-VV 170
           GGLS+++ +GKRA T+ ++    V G   P + VD+ +V +  E       +  T++ +V
Sbjct: 105 GGLSAVVAEGKRAMTVRVNDVVGVAGFALPGNFVDI-LVNTQDEPGKGGAGKDQTISKIV 163

Query: 171 LSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
           L  I V+AI      DE +  V +  TLELTP QA+ L  A+SV  LSLVLR+  D NP 
Sbjct: 164 LERILVLAIAQESSRDETKPKVVNAVTLELTPDQAEKLDLARSVGTLSLVLRNQVDPNPV 223

Query: 230 SSE 232
           +++
Sbjct: 224 NTK 226


>gi|288956968|ref|YP_003447309.1| pilus assembly protein [Azospirillum sp. B510]
 gi|288909276|dbj|BAI70765.1| pilus assembly protein [Azospirillum sp. B510]
          Length = 288

 Score = 82.0 bits (201), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 99/189 (52%), Gaps = 13/189 (6%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
            + ++  DL  G  + P  + W AFPE  +    +  V   + +  L G +VR  +  G+
Sbjct: 42  RIAVAAADLPAGSFLQPMSVRWEAFPENALRPETL--VEGKDNIDSLVGAVVRDAVKAGE 99

Query: 107 PIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE--- 162
            I  ++L+  R  G L+++L  G RAA++ ++  S   G+I P DHVD+++ +  ++   
Sbjct: 100 IISRDRLLSPRERGFLAAVLAPGMRAASVAVNEVSGTAGLIFPGDHVDLLLTQEANDEGA 159

Query: 163 -RKPTVTVVLSNIRVIAIDHNID------SDERVLVGSTATLELTPMQAKALVAAQSVAK 215
            R+     +L N+RV+A+D   D        +   V  T TLE+T  QA+ +  A ++ K
Sbjct: 160 ARRLATETILDNLRVLAVDQRTDFPKGEEPGQTARVARTVTLEVTAKQAQVISVAANLGK 219

Query: 216 LSLVLRSIA 224
           L+L LRS+A
Sbjct: 220 LTLSLRSLA 228


>gi|307294423|ref|ZP_07574267.1| Flp pilus assembly protein CpaB [Sphingobium chlorophenolicum L-1]
 gi|306880574|gb|EFN11791.1| Flp pilus assembly protein CpaB [Sphingobium chlorophenolicum L-1]
          Length = 307

 Score = 82.0 bits (201), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 109/213 (51%), Gaps = 13/213 (6%)

Query: 26  LVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVH 85
            ++  ++ + E   +       V+++   L  G  VT   +  V +P  +V  G   D  
Sbjct: 22  FIANSYLSSAEKAPQADGGMAKVVVATVSLPFGSAVTAEKIRTVDWPANSVPPGAFRDPI 81

Query: 86  QPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG---LSSLLPKGKRAATMDISISSAV 142
           Q  ++ +  G +V   I  G+PI   KL   G GG   +S++L    RA  + +S  +A 
Sbjct: 82  QLTSLGK--GRVVLRQIEPGEPILASKL--SGEGGRATMSAVLAPEMRAVAVRVSDVAAA 137

Query: 143 GGMIKPNDHVDVVMVRSLSE----RKPTVTVVLSNIRVIAIDHNI-DSDERVLVGSTATL 197
           GG + P D VDV + R+L++     +    V+L   RVIAID N  D+ +   VG TATL
Sbjct: 138 GGFVLPGDTVDVFVTRTLTDPVAGSQQITDVLLQGTRVIAIDQNANDTSKDPAVGKTATL 197

Query: 198 ELTPMQAKALVAAQSVAKLSLVLRSIADL-NPS 229
           E+  + A+ LV AQ V +L+LVLR++ D  NP+
Sbjct: 198 EVNQVDAQKLVLAQQVGQLTLVLRNLTDKPNPA 230


>gi|300692330|ref|YP_003753325.1| pilus assembly (cpaB), transmembrane protein [Ralstonia
           solanacearum PSI07]
 gi|299079390|emb|CBJ52061.1| Putative pilus assembly (cpaB), transmembrane protein [Ralstonia
           solanacearum PSI07]
          Length = 284

 Score = 82.0 bits (201), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 106/202 (52%), Gaps = 19/202 (9%)

Query: 37  VITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGV 96
           ++ ++ +    V ++  D+ +G  ++P +++ V +P  ++  G + D H       LDG 
Sbjct: 28  LMQQSASGITKVAVASADVELGQRLSPEMVKLVDWPAASLPPGVVTDAH------ALDGR 81

Query: 97  LVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVV 155
           +V+  + +G+P+   KL   G  GGLS+++  GKRA T+ ++    V G   P  +VDV+
Sbjct: 82  VVKASLTRGEPVLESKLTPVGTAGGLSAVIADGKRAITVRVNDVVGVAGFALPGSYVDVI 141

Query: 156 MVRSLSERKPTVT-----------VVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQ 203
           +     E++               +VL  I V+A+   +  D+ +  V +  TLE+TP Q
Sbjct: 142 VNTMEDEKQAKAAGNDQKEHSISKIVLEKILVLAVAQEVGRDDTKPKVVNAVTLEVTPDQ 201

Query: 204 AKALVAAQSVAKLSLVLRSIAD 225
           A+ L  A+SV  LSLVLR+ AD
Sbjct: 202 AEKLDLARSVGTLSLVLRNQAD 223


>gi|134291858|ref|YP_001115627.1| SAF domain-containing protein [Burkholderia vietnamiensis G4]
 gi|134135047|gb|ABO59372.1| SAF domain protein [Burkholderia vietnamiensis G4]
          Length = 281

 Score = 82.0 bits (201), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 113/218 (51%), Gaps = 18/218 (8%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPE 73
           V A+VAG+ A+   S   + T            +V ++  DL +G  + PN +  V++P 
Sbjct: 11  VVAMVAGLAAVVFASRWLMNTSN------GSVTSVAVATTDLNLGEPLGPNQIHMVSWPA 64

Query: 74  ENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAA 132
            +V  G   D       +EL+G +VR  + +G+P+   KL   G  GGLS+++  G RA 
Sbjct: 65  GSVPTGAFTDT------KELEGRVVRTSLARGEPVIESKLAPVGTKGGLSAVIADGSRAI 118

Query: 133 TMDISISSAVGGMIKPNDHVDVVM----VRSLSERKPTVTVVLSNIRVIAIDHNIDSDER 188
           T+ ++    V G   P ++VDV++     +  ++ +    +VL +I V+A+   +  D+ 
Sbjct: 119 TVRVNDVVGVAGFALPGNYVDVIVNTQEQQGKTDGQSISKIVLEHILVLAVAQQVSRDDT 178

Query: 189 V-LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
              V +  TLE+TP QA+ L  A+SV  LSLVLR+  D
Sbjct: 179 APKVVNAVTLEVTPDQAERLDLARSVGTLSLVLRNQVD 216


>gi|78060315|ref|YP_366890.1| Flp pilus assembly CpaB [Burkholderia sp. 383]
 gi|77964865|gb|ABB06246.1| Flp pilus assembly CpaB [Burkholderia sp. 383]
          Length = 279

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 114/218 (52%), Gaps = 18/218 (8%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPE 73
           V A+VAG+ A+   S   VQT      + +    V ++  DL +G  + PN +  V++P 
Sbjct: 11  VVAMVAGLAAVVFASHWLVQT------STSSVTPVAVATTDLNLGEPLGPNQIHMVSWPS 64

Query: 74  ENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAA 132
            +V  G   D       + L+G +VR  + +G+P+   KL   G  GGLS+++  G RA 
Sbjct: 65  GSVPTGAFTDT------KGLEGRVVRTSLSRGEPVIESKLAPVGTKGGLSAVIADGSRAI 118

Query: 133 TMDISISSAVGGMIKPNDHVDVVM----VRSLSERKPTVTVVLSNIRVIAIDHNIDSDER 188
           T+ ++    V G   P ++VDV++     +  ++ +    +VL +I V+A+   +  D+ 
Sbjct: 119 TVRVNDVVGVAGFALPGNYVDVIVNTQEQQGKTDGQSISKIVLEHILVLAVAQQVSRDDT 178

Query: 189 V-LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
              V +  TLE+TP QA+ L  A+SV  LSLVLR+  D
Sbjct: 179 APKVVNAVTLEVTPDQAERLDLARSVGTLSLVLRNQVD 216


>gi|167584956|ref|ZP_02377344.1| Flp pilus assembly CpaB [Burkholderia ubonensis Bu]
          Length = 280

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 71/235 (30%), Positives = 121/235 (51%), Gaps = 29/235 (12%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK TR + +++    A+VAG+ A+   S   VQT        +    V ++  DL +G  
Sbjct: 1   MKNTRAITMLI---IAMVAGLAAVAFASRWLVQTST------SAVTQVAVATTDLNLGEP 51

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           + P  +  +++P  +V  G   D       + L+G +VR  + +G+P+   KL   G  G
Sbjct: 52  IGPAQIRTISWPTGSVPPGAFTDT------KSLEGRVVRTSLARGEPVLEAKLAPLGTKG 105

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT--------VVL 171
           GLS+++  G RA T+ ++    V G   P ++VDV++    + ++P  T        +VL
Sbjct: 106 GLSAVIGAGNRAITVRVNDVVGVAGFALPGNYVDVIV----NTQEPGKTDNQQSISKIVL 161

Query: 172 SNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
            +I V+A+   +  D+ +  V +  TLE++P QA+ L  A+SV  LSLVLR+  D
Sbjct: 162 EHILVLAVAQQVSRDDTQPKVVNAVTLEVSPEQAEKLDVARSVGTLSLVLRNQVD 216


>gi|296156488|ref|ZP_06839326.1| Flp pilus assembly protein CpaB [Burkholderia sp. Ch1-1]
 gi|295893087|gb|EFG72867.1| Flp pilus assembly protein CpaB [Burkholderia sp. Ch1-1]
          Length = 269

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 114/221 (51%), Gaps = 21/221 (9%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPE 73
           + A +AG+ A+   S        +++++      V+++  D+ +G  + P+ L+   +P 
Sbjct: 3   LIATLAGLTAVVFAS------RWMVSQSSNATTKVVVAATDINLGQRIGPDFLKLTEWPS 56

Query: 74  ENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAA 132
            +V  G   D+      Q+LDG +++  +L G+P+   KL   G  GGLS+++ +GKRA 
Sbjct: 57  NSVPPGSFTDI------QKLDGRVLKESLLHGEPVLEAKLTPVGTLGGLSAVIGEGKRAI 110

Query: 133 TMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTV-------TVVLSNIRVIAIDHNIDS 185
           T+ ++    V G   P ++VD+++      R P          +VL  I V+A+   +  
Sbjct: 111 TVRVNDVIGVAGFALPGNYVDIIVNTQKDARDPGTQRDQNISKIVLEKILVLAVAQEVGR 170

Query: 186 DE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           DE +  V    TLE++P QA+ +  A+S+  LSLVLR+  D
Sbjct: 171 DETKPKVVDAVTLEVSPEQAEKIDLARSIGTLSLVLRNQID 211


>gi|170692565|ref|ZP_02883727.1| Flp pilus assembly protein CpaB [Burkholderia graminis C4D1M]
 gi|170142221|gb|EDT10387.1| Flp pilus assembly protein CpaB [Burkholderia graminis C4D1M]
          Length = 278

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/233 (31%), Positives = 122/233 (52%), Gaps = 23/233 (9%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK +R   IV+ G  AL+AG+ A+   S   +QT        +    V ++  ++++G  
Sbjct: 1   MKTSR--AIVMLG-MALLAGLAAVGFASRWLLQTSS------SALTPVAVATAEVSLGQP 51

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           +   ++  V +P  +V  G   D   P A   LDG +VR  +  G+P+   KL  +G  G
Sbjct: 52  LNSTMIRTVNWPTASVPPGAFKD---PKA---LDGRVVRASLEPGEPVIESKLAPQGTKG 105

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM------VRSLSERKPTVTVVLSN 173
           GLS+++ +GKRA T+ ++    V G   P ++VDV++       ++   ++    +VL  
Sbjct: 106 GLSAVIGEGKRAITVRVNDVVGVAGFALPGNYVDVIVNTQEPEAKTADPQQSISKIVLEK 165

Query: 174 IRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           I V+A+   +  D+ +  V +  TLE+TP QA+ L  A+SV  LSLVLR+  D
Sbjct: 166 ILVLAVAQQVSRDDTQPKVVNAVTLEVTPDQAEKLDLARSVGSLSLVLRNQID 218


>gi|197295152|ref|YP_002153693.1| putative flp type pilus assembly protein [Burkholderia cenocepacia
           J2315]
 gi|195944631|emb|CAR57235.1| putative flp type pilus assembly protein [Burkholderia cenocepacia
           J2315]
          Length = 279

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/218 (30%), Positives = 114/218 (52%), Gaps = 18/218 (8%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPE 73
           V A++AG+ A+   S   +QT      +     +V ++  DL +G  + PN +  V++P 
Sbjct: 11  VVAMIAGLAAVVFASHWLMQT------STNSVTSVAVATTDLNLGEPLGPNQIHMVSWPS 64

Query: 74  ENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAA 132
            +V  G   D       + L+G +VR  + +G+P+   KL   G  GGLS+++  G RA 
Sbjct: 65  GSVPTGAFTDT------KALEGRVVRTSLSRGEPVIESKLAPVGTKGGLSAVIADGSRAI 118

Query: 133 TMDISISSAVGGMIKPNDHVDVVM----VRSLSERKPTVTVVLSNIRVIAIDHNIDSDER 188
           T+ ++    V G   P ++VDV++     +  ++ +    +VL +I V+A+   +  D+ 
Sbjct: 119 TVRVNDVVGVAGFALPGNYVDVIVNTQEQQGKTDGQSISKIVLEHILVLAVAQQVSRDDT 178

Query: 189 V-LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
              V +  TLE+TP QA+ L  A+SV  LSLVLR+  D
Sbjct: 179 APKVVNAVTLEVTPDQAERLDLARSVGTLSLVLRNQVD 216


>gi|241662166|ref|YP_002980526.1| Flp pilus assembly protein CpaB [Ralstonia pickettii 12D]
 gi|309780761|ref|ZP_07675502.1| Flp pilus assembly protein CpaB [Ralstonia sp. 5_7_47FAA]
 gi|240864193|gb|ACS61854.1| Flp pilus assembly protein CpaB [Ralstonia pickettii 12D]
 gi|308920443|gb|EFP66099.1| Flp pilus assembly protein CpaB [Ralstonia sp. 5_7_47FAA]
          Length = 283

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 102/193 (52%), Gaps = 18/193 (9%)

Query: 45  FINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILK 104
              + ++  D+ +G  ++P  ++ V +P  ++  G I+D H       LDG +VR  + +
Sbjct: 36  ITKIAVAATDIDLGQRLSPEAIKLVDWPASSLPPGAINDPH------ALDGRVVRASLTR 89

Query: 105 GDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER 163
           G+P+   KL   G  GGLS+++ +GKRA T+ ++    V G   P  +VD+++      R
Sbjct: 90  GEPVLDSKLTPVGTAGGLSAVIAEGKRAITVRVNDVVGVAGFALPGSYVDIIVNTQQDSR 149

Query: 164 --KPTV--------TVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQS 212
             KP           +VL  I V+A+   ++ D+ +  V +  TLE+TP QA+ +  A+S
Sbjct: 150 EAKPGADRNDQSISKIVLEKILVLAVAQEVNRDDTKPKVVNAVTLEVTPEQAEKIDLARS 209

Query: 213 VAKLSLVLRSIAD 225
           V  LSLVLR+  D
Sbjct: 210 VGNLSLVLRNQVD 222


>gi|254255253|ref|ZP_04948569.1| Flp pilus assembly protein CpaB [Burkholderia dolosa AUO158]
 gi|124900990|gb|EAY71740.1| Flp pilus assembly protein CpaB [Burkholderia dolosa AUO158]
          Length = 323

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 115/218 (52%), Gaps = 18/218 (8%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPE 73
           V A+VAG+ A+   S   VQT      + +   +V ++  DL +G  +  N +  V++P 
Sbjct: 53  VVAMVAGLAAVVFASHWLVQT------STSAVTSVAVAATDLNLGEPLGANQIHMVSWPS 106

Query: 74  ENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAA 132
            +V  G   D       + L+G +VR  + +G+P+   KL   G  GGLS+++ +G RA 
Sbjct: 107 GSVPTGAFTDT------KALEGRVVRTSLARGEPVIESKLAPIGTKGGLSAVIAEGSRAI 160

Query: 133 TMDISISSAVGGMIKPNDHVDVVM----VRSLSERKPTVTVVLSNIRVIAIDHNIDSDER 188
           T+ ++    V G   P ++VDV++     +  ++ +    +VL +I V+A+   +  D+ 
Sbjct: 161 TVRVNDVVGVAGFALPGNYVDVIVNTQEQQGKTDGQSISKIVLEHILVLAVAQQVSRDDT 220

Query: 189 V-LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
              V +  TLE+TP QA+ L  A+SV  LSLVLR+  D
Sbjct: 221 APKVVNAVTLEVTPEQAERLDLARSVGTLSLVLRNQID 258


>gi|294012240|ref|YP_003545700.1| Flp pilus assembly protein CpaB [Sphingobium japonicum UT26S]
 gi|292675570|dbj|BAI97088.1| Flp pilus assembly protein CpaB [Sphingobium japonicum UT26S]
          Length = 295

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 71/218 (32%), Positives = 109/218 (50%), Gaps = 14/218 (6%)

Query: 22  IAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFI 81
           +A   V+  ++   E +         V+++   L  G  VT   +  V +P  +V  G  
Sbjct: 4   LAAVFVANSYLSRAEKVPPPEGGMAKVVVATVSLPFGSAVTAEKIRVVDWPANSVPPGAF 63

Query: 82  DDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG---LSSLLPKGKRAATMDISI 138
            D  Q  ++ +  G +V   I  G+PI   KL   G GG   +S++L    RA  + +S 
Sbjct: 64  RDPIQLTSLGK--GRVVLRQIEPGEPILASKL--SGEGGRATMSAVLAPEMRAVAVRVSD 119

Query: 139 SSAVGGMIKPNDHVDVVMVRSLSE-----RKPTVTVVLSNIRVIAIDHNI-DSDERVLVG 192
            +A GG + P D VDV + R+L +      +    V+L   RVIAID N  D+ +   VG
Sbjct: 120 VAAAGGFVLPGDTVDVFVTRTLQDPMGGASQQITDVLLQGTRVIAIDQNANDTSKDPAVG 179

Query: 193 STATLELTPMQAKALVAAQSVAKLSLVLRSIADL-NPS 229
            TATLE+  + A+ LV AQ V +L+LVLR++ D  NP+
Sbjct: 180 KTATLEVNQVDAQKLVLAQQVGQLTLVLRNLTDKPNPA 217


>gi|299067806|emb|CBJ39017.1| Putative pilus assembly (cpaB), transmembrane protein [Ralstonia
           solanacearum CMR15]
          Length = 295

 Score = 79.3 bits (194), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 118/244 (48%), Gaps = 31/244 (12%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  R++ +++    A +AG+ AM   S   +Q      +  +    V ++  D+ +G  
Sbjct: 8   MKNLRILSMLL---IATIAGLAAMLFASRWLIQ------QGNSGTTKVAVAAVDVNLGQR 58

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           ++P  +  V +P  ++  G I D H       +DG + R  +  G+P+   KL   G  G
Sbjct: 59  LSPEFIRLVDWPAASLPPGAISDEHA------IDGRVTRTSLSPGEPVLESKLTPVGTKG 112

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM--------------VRSLSERKP 165
           GLS+++  GKRA T+ ++    V G   P  +VD+++               ++  E   
Sbjct: 113 GLSAVIADGKRAITVRVNDVVGVAGFALPGSYVDIIVNTQQEAPDGKPAKGAQADREEHS 172

Query: 166 TVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
              +VL  I V+A+   ++ DE +  V +  TLE+TP +A+ L  A+SV  LSLVLR+  
Sbjct: 173 ISKIVLEKILVLAVAQEVNRDETKPKVVNAVTLEVTPDEAEKLDLARSVGTLSLVLRNQV 232

Query: 225 DLNP 228
           D  P
Sbjct: 233 DPRP 236


>gi|17545375|ref|NP_518777.1| pilus assembly transmembrane protein [Ralstonia solanacearum
           GMI1000]
 gi|17427667|emb|CAD14186.1| probable pilus assembly cpab transmembrane protein [Ralstonia
           solanacearum GMI1000]
          Length = 288

 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 118/244 (48%), Gaps = 31/244 (12%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  R++ +++    A +AG+ AM   S   +Q      +  +    V ++  D+ +G  
Sbjct: 1   MKNLRILSMLL---IATIAGLAAMLFASRWLIQ------QGNSGTTKVAVAAVDVNLGQR 51

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           ++P  +  V +P  ++  G I D H       +DG + R  +  G+P+   KL   G  G
Sbjct: 52  LSPEFIRLVDWPAASLPPGAISDEHA------IDGRVTRTSLSPGEPVLESKLTPVGTKG 105

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM--------------VRSLSERKP 165
           GLS+++  GKRA T+ ++    V G   P  +VD+++               ++  E   
Sbjct: 106 GLSAVIADGKRAITVRVNDVVGVAGFALPGSYVDIIVNTQQETPDGKPAKGAQADREEHS 165

Query: 166 TVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
              +VL  I V+A+   ++ DE +  V +  TLE+TP +A+ L  A+SV  LSLVLR+  
Sbjct: 166 ISKIVLEKILVLAVAQEVNRDETKPKVVNAVTLEVTPDEAEKLDLARSVGTLSLVLRNQV 225

Query: 225 DLNP 228
           D  P
Sbjct: 226 DPRP 229


>gi|253701799|ref|YP_003022988.1| Flp pilus assembly protein CpaB [Geobacter sp. M21]
 gi|251776649|gb|ACT19230.1| Flp pilus assembly protein CpaB [Geobacter sp. M21]
          Length = 291

 Score = 79.0 bits (193), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 55/191 (28%), Positives = 105/191 (54%), Gaps = 19/191 (9%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRV---PIL 103
            ++++  D+ +G  +TP  L+  ++P++++          P + ++++ V  RV   PI 
Sbjct: 43  RIVVAAADIPIGTAITPAQLKVTSWPKDSI---------PPGSARDIEAVANRVAIRPIT 93

Query: 104 KGDPIRLEKLVDR----GNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS 159
            GD +   KL  R    G G ++ ++P+G RA T+ ++  + V G + P+D VDV++   
Sbjct: 94  GGDAVTEAKLKPRSGAPGAGFMTYVVPQGHRAVTVAVNEVAGVAGFLTPSDRVDVIVTTP 153

Query: 160 L--SERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKL 216
           L  +E++    +VL N+ ++A     D  E + +V  T TL+L P  A+ LV + S   L
Sbjct: 154 LPGNEKENISKIVLENVPILATGQVTDQKEGKPVVVPTVTLDLVPDDAEKLVLSASKGSL 213

Query: 217 SLVLRSIADLN 227
            L+LR+I+D++
Sbjct: 214 QLLLRNISDIS 224


>gi|193213116|ref|YP_001999069.1| Flp pilus assembly protein CpaB [Chlorobaculum parvum NCIB 8327]
 gi|193086593|gb|ACF11869.1| Flp pilus assembly protein CpaB [Chlorobaculum parvum NCIB 8327]
          Length = 263

 Score = 79.0 bits (193), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 73/238 (30%), Positives = 119/238 (50%), Gaps = 28/238 (11%)

Query: 9   IVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEW 68
           I ++ V   +A  IA R+     VQT+            V+I    +  G V+ P+ ++ 
Sbjct: 7   IAIALVLGAMAAYIAARM---STVQTD-------GSEAKVVIVAMPIDAGKVIAPDQIKA 56

Query: 69  VAFPEE----NVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSS 123
           V +P      N F    D V          G + RV ++ G+P+  +KL  +G  GGL+S
Sbjct: 57  VQWPSSAVPLNAFARTADVV----------GRVARVSMIAGEPVLPDKLALKGAKGGLAS 106

Query: 124 LLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDH-- 181
            LP+GKRA T+ ++   AV G   P  +VD+++      R+     VLS ++V+A+D   
Sbjct: 107 TLPEGKRAITVKVNEVIAVAGFALPGSYVDILVNGKDDNRRSFSRTVLSRVKVLAVDQVT 166

Query: 182 NIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDV 239
             D D+  LV +  T+EL+P +A+ L  A+++  LSLVLR+  D    +SE   + D+
Sbjct: 167 TGDPDKPKLVNAV-TVELSPREAEKLDLARNIGNLSLVLRNELDTAEVNSEGVRLPDI 223


>gi|323529414|ref|YP_004231566.1| Flp pilus assembly protein CpaB [Burkholderia sp. CCGE1001]
 gi|323386416|gb|ADX58506.1| Flp pilus assembly protein CpaB [Burkholderia sp. CCGE1001]
          Length = 278

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 101/189 (53%), Gaps = 14/189 (7%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V ++  ++++G  +  N++  V +P  +V  G   D   P A   LDG +VR  +  G+P
Sbjct: 39  VAVATAEVSLGQPLNANMIRTVNWPTASVPPGAFKD---PKA---LDGRVVRTSLEPGEP 92

Query: 108 IRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT 166
           +   KL  +G  GGLS+++ +GKRA T+ ++    V G   P ++VDV++     E K  
Sbjct: 93  VIESKLAPQGTKGGLSAVIGEGKRAITVRVNDVVGVAGFALPGNYVDVIVNTQEPESKTA 152

Query: 167 ------VTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLV 219
                   +VL  I V+A+   +  D+ +  V +  TLE+TP QA+ L  A+SV  LSLV
Sbjct: 153 DPQQSISKIVLEKILVLAVAQQVSRDDTQPKVVNAVTLEVTPDQAEKLDLARSVGSLSLV 212

Query: 220 LRSIADLNP 228
           LR+  D  P
Sbjct: 213 LRNQIDDRP 221


>gi|113866745|ref|YP_725234.1| flp pilus assembly protein [Ralstonia eutropha H16]
 gi|113525521|emb|CAJ91866.1| flp pilus assembly protein [Ralstonia eutropha H16]
          Length = 280

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 100/180 (55%), Gaps = 14/180 (7%)

Query: 54  DLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL 113
           DL +G  +  + L  V++P  +V  G  +D      M+ L+G +VR  + +G+P+   KL
Sbjct: 45  DLNLGQPLNGSQLRMVSWPTGSVPPGAFED------MKALEGRVVRTSLQRGEPVLDAKL 98

Query: 114 VDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT---- 168
              G  GGLS+++  GKRA T+ ++    V G   P ++VDV+ V +  E K T +    
Sbjct: 99  APVGTKGGLSAVINDGKRAITVRVNDVVGVAGFALPGNYVDVI-VNTNEEAKTTQSGSIS 157

Query: 169 -VVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADL 226
            +VL  I V+A+   +  D+ +  V +  TLE+TP QA+ L  A+SV  LSLVLR+  D+
Sbjct: 158 KIVLEKILVLAVAQQVSRDDTQPKVVNAVTLEVTPEQAEKLDVARSVGTLSLVLRNQLDV 217


>gi|73542328|ref|YP_296848.1| Flp pilus assembly CpaB [Ralstonia eutropha JMP134]
 gi|72119741|gb|AAZ62004.1| Flp pilus assembly CpaB [Ralstonia eutropha JMP134]
          Length = 280

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 113/213 (53%), Gaps = 19/213 (8%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V+++  DL +G  +  + L  V +P  +V  G  +D      ++ L+G +VR  + +G+P
Sbjct: 39  VVVAANDLNLGQPLNGSQLRLVNWPTASVPPGAFED------LKLLEGRVVRTSLQRGEP 92

Query: 108 IRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT 166
           +   KL   G  GGLS+++  GKRA T+ ++    V G   P ++VDV++  + +E   T
Sbjct: 93  VLDAKLAPIGTKGGLSAVINDGKRAITVRVNDVVGVAGFALPGNYVDVIV--NTNEEAKT 150

Query: 167 VT------VVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLV 219
                   +VL  I V+A+   +  D+ +  V +  TLE+TP QA+ L  A+SV  LSLV
Sbjct: 151 AQNGSISKIVLEKILVLAVAQQVSRDDTQPKVVNAVTLEVTPDQAEKLDVARSVGTLSLV 210

Query: 220 LRS---IADLNPSSSEDSDVWDVQEEGKEIQII 249
           LR+   +AD+N   +    +     E  +++++
Sbjct: 211 LRNQMDVADINTGGATKGTLLGKAPEAPQVKVV 243


>gi|27378603|ref|NP_770132.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
 gi|27351751|dbj|BAC48757.1| blr3492 [Bradyrhizobium japonicum USDA 110]
          Length = 329

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/171 (33%), Positives = 84/171 (49%), Gaps = 21/171 (12%)

Query: 84  VHQPNAMQELDGVLVRVPILKGDPIRLEK-LVDRGNGGLSSLLPKGKRAATMDISISSAV 142
           +  P+A   L G LVR  +  G PI L+  L  R  G L+S+L    RA ++ +   S V
Sbjct: 96  LETPDAKAGLTGSLVRKFVEAGSPITLQDVLRPRDRGFLASVLAPDSRAISIKVDEESGV 155

Query: 143 GGMIKPNDHVDVVMVRSLSE----RKPTVTVVLSNIRVIAIDHNIDSDERV---LVG--- 192
            G+I+P DHVDV++ +   +    R+    VVL N+RVIAID  I    R    L G   
Sbjct: 156 SGLIRPGDHVDVLLTQVFEKADPARRALSEVVLGNVRVIAIDQEIVQGGRTVSSLAGKQA 215

Query: 193 STATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEG 243
            T +LEL P Q K +  A+ +  +SL +R+  +           WD  + G
Sbjct: 216 QTVSLELAPDQVKKITVAKQIGTISLAVRAAVEQ----------WDTADTG 256


>gi|295700371|ref|YP_003608264.1| Flp pilus assembly protein CpaB [Burkholderia sp. CCGE1002]
 gi|295439584|gb|ADG18753.1| Flp pilus assembly protein CpaB [Burkholderia sp. CCGE1002]
          Length = 276

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 112/217 (51%), Gaps = 18/217 (8%)

Query: 15  FALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEE 74
            A++AG+ A+   S   +QT        A   +V ++  D+++G  +  N++  V++P  
Sbjct: 12  IAVLAGLAAVSFASRWLLQTSS------AAVTSVAVASSDISLGQPLNQNLIHMVSWPTS 65

Query: 75  NVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAAT 133
           +V  G   D       + L+G ++   +  G+P+   KL  +G  GGLS+++ +G RA T
Sbjct: 66  SVPPGAFAD------SKALEGRVLLTSLAPGEPVLESKLAPQGTKGGLSAVIGEGHRAIT 119

Query: 134 MDISISSAVGGMIKPNDHVDVVMVRSLSER----KPTVTVVLSNIRVIAIDHNIDSDERV 189
           + ++    V G   P ++VDV++    + +    +    +VL  I V+A+   +  D+  
Sbjct: 120 VRVNDVVGVAGFALPGNYVDVIVNTQQANKTDASQSISKIVLEKILVLAVAQRVSRDDTA 179

Query: 190 -LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
             V +  TLE+TP QA+ L  A+SV  LSLVLR+  D
Sbjct: 180 PKVVNAVTLEVTPEQAEKLDLARSVGTLSLVLRNQVD 216


>gi|170701162|ref|ZP_02892135.1| Flp pilus assembly protein CpaB [Burkholderia ambifaria IOP40-10]
 gi|170133943|gb|EDT02298.1| Flp pilus assembly protein CpaB [Burkholderia ambifaria IOP40-10]
          Length = 281

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 97/178 (54%), Gaps = 12/178 (6%)

Query: 54  DLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL 113
           DL +G  + PN +  V++P  +V  G   D       +EL+G +VR  + +G+P+   KL
Sbjct: 45  DLNLGEPLGPNQIHMVSWPSGSVPTGAFADT------KELEGRVVRTSLARGEPVIESKL 98

Query: 114 VDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM----VRSLSERKPTVT 168
              G  GGLS+++  G RA T+ ++    V G   P ++VDV++     +  ++ +    
Sbjct: 99  APVGTKGGLSAVIADGSRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQQGKTDGQSISK 158

Query: 169 VVLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           +VL +I V+A+   +  D+    V +  TLE+TP QA+ L  A+SV  LSLVLR+  D
Sbjct: 159 IVLEHILVLAVAQQVSRDDTAPKVVNAVTLEVTPDQAERLDLARSVGTLSLVLRNQVD 216


>gi|115361032|ref|YP_778169.1| Flp pilus assembly CpaB [Burkholderia ambifaria AMMD]
 gi|115286360|gb|ABI91835.1| Flp pilus assembly CpaB [Burkholderia ambifaria AMMD]
          Length = 281

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 97/178 (54%), Gaps = 12/178 (6%)

Query: 54  DLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL 113
           DL +G  + PN +  V++P  +V  G   D       +EL+G +VR  + +G+P+   KL
Sbjct: 45  DLNLGEPLGPNQIHMVSWPSGSVPTGAFADT------KELEGRVVRTSLARGEPVIESKL 98

Query: 114 VDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM----VRSLSERKPTVT 168
              G  GGLS+++  G RA T+ ++    V G   P ++VDV++     +  ++ +    
Sbjct: 99  APVGTKGGLSAVIADGSRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQQGKTDGQSISK 158

Query: 169 VVLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           +VL +I V+A+   +  D+    V +  TLE+TP QA+ L  A+SV  LSLVLR+  D
Sbjct: 159 IVLEHILVLAVAQQVSRDDTAPKVVNAVTLEVTPDQAERLDLARSVGTLSLVLRNQVD 216


>gi|172065272|ref|YP_001815984.1| Flp pilus assembly protein CpaB [Burkholderia ambifaria MC40-6]
 gi|171997514|gb|ACB68431.1| Flp pilus assembly protein CpaB [Burkholderia ambifaria MC40-6]
          Length = 281

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 97/178 (54%), Gaps = 12/178 (6%)

Query: 54  DLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL 113
           DL +G  + PN +  V++P  +V  G   D       +EL+G +VR  + +G+P+   KL
Sbjct: 45  DLNLGEPLGPNQIHMVSWPSGSVPTGAFADT------KELEGRVVRTSLARGEPVIESKL 98

Query: 114 VDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM----VRSLSERKPTVT 168
              G  GGLS+++  G RA T+ ++    V G   P ++VDV++     +  ++ +    
Sbjct: 99  APVGTKGGLSAVIADGSRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQQGKTDGQSISK 158

Query: 169 VVLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           +VL +I V+A+   +  D+    V +  TLE+TP QA+ L  A+SV  LSLVLR+  D
Sbjct: 159 IVLEHILVLAVAQQVSRDDTAPKVVNAVTLEVTPDQAERLDLARSVGTLSLVLRNQVD 216


>gi|329847252|ref|ZP_08262280.1| flp pilus assembly protein CpaB [Asticcacaulis biprosthecum C19]
 gi|328842315|gb|EGF91884.1| flp pilus assembly protein CpaB [Asticcacaulis biprosthecum C19]
          Length = 311

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 83/146 (56%), Gaps = 9/146 (6%)

Query: 95  GVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVD 153
           G + R  IL  +PI   K+V    GG ++ +L  G RA  + +S+ +  GG I P D VD
Sbjct: 136 GGVAREDILANEPIIDAKIVRSDEGGFMAVMLQPGMRALAVPVSVDNTAGGFILPGDRVD 195

Query: 154 VVMVRSLSERKPTVTV-----VLSNIRVIAIDHNI--DSDERVLVGSTATLELTPMQAKA 206
           +++   L       T+     VL NIRV+AID ++  + D++ ++G+TATLE++P   + 
Sbjct: 196 ILVTHQLPSATGRGTIDSVQPVLRNIRVLAIDQSVAAEQDKQTVIGATATLEVSPGDGQV 255

Query: 207 LVAAQSVAKLSLVLRSIADLN-PSSS 231
           +  A++   LSL+LRS AD   PS +
Sbjct: 256 VTLAKASGTLSLMLRSYADAQGPSGA 281


>gi|319941903|ref|ZP_08016224.1| hypothetical protein HMPREF9464_01443 [Sutterella wadsworthensis
           3_1_45B]
 gi|319804556|gb|EFW01426.1| hypothetical protein HMPREF9464_01443 [Sutterella wadsworthensis
           3_1_45B]
          Length = 295

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 108/216 (50%), Gaps = 36/216 (16%)

Query: 37  VITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGV 96
           V++EN A+ ++V  +  +L+ G  ++   +EW A  +    D F+      N  Q+L G 
Sbjct: 36  VVSENKAQ-VSVARAAANLSPGSFLSARDIEWTAVAQSAAKDTFVQ-----NESQDLSGA 89

Query: 97  LVRVPILKGDPIRLEKLVDRGNGGL-SSLLPKGKRAATMDISISSAVGGMIKPNDHVDVV 155
           LV  PI  G+ I    L+ R +    +++L  G RA T+++ + +   G+++P + VDV+
Sbjct: 90  LVLKPIKAGEVISPSALLARTDPEFVAAVLAPGMRAFTIEVDMVTGGAGLLRPGNRVDVI 149

Query: 156 MV--------RSLSERK--PTVTVVLSNIRVIAIDHNID----------SDERVLVGSTA 195
           +         R+ + +K       +L N+RVIA+DH I+          SD R++  ST 
Sbjct: 150 LAAQTDPQKSRAFASQKNFDVARTLLHNLRVIAVDHTIEPKGFGADPQSSDPRMVRSSTP 209

Query: 196 ---------TLELTPMQAKALVAAQSVAKLSLVLRS 222
                    TLE+TP   + L  A+S  +LSL LR+
Sbjct: 210 ANINRKGTVTLEVTPKDVELLTVARSNGQLSLSLRN 245


>gi|144898050|emb|CAM74914.1| Flp pilus assembly protein CpaB [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 288

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/209 (30%), Positives = 103/209 (49%), Gaps = 20/209 (9%)

Query: 34  TEEVITENP---AKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAM 90
           T++  T  P   A  + VL+   D+A G  ++   L +  +P  N    F+      +  
Sbjct: 27  TDKQSTARPTVAADSVEVLVLARDVATGSALSDADLRYENWPAVNAGR-FMTRKDGDDPK 85

Query: 91  QELDGVLVRVPILKGDPIRLEKLVDR-GNGGLSSLLPKGKRAATMDISISSAVGGMIKPN 149
               G + R P+ +G+P        R G+G L+ +L  G RA ++ IS +SAV G + P 
Sbjct: 86  ARAIGAVARRPLSEGEPFTPSATFTRDGSGILAGMLAPGMRAVSVAISNASAVSGFVVPG 145

Query: 150 DHVDVVMV----RSLSER---------KPTVTVVLSNIRVIAIDHNID--SDERVLVGST 194
           D VDVV+     R+ SE          +     VL++++V+A+D       D   + G T
Sbjct: 146 DRVDVVLAADFQRADSEAAGKGGGAIVRYAAETVLADVKVLAVDQQFSKGKDGPTIQGKT 205

Query: 195 ATLELTPMQAKALVAAQSVAKLSLVLRSI 223
           ATLE++P QA+ LV A  + +LSL+LR +
Sbjct: 206 ATLEVSPDQAEILVTAGLMGQLSLILRGV 234


>gi|167579113|ref|ZP_02371987.1| pilus assembly protein [Burkholderia thailandensis TXDOH]
          Length = 279

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 104/193 (53%), Gaps = 12/193 (6%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V ++  D+ +G  + PN L  V +P  +V  G   D      ++ L+G +VR  + +G+P
Sbjct: 39  VAVAATDVNLGEPLGPNQLRIVNWPTASVPPGAFTD------LKSLEGRVVRTSLARGEP 92

Query: 108 IRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-VRSLSERKP 165
           +   KL   G  GGLS+++  G RA T+ ++    V G   P ++VDV++  +  S+  P
Sbjct: 93  VLGTKLAPVGTKGGLSAVIAPGDRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQSKADP 152

Query: 166 TVTV---VLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
             ++   VL  I V+A+   +  D+    V +  TLE+TP QA+ L  A+SV  LSLVLR
Sbjct: 153 QQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVTPDQAEKLDLARSVGTLSLVLR 212

Query: 222 SIADLNPSSSEDS 234
           +  D +  ++E +
Sbjct: 213 NQVDKSALTTEGA 225


>gi|83717368|ref|YP_440455.1| pilus assembly protein [Burkholderia thailandensis E264]
 gi|167617228|ref|ZP_02385859.1| pilus assembly protein [Burkholderia thailandensis Bt4]
 gi|257141103|ref|ZP_05589365.1| pilus assembly protein [Burkholderia thailandensis E264]
 gi|83651193|gb|ABC35257.1| pilus assembly protein [Burkholderia thailandensis E264]
          Length = 279

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 103/191 (53%), Gaps = 12/191 (6%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V ++  D+ +G  + PN L  V +P  +V  G   D      ++ L+G +VR  + +G+P
Sbjct: 39  VAVAATDVNLGEPLGPNQLRIVNWPTASVPPGAFTD------LKSLEGRVVRTSLARGEP 92

Query: 108 IRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-VRSLSERKP 165
           +   KL   G  GGLS+++  G RA T+ ++    V G   P ++VDV++  +  S+  P
Sbjct: 93  VLGTKLAPVGTKGGLSAVIAPGDRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQSKADP 152

Query: 166 TVTV---VLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
             ++   VL  I V+A+   +  D+    V +  TLE+TP QA+ L  A+SV  LSLVLR
Sbjct: 153 QQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVTPDQAEKLDLARSVGTLSLVLR 212

Query: 222 SIADLNPSSSE 232
           +  D +  ++E
Sbjct: 213 NQVDKSALTTE 223


>gi|307726374|ref|YP_003909587.1| Flp pilus assembly protein CpaB [Burkholderia sp. CCGE1003]
 gi|307586899|gb|ADN60296.1| Flp pilus assembly protein CpaB [Burkholderia sp. CCGE1003]
          Length = 278

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 100/189 (52%), Gaps = 14/189 (7%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V +   ++++G  +  N++  V +P  +V  G   D   P A   LDG +VR  +  G+P
Sbjct: 39  VAVVTAEVSLGQPLNANMIRTVNWPTASVPPGAFKD---PKA---LDGRVVRTSLEPGEP 92

Query: 108 IRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT 166
           +   KL  +G  GGLS+++ +GKRA T+ ++    V G   P ++VDV++     E K  
Sbjct: 93  VIESKLAPQGTKGGLSAVIGEGKRAITVRVNDVVGVAGFALPGNYVDVIVNTQEPEAKTA 152

Query: 167 ------VTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLV 219
                   +VL  I V+A+   +  D+ +  V +  TLE+TP QA+ L  A+SV  LSLV
Sbjct: 153 DPQHSISKIVLEKILVLAVAQQVSRDDTQPKVVNAVTLEVTPDQAEKLDLARSVGSLSLV 212

Query: 220 LRSIADLNP 228
           LR+  D  P
Sbjct: 213 LRNQIDDRP 221


>gi|54302291|ref|YP_132284.1| Flp pilus assembly protein [Photobacterium profundum SS9]
 gi|46915713|emb|CAG22484.1| hypothetical Flp pilus assembly protein [Photobacterium profundum
           SS9]
          Length = 264

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 105/202 (51%), Gaps = 13/202 (6%)

Query: 27  VSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQ 86
           V+   VQ +EV+ E P   +  ++++  + +G  +    L    +P + V     +   Q
Sbjct: 45  VTQVEVQIKEVMKEEPK--VPRVMAQQRIPLGTKIEAKHLSIEYYPTDLVKSKGYETPEQ 102

Query: 87  PNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGM 145
                 + G+L R  I +GD +R E+LV  G G  L++L+    RA T+ ++    V G 
Sbjct: 103 ------VVGMLARNEIFEGDLLRKERLVTPGEGTTLAALISPNMRAVTIRVNDVIGVAGF 156

Query: 146 IKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQA 204
           + P D VDV+ ++   E+      VL  I+++A+D    +D+ + ++    TLELTP QA
Sbjct: 157 LLPGDFVDVIYIK---EKSNNAITVLKKIKILAVDQTARTDDSKPVIVRAVTLELTPKQA 213

Query: 205 KALVAAQSVAKLSLVLRSIADL 226
           ++LV A+S  +L L LR+  D+
Sbjct: 214 ESLVTAKSKGELQLSLRNPNDI 235


>gi|145219385|ref|YP_001130094.1| SAF domain-containing protein [Prosthecochloris vibrioformis DSM
           265]
 gi|145205549|gb|ABP36592.1| SAF domain protein [Chlorobium phaeovibrioides DSM 265]
          Length = 262

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 98/181 (54%), Gaps = 8/181 (4%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
            V+I    + +G  +T   ++ V +P  ++  G +          E+ G + RV ++ G+
Sbjct: 34  KVVIVAQPIELGKAITTEQIKTVNWPGADIPQGAVSKA------TEVVGRIARVSMMPGE 87

Query: 107 PIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP 165
           P+   KL  +G  GGL+S++  GKRA T+ ++   AV G   P   VD+++    + R+P
Sbjct: 88  PVLPGKLAPKGATGGLASIISDGKRAITVKVNEVIAVAGFALPGSFVDILVSGKDANRQP 147

Query: 166 TVTVVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
               VLS ++V+A+     ++ ++  V +  TLELTP +++ L  A+S+  LSLVLR+  
Sbjct: 148 FSRTVLSRVKVLAVAQETTAEPDKPKVVNAVTLELTPHESEKLDLARSIGALSLVLRNEL 207

Query: 225 D 225
           D
Sbjct: 208 D 208


>gi|53723206|ref|YP_112191.1| pilus assembly-related, exported protein [Burkholderia pseudomallei
           K96243]
 gi|76817358|ref|YP_336468.1| pilus assembly transmembrane protein [Burkholderia pseudomallei
           1710b]
 gi|126444606|ref|YP_001064075.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           668]
 gi|126455786|ref|YP_001076988.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1106a]
 gi|167829714|ref|ZP_02461185.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei 9]
 gi|167899812|ref|ZP_02487213.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           7894]
 gi|167916475|ref|ZP_02503566.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           112]
 gi|217424287|ref|ZP_03455786.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           576]
 gi|226194084|ref|ZP_03789685.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           Pakistan 9]
 gi|237507313|ref|ZP_04520028.1| Flp pilus assembly protein CpaB [Burkholderia pseudomallei MSHR346]
 gi|242313081|ref|ZP_04812098.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1106b]
 gi|254182584|ref|ZP_04889178.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1655]
 gi|254187135|ref|ZP_04893650.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254262844|ref|ZP_04953709.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1710a]
 gi|254296484|ref|ZP_04963940.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           406e]
 gi|52213620|emb|CAH39674.1| putative pilus assembly-related, exported protein [Burkholderia
           pseudomallei K96243]
 gi|76581831|gb|ABA51305.1| pilus assembly transmembrane protein [Burkholderia pseudomallei
           1710b]
 gi|126224097|gb|ABN87602.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           668]
 gi|126229554|gb|ABN92967.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1106a]
 gi|157806446|gb|EDO83616.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           406e]
 gi|157934818|gb|EDO90488.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           Pasteur 52237]
 gi|184213119|gb|EDU10162.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1655]
 gi|217392752|gb|EEC32775.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           576]
 gi|225934029|gb|EEH30015.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           Pakistan 9]
 gi|234999518|gb|EEP48942.1| Flp pilus assembly protein CpaB [Burkholderia pseudomallei MSHR346]
 gi|242136320|gb|EES22723.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1106b]
 gi|254213846|gb|EET03231.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1710a]
          Length = 281

 Score = 76.6 bits (187), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 100/184 (54%), Gaps = 12/184 (6%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V ++  D+++G  + PN L  V +P  +V  G   D      ++ L+G +VR  + +G+P
Sbjct: 39  VAVAATDVSLGEPLGPNQLRIVNWPTASVPPGAFTD------LKPLEGRVVRTSLARGEP 92

Query: 108 IRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-VRSLSERKP 165
           +   KL   G  GGLS+++  G RA T+ ++    V G   P ++VDV++  +  S+  P
Sbjct: 93  VLGTKLAPVGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQSKADP 152

Query: 166 TVTV---VLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
             ++   VL  I V+A+   +  D+    V +  TLE++P QA+ L  A+SV  LSLVLR
Sbjct: 153 QQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVSPEQAEKLDLARSVGTLSLVLR 212

Query: 222 SIAD 225
           +  D
Sbjct: 213 NQVD 216


>gi|167574002|ref|ZP_02366876.1| putative pilus assembly protein CpaB [Burkholderia oklahomensis
           C6786]
          Length = 282

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 96/178 (53%), Gaps = 12/178 (6%)

Query: 54  DLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL 113
           D+ +G  + PN L  V +P  +V  G   DV      + L+G +VR  + +G+P+   KL
Sbjct: 45  DVNLGEPLVPNQLRVVNWPTASVPPGAFTDV------KSLEGRVVRTSLARGEPVLGSKL 98

Query: 114 VDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-VRSLSERKPTVTV-- 169
              G  GGLS+++  G RA T+ ++    V G   P ++VDV++  +  S+  P  ++  
Sbjct: 99  APVGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQSKADPQQSISK 158

Query: 170 -VLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
            VL  I V+A+   +  D+    V +  TLE+TP QA+ L  A+SV  LSLVLR+  D
Sbjct: 159 IVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVTPDQAEKLDLARSVGTLSLVLRNQVD 216


>gi|167744174|ref|ZP_02416948.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei 14]
          Length = 281

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 100/184 (54%), Gaps = 12/184 (6%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V ++  D+++G  + PN L  V +P  +V  G   D      ++ L+G +VR  + +G+P
Sbjct: 39  VAVAATDVSLGEPLGPNQLRIVNWPTASVPPGAFTD------LKPLEGRVVRTSLARGEP 92

Query: 108 IRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-VRSLSERKP 165
           +   KL   G  GGLS+++  G RA T+ ++    V G   P ++VDV++  +  S+  P
Sbjct: 93  VLGTKLAPVGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQSKADP 152

Query: 166 TVTV---VLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
             ++   VL  I V+A+   +  D+    V +  TLE++P QA+ L  A+SV  LSLVLR
Sbjct: 153 QQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVSPEQAEKLDLARSVGTLSLVLR 212

Query: 222 SIAD 225
           +  D
Sbjct: 213 NQVD 216


>gi|254192395|ref|ZP_04898834.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           S13]
 gi|169649153|gb|EDS81846.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           S13]
          Length = 281

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 100/184 (54%), Gaps = 12/184 (6%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V ++  D+++G  + PN L  V +P  +V  G   D      ++ L+G +VR  + +G+P
Sbjct: 39  VAVAATDVSLGEPLGPNQLRIVNWPTASVPPGAFTD------LKPLEGRVVRTSLARGEP 92

Query: 108 IRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-VRSLSERKP 165
           +   KL   G  GGLS+++  G RA T+ ++    V G   P ++VDV++  +  S+  P
Sbjct: 93  VLGTKLAPVGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQSKADP 152

Query: 166 TVTV---VLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
             ++   VL  I V+A+   +  D+    V +  TLE++P QA+ L  A+SV  LSLVLR
Sbjct: 153 QQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVSPEQAEKLDLARSVGTLSLVLR 212

Query: 222 SIAD 225
           +  D
Sbjct: 213 NQVD 216


>gi|167725246|ref|ZP_02408482.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           DM98]
          Length = 245

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 100/184 (54%), Gaps = 12/184 (6%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V ++  D+++G  + PN L  V +P  +V  G   D      ++ L+G +VR  + +G+P
Sbjct: 39  VAVAATDVSLGEPLGPNQLRIVNWPTASVPPGAFTD------LKPLEGRVVRTSLARGEP 92

Query: 108 IRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-VRSLSERKP 165
           +   KL   G  GGLS+++  G RA T+ ++    V G   P ++VDV++  +  S+  P
Sbjct: 93  VLGTKLAPVGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQSKADP 152

Query: 166 TVTV---VLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
             ++   VL  I V+A+   +  D+    V +  TLE++P QA+ L  A+SV  LSLVLR
Sbjct: 153 QQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVSPEQAEKLDLARSVGTLSLVLR 212

Query: 222 SIAD 225
           +  D
Sbjct: 213 NQVD 216


>gi|167566933|ref|ZP_02359849.1| putative pilus assembly protein CpaB [Burkholderia oklahomensis
           EO147]
          Length = 274

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 96/178 (53%), Gaps = 12/178 (6%)

Query: 54  DLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL 113
           D+ +G  + PN L  V +P  +V  G   DV      + L+G +VR  + +G+P+   KL
Sbjct: 37  DVNLGEPLVPNQLRVVNWPTASVPPGAFTDV------KSLEGRVVRTSLARGEPVLGSKL 90

Query: 114 VDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-VRSLSERKPTVTV-- 169
              G  GGLS+++  G RA T+ ++    V G   P ++VDV++  +  S+  P  ++  
Sbjct: 91  APVGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQSKADPQQSISK 150

Query: 170 -VLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
            VL  I V+A+   +  D+    V +  TLE+TP QA+ L  A+SV  LSLVLR+  D
Sbjct: 151 IVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVTPDQAEKLDLARSVGTLSLVLRNQVD 208


>gi|167821373|ref|ZP_02453053.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei 91]
          Length = 251

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 100/184 (54%), Gaps = 12/184 (6%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V ++  D+++G  + PN L  V +P  +V  G   D      ++ L+G +VR  + +G+P
Sbjct: 39  VAVAATDVSLGEPLGPNQLRIVNWPTASVPPGAFTD------LKPLEGRVVRTSLARGEP 92

Query: 108 IRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-VRSLSERKP 165
           +   KL   G  GGLS+++  G RA T+ ++    V G   P ++VDV++  +  S+  P
Sbjct: 93  VLGTKLAPVGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQSKADP 152

Query: 166 TVTV---VLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
             ++   VL  I V+A+   +  D+    V +  TLE++P QA+ L  A+SV  LSLVLR
Sbjct: 153 QQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVSPEQAEKLDLARSVGTLSLVLR 212

Query: 222 SIAD 225
           +  D
Sbjct: 213 NQVD 216


>gi|167851181|ref|ZP_02476689.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           B7210]
          Length = 253

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 100/184 (54%), Gaps = 12/184 (6%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V ++  D+++G  + PN L  V +P  +V  G   D      ++ L+G +VR  + +G+P
Sbjct: 39  VAVAATDVSLGEPLGPNQLRIVNWPTASVPPGAFTD------LKPLEGRVVRTSLARGEP 92

Query: 108 IRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-VRSLSERKP 165
           +   KL   G  GGLS+++  G RA T+ ++    V G   P ++VDV++  +  S+  P
Sbjct: 93  VLGTKLAPVGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQSKADP 152

Query: 166 TVTV---VLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
             ++   VL  I V+A+   +  D+    V +  TLE++P QA+ L  A+SV  LSLVLR
Sbjct: 153 QQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVSPEQAEKLDLARSVGTLSLVLR 212

Query: 222 SIAD 225
           +  D
Sbjct: 213 NQVD 216


>gi|162147490|ref|YP_001601951.1| pilus assembly protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545597|ref|YP_002277826.1| Flp pilus assembly protein CpaB [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786067|emb|CAP55649.1| putative pilus assembly protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209533274|gb|ACI53211.1| Flp pilus assembly protein CpaB [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 292

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 74/273 (27%), Positives = 124/273 (45%), Gaps = 48/273 (17%)

Query: 6   LMGIVVSGVFALVAG---IIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
           L+G+V+ G  AL +G   ++A              +TE     + VL+++     G ++ 
Sbjct: 15  LIGVVILGRLALHSGEKPVVAQ-------------VTEKKVPTVGVLVARKAEPAGALLQ 61

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-L 121
              L+   FP   V  G I DV  P+    L G L+RVP+ +G  +  E ++  G+ G L
Sbjct: 62  SGDLQTKDFPANLVPPGAIHDV--PSERAALTGGLLRVPVPEGGLLTNEAVLRVGDHGFL 119

Query: 122 SSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE------------------- 162
           +++L  G  A ++ +   S V  +I+P D+VD+++   ++                    
Sbjct: 120 AAVLKPGDSAVSVGVDSVSGVADLIEPGDYVDLIVTHDVATADVANSGGGAGGNPGGDAG 179

Query: 163 -RKPTVTVVLSNIRVIAID----HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLS 217
             +     VLS +RV+AID    H    D R +   T TLE+TP QA+A+  A  + +L+
Sbjct: 180 GGRIAAETVLSALRVVAIDREMQHTSTVDSRGVGNRTVTLEVTPAQAEAVAVAGRLGRLT 239

Query: 218 LVLRS-----IADLNPSSSEDSDVWDVQEEGKE 245
           L +RS     +A   P ++   DV      G E
Sbjct: 240 LAVRSLDQAGVAAFAPHTTWGGDVSPALAHGPE 272


>gi|94497253|ref|ZP_01303825.1| Flp pilus assembly CpaB [Sphingomonas sp. SKA58]
 gi|94423358|gb|EAT08387.1| Flp pilus assembly CpaB [Sphingomonas sp. SKA58]
          Length = 337

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 99/190 (52%), Gaps = 13/190 (6%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
           +VL++   L VG ++      +  +P++ V   +        A   L G ++R  I  G 
Sbjct: 48  HVLVAVKALPVGTILDAESFRFQPWPKDLVEQAYYLRGQADPA--RLAGSVIRTAITAGQ 105

Query: 107 PIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS---- 161
           P+    LV  G+ G L++ L  G RA T+ +S  ++V G + P D +D+V+ +S++    
Sbjct: 106 PLTQGSLVKPGDRGFLAAALAPGMRAVTVPVSAQTSVAGFVFPGDRIDLVLTQSVAGGGD 165

Query: 162 -ERKPTVTVVLSNIRVIAIDHNIDS---DERVLVG--STATLELTPMQAKALVAAQSVAK 215
            E       +L N+RV+A D  +D+   D + +V   S  TLE+TP  A+ +  AQ+V  
Sbjct: 166 GEPLKVSETILRNLRVLATDQRMDALGPDGKPVVQTYSNVTLEVTPKIAEKIAVAQTVGS 225

Query: 216 LSLVLRSIAD 225
           LS+ LRS+AD
Sbjct: 226 LSMSLRSMAD 235


>gi|167924331|ref|ZP_02511422.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           BCC215]
          Length = 281

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 100/184 (54%), Gaps = 12/184 (6%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V ++  D+++G  + PN L  V +P  +V  G   D      ++ L+G +VR  + +G+P
Sbjct: 39  VAVAATDVSLGEPLGPNQLRIVNWPTASVPPGAFTD------LKPLEGRVVRTSLARGEP 92

Query: 108 IRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-VRSLSERKP 165
           +   KL   G  GGLS+++  G RA T+ ++    V G   P ++VDV++  +  S+  P
Sbjct: 93  VLGTKLAPVGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQSKADP 152

Query: 166 TVTV---VLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
             ++   VL  I V+A+   +  D+    V +  TLE++P QA+ L  A+SV  LSLVLR
Sbjct: 153 QQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVSPEQAEKLDLARSVGTLSLVLR 212

Query: 222 SIAD 225
           +  D
Sbjct: 213 NQID 216


>gi|187927688|ref|YP_001898175.1| Flp pilus assembly protein CpaB [Ralstonia pickettii 12J]
 gi|187724578|gb|ACD25743.1| Flp pilus assembly protein CpaB [Ralstonia pickettii 12J]
          Length = 283

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 71/226 (31%), Positives = 117/226 (51%), Gaps = 20/226 (8%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPE 73
           + ALVAGI A+   S    Q      ++ +    V+++  D+ +G  +    L  V++P 
Sbjct: 11  IVALVAGIAAVVSASRWLSQ------QSTSSVKQVVVAASDMDLGQPLGNEQLRTVSWPA 64

Query: 74  ENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAA 132
            ++  G  DD   P A+Q   G +VR  + KG+PI   KL   G  GGLS+++ +GKRA 
Sbjct: 65  GSLPPGTFDD---PKALQ---GRVVRASLQKGEPILENKLAPIGTKGGLSAVIAEGKRAI 118

Query: 133 TMDISISSAVGGMIKPNDHVDVVM------VRSLSERKPTVTVVLSNIRVIAIDHNIDSD 186
           T+ ++    V G   P + VDV++        + +       +VL  I V+A+   +  D
Sbjct: 119 TVRVNDVVGVAGFALPGNLVDVIVNTNEDAKSASNNNNSISKIVLEKILVLAVAQQVSRD 178

Query: 187 E-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSS 231
           + +  V +  TLE+TP QA+ L  A+SV  LSLVLR+  D+  +++
Sbjct: 179 DTQPKVVNAVTLEVTPDQAEKLDVARSVGTLSLVLRNQVDVAATAT 224


>gi|167624206|ref|YP_001674500.1| SAF domain-containing protein [Shewanella halifaxensis HAW-EB4]
 gi|167354228|gb|ABZ76841.1| SAF domain protein [Shewanella halifaxensis HAW-EB4]
          Length = 270

 Score = 75.9 bits (185), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 112/218 (51%), Gaps = 20/218 (9%)

Query: 14  VFALVAGIIAMRLVS---PHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVA 70
           + +LV G+ A+ L       + QTE V T +     NV+    ++ +G ++    L    
Sbjct: 10  ILSLVFGVTAVYLAQSWLKSNTQTETVGTTS-----NVITMVTEVPLGTIIERKHLALTP 64

Query: 71  FPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGK 129
            PE  V  G I D+       E +G +V+  + +G+ +R E+L  +G G  L+SL+    
Sbjct: 65  VPENLVPKGAITDI------TEAEGQVVKHRLYQGEVLRKERLTPKGEGSTLASLITPTM 118

Query: 130 RAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDER- 188
           RA T+ ++    V G + P + VD++ +   S  K    +VLSN++++AID    +DE  
Sbjct: 119 RAVTIRVNDVVGVAGFLLPGNRVDIINIFKSSGLK--TDIVLSNVKILAIDQKASNDENK 176

Query: 189 -VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
            VLV +  TLEL+  QA+ L+ A+S   L L LR+  D
Sbjct: 177 PVLVRA-VTLELSLEQAEVLMIAKSRGSLQLALRNPND 213


>gi|197117447|ref|YP_002137874.1| Flp pilus assembly protein CpaB [Geobacter bemidjiensis Bem]
 gi|197086807|gb|ACH38078.1| Flp pilus assembly protein CpaB [Geobacter bemidjiensis Bem]
          Length = 291

 Score = 75.9 bits (185), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 108/201 (53%), Gaps = 19/201 (9%)

Query: 35  EEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELD 94
           +EV +   A+   ++++  D+ +G  +TP  L+  ++P++++          P + + ++
Sbjct: 31  QEVKSAKAAQPQRIVVAAVDIPIGTAITPAQLKVASWPKDSI---------PPGSARGIE 81

Query: 95  GVLVRV---PILKGDPIRLEKLVDR----GNGGLSSLLPKGKRAATMDISISSAVGGMIK 147
            V  RV   PI  GD +   KL  R    G G ++ ++P+G RA T+ ++  + V G + 
Sbjct: 82  AVANRVAIRPITGGDAVTEAKLKPRSGAPGAGFMTYVVPQGHRAVTVAVNEVAGVAGFLT 141

Query: 148 PNDHVDVVMVRSL--SERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQA 204
           P+D VDV++   +  +E++    +VL N+ ++A     D  E + +V  T TL+L P  A
Sbjct: 142 PSDRVDVIVTTPVPGNEKENISKIVLENVPILATGQVTDQKEGKPVVVPTVTLDLVPDDA 201

Query: 205 KALVAAQSVAKLSLVLRSIAD 225
           + LV + S   L L+LR+I+D
Sbjct: 202 EKLVLSASKGSLQLLLRNISD 222


>gi|78186538|ref|YP_374581.1| pilus assembly protein CpaB [Chlorobium luteolum DSM 273]
 gi|78166440|gb|ABB23538.1| pilus assembly protein CpaB [Chlorobium luteolum DSM 273]
          Length = 262

 Score = 75.5 bits (184), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 81/137 (59%), Gaps = 2/137 (1%)

Query: 97  LVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVV 155
           + RV ++ G+P+   KL  +G  GGL+S++P GKRA T+ ++   AV G   P  +VDV+
Sbjct: 78  IARVSMMPGEPVLPGKLAPKGATGGLASIIPDGKRAITVKVNEVIAVAGFALPGSYVDVL 137

Query: 156 MVRSLSERKPTVTVVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVA 214
           +    +  +P    VL+ ++V+AI     ++ ++  V +  TLELTP +++ L  A+S+ 
Sbjct: 138 VSGKDASHQPFARTVLNRVKVLAIAQETTAEPDKPKVVNAVTLELTPHESEKLDLARSIG 197

Query: 215 KLSLVLRSIADLNPSSS 231
            LSLVLR+  D    +S
Sbjct: 198 SLSLVLRNELDTGEENS 214


>gi|90411207|ref|ZP_01219220.1| hypothetical Flp pilus assembly protein [Photobacterium profundum
           3TCK]
 gi|90328053|gb|EAS44374.1| hypothetical Flp pilus assembly protein [Photobacterium profundum
           3TCK]
          Length = 266

 Score = 75.5 bits (184), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 103/202 (50%), Gaps = 13/202 (6%)

Query: 27  VSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQ 86
           V+   VQ +EV+ E P   +  + ++  + +G  +    L    +P + V     +   Q
Sbjct: 45  VTQVEVQIKEVMKEEPK--VPRVTAQQRIPLGTKIEAKHLSIEYYPTDLVSTKGYETPEQ 102

Query: 87  PNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGM 145
                 + G+L R  I +GD +R E+LV  G G  L++L+    RA T+ ++    V G 
Sbjct: 103 ------VVGMLARNEIFEGDLLRKERLVTPGEGTTLAALISPNMRAVTIRVNDVIGVAGF 156

Query: 146 IKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQA 204
           + P D VDV+  +   E+      VL  I+++A+D    +D+ + ++    TLELTP QA
Sbjct: 157 LLPGDFVDVIYTK---EKSNNAVTVLKKIKILAVDQTARTDDSKPVIVRAVTLELTPKQA 213

Query: 205 KALVAAQSVAKLSLVLRSIADL 226
           ++LV A+S  +L L LR+  D+
Sbjct: 214 ESLVTAKSKGELQLSLRNPNDI 235


>gi|186474102|ref|YP_001861444.1| Flp pilus assembly protein CpaB [Burkholderia phymatum STM815]
 gi|184196434|gb|ACC74398.1| Flp pilus assembly protein CpaB [Burkholderia phymatum STM815]
          Length = 282

 Score = 75.1 bits (183), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 117/229 (51%), Gaps = 25/229 (10%)

Query: 16  ALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEEN 75
           A  AG+ A+   +   VQ     T        V+I+  D+++G  V+P +L+   +P  +
Sbjct: 13  ATAAGLAAVVFAARWMVQQTSTST------TKVVIASADMSLGQRVSPEMLKVSDWPAGS 66

Query: 76  VFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATM 134
           V  G  +DV      ++L+G +++  + +G+P+   KL   G  GGLS+++ +GKRA T+
Sbjct: 67  VPPGTFNDV------KKLEGRVLKASLSRGEPVLEAKLSPVGTLGGLSAVINEGKRAITV 120

Query: 135 DISISSAVGGMIKPNDHVDVVMVR----------SLSERKPTVT-VVLSNIRVIAIDHNI 183
            ++    V G   P ++VD+++              S R   ++ +VL  I V+A+    
Sbjct: 121 RVNDVIGVAGFALPGNYVDILVNTEKENASREGAGASGRDQNISKIVLEKILVLAVAQEA 180

Query: 184 DSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSS 231
             DE +  V    TLE+TP QA+ +  A+S+  LSLVLR+  D   +S+
Sbjct: 181 GRDETKPKVVDAVTLEVTPEQAEKIDLARSIGSLSLVLRNQVDPQDTST 229


>gi|167908128|ref|ZP_02495333.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           NCTC 13177]
          Length = 256

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 99/184 (53%), Gaps = 12/184 (6%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V ++  D+++G  + PN L  V +P  +V  G   D      ++ L+G + R  + +G+P
Sbjct: 39  VAVAATDVSLGEPLGPNQLRIVNWPTASVPPGAFTD------LKPLEGRVARTSLARGEP 92

Query: 108 IRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-VRSLSERKP 165
           +   KL   G  GGLS+++  G RA T+ ++    V G   P ++VDV++  +  S+  P
Sbjct: 93  VLGTKLAPVGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQSKADP 152

Query: 166 TVTV---VLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
             ++   VL  I V+A+   +  D+    V +  TLE++P QA+ L  A+SV  LSLVLR
Sbjct: 153 QQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVSPEQAEKLDLARSVGTLSLVLR 212

Query: 222 SIAD 225
           +  D
Sbjct: 213 NQVD 216


>gi|224824212|ref|ZP_03697320.1| Flp pilus assembly protein CpaB [Lutiella nitroferrum 2002]
 gi|224603631|gb|EEG09806.1| Flp pilus assembly protein CpaB [Lutiella nitroferrum 2002]
          Length = 282

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 70/229 (30%), Positives = 122/229 (53%), Gaps = 26/229 (11%)

Query: 9   IVVSGVFALVAGIIAMRLVSPH-HVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILE 67
           IVVS +  LVA ++A + ++   +V  ++V+           ++  D+ +G  ++P +L 
Sbjct: 2   IVVSVIIGLVAVVMASQWINKQTNVAAQKVV-----------VASMDIDLGSKLSPEMLR 50

Query: 68  WVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLP 126
            V +P  ++ +G I D   P A   LDG +++  + +G+ I   KL   G  GGLS+++ 
Sbjct: 51  SVDWPSGSIPEGAILD---PKA---LDGRVLKTSVNRGEAILESKLAPVGTKGGLSAVVM 104

Query: 127 KGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK------PTVTVVLSNIRVIAID 180
           +GKRA T+ ++    V G   P ++VD+++  +   +K          +VL +I V+A+ 
Sbjct: 105 EGKRAMTVRVNDVVGVAGFALPGNYVDILVNTTDDAKKGQNNDASISKIVLEHILVLAVA 164

Query: 181 HNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNP 228
                D+ +  V +  TLE+TP QA+ L  A+SV  LSLVLR+  D  P
Sbjct: 165 QEASRDDTKPKVVNAVTLEVTPEQAEKLDLARSVGTLSLVLRNQVDPKP 213


>gi|23016178|ref|ZP_00055937.1| COG3745: Flp pilus assembly protein CpaB [Magnetospirillum
           magnetotacticum MS-1]
          Length = 296

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 74/248 (29%), Positives = 113/248 (45%), Gaps = 34/248 (13%)

Query: 43  AKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQP--NAMQELDGVLVRV 100
           A  + VL+   D+  G  ++ + L + ++P        +  V +P  +A     G++ R 
Sbjct: 30  APVVEVLVINRDVPSGAALSVDDLRYESWPRSAATARLV--VRRPGEDAKAAFVGMIARR 87

Query: 101 PILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS 159
            + +G+P+         + G L+ LL  GKRA ++ I+  +AV G I P D VDVVM+  
Sbjct: 88  ALTEGEPVSAATTFKPDSSGVLAGLLGPGKRAISITITNPTAVSGFITPGDRVDVVMLTD 147

Query: 160 LS--------ERKPT--------------VTVVLSNIRVIAIDHNI--DSDERVLVGSTA 195
           L         E K                   VLS+IRV+AID  I    D   + G TA
Sbjct: 148 LKKIEDAQGRESKQEEGRFGGETLLVRFGAETVLSDIRVLAIDQQITRGRDGAAIQGKTA 207

Query: 196 TLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS-SSEDSDVWDVQ---EEGKEIQIIKA 251
           TLE+TP QA+ LV A+++  L L LR      P+ + +  ++ D     E GK +Q    
Sbjct: 208 TLEVTPKQAEILVLAETMGMLQLSLRPQQGDGPAVAPQPGEMLDFTADLEAGKALQ-ASV 266

Query: 252 GVIVNKDG 259
           G    K G
Sbjct: 267 GFAAKKKG 274


>gi|194288837|ref|YP_002004744.1| pilus assembly transmembrane protein [Cupriavidus taiwanensis LMG
           19424]
 gi|193222672|emb|CAQ68675.1| PILUS ASSEMBLY TRANSMEMBRANE PROTEIN [Cupriavidus taiwanensis LMG
           19424]
          Length = 279

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 97/180 (53%), Gaps = 14/180 (7%)

Query: 54  DLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL 113
           DL +G  +    L  V++P  +V  G   D      ++ L+G +VR  + +G+PI   KL
Sbjct: 45  DLNLGQPLNGAQLRMVSWPAGSVPPGAFTD------LKALEGRVVRTSLQRGEPILDAKL 98

Query: 114 VDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT---- 168
              G  GGLS+++  GKRA T+ ++    V G   P ++VDV+ V +  E K +      
Sbjct: 99  APVGTKGGLSAVINDGKRAITVRVNDVVGVAGFALPGNYVDVI-VNTNEEAKSSQNSSIS 157

Query: 169 -VVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADL 226
            +VL  I V+A+   +  DE +  V +  TLE+TP QA+ L  A+SV  LSLVLR+  D+
Sbjct: 158 KIVLEKILVLAVAQQVSRDETQPKVVNAVTLEVTPDQAEKLDVARSVGTLSLVLRNQMDV 217


>gi|260776716|ref|ZP_05885611.1| flp pilus assembly protein RcpC/CpaB [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607939|gb|EEX34204.1| flp pilus assembly protein RcpC/CpaB [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 247

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 82/154 (53%), Gaps = 7/154 (4%)

Query: 83  DVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSA 141
           D  Q  + +EL G +V   I  G+ I   +L   G G  L++L+P+ KRA T+ ++    
Sbjct: 75  DEFQFTSSEELIGQVVATSIFPGEIINQNRLTVPGEGSTLAALIPENKRAVTIRVNDVIG 134

Query: 142 VGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDS-DERVLVGSTATLELT 200
           V G + P + VD++     SE   + + VL +I+V+A+D    + D + ++    TLE+T
Sbjct: 135 VAGFLLPGNKVDILSTVKYSETSASTSTVLKDIKVLAVDQTARTKDNKPIIVRAVTLEVT 194

Query: 201 PMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           P QA+ L+ A+S  ++ L LR     NP   E +
Sbjct: 195 PRQAEKLLTARSKGEIQLTLR-----NPHEEEKA 223


>gi|258621446|ref|ZP_05716480.1| Pilus assembly protein [Vibrio mimicus VM573]
 gi|262165920|ref|ZP_06033657.1| flp pilus assembly protein RcpC/CpaB [Vibrio mimicus VM223]
 gi|258586834|gb|EEW11549.1| Pilus assembly protein [Vibrio mimicus VM573]
 gi|262025636|gb|EEY44304.1| flp pilus assembly protein RcpC/CpaB [Vibrio mimicus VM223]
          Length = 250

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 85/153 (55%), Gaps = 7/153 (4%)

Query: 83  DVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSA 141
           ++ Q +  + L G +V  PI +G+ I +++L   G G  L+SL+P+  RA T+ ++    
Sbjct: 75  NISQFSDTKVLVGQIVTGPIFQGEIIYVQRLTVPGEGSTLASLIPEKMRAITIRVNDVIG 134

Query: 142 VGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELT 200
           V G + P + VDV+   S S+       VL +I+V+A+D    S E + ++    TLE+T
Sbjct: 135 VAGFLLPGNRVDVLNTVSYSKGSAVTNTVLKDIKVLAVDQTARSKENKPIIVRAVTLEVT 194

Query: 201 PMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
           P QA+ L++AQS  ++ L LR     NP   E+
Sbjct: 195 PEQAEKLLSAQSKGEIQLTLR-----NPHEPEE 222


>gi|262171231|ref|ZP_06038909.1| flp pilus assembly protein RcpC/CpaB [Vibrio mimicus MB-451]
 gi|261892307|gb|EEY38293.1| flp pilus assembly protein RcpC/CpaB [Vibrio mimicus MB-451]
          Length = 250

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 80/143 (55%), Gaps = 7/143 (4%)

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDH 151
           L G +V  PI +G+ I +++L   G G  L+SL+P+  RA T+ ++    V G + P + 
Sbjct: 85  LVGQIVTGPIFQGEIIYVQRLTVPGEGSTLASLIPEKMRAITIRVNDVIGVAGFLLPGNR 144

Query: 152 VDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAA 210
           VDV+   S S+       VL +I+V+A+D    S E + ++    TLE+TP QA+ L++A
Sbjct: 145 VDVLNTVSYSKGSAVTNTVLKDIKVLAVDQTARSKENKPIIVRAVTLEVTPEQAEKLLSA 204

Query: 211 QSVAKLSLVLRSIADLNPSSSED 233
           QS  ++ L LR     NP   E+
Sbjct: 205 QSKGEIQLTLR-----NPHEPEE 222


>gi|167841424|ref|ZP_02468108.1| putative pilus assembly protein CpaB [Burkholderia thailandensis
           MSMB43]
          Length = 281

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 99/184 (53%), Gaps = 12/184 (6%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V ++  D+ +G  + PN L  V +P  +V  G   D      ++ L+G +VR  + +G+P
Sbjct: 39  VAVAATDVNLGEPLGPNQLRIVNWPTASVPPGAFTD------LKPLEGRVVRTSLARGEP 92

Query: 108 IRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-VRSLSERKP 165
           +   KL   G  GGLS+++  G RA T+ ++    V G   P ++VDV++  +  S+  P
Sbjct: 93  VLGTKLAPIGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQSKADP 152

Query: 166 TVT---VVLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
             +   +VL  I V+A+   +  D+    V +  TLE++P QA+ L  A+SV  LSLVLR
Sbjct: 153 QQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVSPDQAEKLDLARSVGTLSLVLR 212

Query: 222 SIAD 225
           +  D
Sbjct: 213 NQID 216


>gi|297618080|ref|YP_003703239.1| Flp pilus assembly protein CpaB [Syntrophothermus lipocalidus DSM
           12680]
 gi|297145917|gb|ADI02674.1| Flp pilus assembly protein CpaB [Syntrophothermus lipocalidus DSM
           12680]
          Length = 242

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 109/227 (48%), Gaps = 30/227 (13%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPE 73
           +F L A ++A R ++    + E      P   + V+++  D+    V+T   ++    P 
Sbjct: 13  LFGLAATVLAYRYIAGVKARYE------PKNLVQVVVAATDIPKNSVITREKVKLELVPA 66

Query: 74  ENVFDGFIDDVHQPNAMQELDGVLVRVP---ILKGDPIRLEKLVD--RGNGGLSSLLPKG 128
           +            P A+++LD V+ RV    I+ G+ I   K++        L+  +P G
Sbjct: 67  Q---------FAHPAAVRDLDEVVGRVAASYIVAGEEILSAKIISDAEKTNKLAYAVPMG 117

Query: 129 KRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTV---VLSNIRVIAIDHNIDS 185
           KRA ++ ++  S V G+++P D VDV+    L+  +  V V   +L ++ V+A+D N+D 
Sbjct: 118 KRAVSVPVNAVSGVSGLVRPGDRVDVIATVELASGQENVAVTSFILQDVEVLAVDQNLDE 177

Query: 186 DERV-------LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
            + V          +T TL +TP +A+ LV A     + L LR+ AD
Sbjct: 178 TKPVPAAKEEAAPATTVTLAVTPEEARPLVLASEQGSIRLALRAPAD 224


>gi|163738371|ref|ZP_02145786.1| CpaB family protein [Phaeobacter gallaeciensis BS107]
 gi|161388292|gb|EDQ12646.1| CpaB family protein [Phaeobacter gallaeciensis BS107]
          Length = 286

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 94/191 (49%), Gaps = 12/191 (6%)

Query: 45  FINVLISKGDLAVGMVVTPNILEWVAFPEENVFDG---FIDDVHQPNAMQELDGVLVRVP 101
            ++V I+   L  G  +T + +  V +PE  + +G    +D +  P    +L  VL R+ 
Sbjct: 47  LVDVFIANDQLKYGERLTRDSVRSVRWPENAIPEGAFLTMDALFPPQYPDDLRVVLRRME 106

Query: 102 ILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL 160
             K + I   K+   G + G++S L KG RA  + + +SS V G ++P DHVDV    SL
Sbjct: 107 --KDEAILAVKVTKPGEDAGITSRLAKGMRAFAIRVDVSSGVSGFLRPGDHVDVYWTGSL 164

Query: 161 SERK-----PTVTVVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVA 214
           +++          ++ +NI +IA+D     D +  ++  T T  + P Q  AL  AQS  
Sbjct: 165 NDQNGGRNGEFTRLIQTNIELIAVDQTAGGDLDGAVIARTVTAAVRPEQVAALAQAQSTG 224

Query: 215 KLSLVLRSIAD 225
           +LSL L    D
Sbjct: 225 RLSLSLVGAGD 235


>gi|94309593|ref|YP_582803.1| Flp pilus assembly CpaB [Cupriavidus metallidurans CH34]
 gi|93353445|gb|ABF07534.1| Flp pilus assembly CpaB precursor [Cupriavidus metallidurans CH34]
          Length = 281

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/183 (33%), Positives = 104/183 (56%), Gaps = 15/183 (8%)

Query: 54  DLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL 113
           DL +G  +  + L+ V++P  +V  G  +D       + LDG +VR  + +G+PI   KL
Sbjct: 45  DLDLGQPLNGSQLKLVSWPAGSVPPGAFED------PKTLDGRVVRTSLQRGEPIIDAKL 98

Query: 114 VDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVR---SLSERKPTVT- 168
              G  GGLS+++  GKRA T+ ++    V G   P ++VDV++     + S +  +++ 
Sbjct: 99  APVGTKGGLSAVINDGKRAITVRVNDVVGVAGFALPGNYVDVIVNTNEDTKSAQNGSISK 158

Query: 169 VVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRS---IA 224
           +VL  I V+A+   +  D+ +  V +  TLE++P QA+ L  A+SV  LSLVLR+   +A
Sbjct: 159 IVLEKILVLAVAQQVSRDDTQPKVVNAVTLEVSPDQAEKLDVARSVGTLSLVLRNQMDVA 218

Query: 225 DLN 227
           D+N
Sbjct: 219 DIN 221


>gi|56477529|ref|YP_159118.1| pilus assembly transmembrane protein [Aromatoleum aromaticum EbN1]
 gi|56313572|emb|CAI08217.1| pilus assembly transmembrane protein [Aromatoleum aromaticum EbN1]
          Length = 283

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 94/182 (51%), Gaps = 14/182 (7%)

Query: 54  DLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL 113
           +L +G  + P  +  V +P  ++  G   D      + +LDG +    I  G+P+   +L
Sbjct: 44  ELQLGSRIAPEAIRLVEWPSGSIPAGAFHD------LAKLDGRVAITGIQPGEPVLESRL 97

Query: 114 VDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM------VRSLSERKPT 166
              G  GGLS+++P+GKRA T+ ++    V G   P ++VD+++          S  +  
Sbjct: 98  APEGTKGGLSAVVPEGKRAITVRVNDVIGVAGFTLPGNYVDIMVNTENTGANRNSADQMI 157

Query: 167 VTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
             +VL  I V+A+    + DE +  V +  TLE+TP QA+ L  A+SV  LSLVLR+  D
Sbjct: 158 SKIVLERILVLAVAQEANRDETKPKVVNAVTLEVTPEQAERLDLARSVGNLSLVLRNQID 217

Query: 226 LN 227
            N
Sbjct: 218 SN 219


>gi|194335912|ref|YP_002017706.1| Flp pilus assembly protein CpaB [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194308389|gb|ACF43089.1| Flp pilus assembly protein CpaB [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 263

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 78/133 (58%), Gaps = 2/133 (1%)

Query: 95  GVLVRVPILKGDPIRLEKLV-DRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVD 153
           G +  V ++ G+P+   KL      GGLSS++PKGKRA T+ ++   AV G   P  +VD
Sbjct: 77  GRIALVSMMPGEPVLPGKLAPTTATGGLSSIIPKGKRAITVKVNEVIAVAGFALPGSYVD 136

Query: 154 VVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQS 212
           V++    + ++P    VL  ++V+AI     +D ++  V +  TLELTP +A+ L  A++
Sbjct: 137 VLVSSKDANQQPFSVTVLLRVKVLAIAQETTADRDKPKVVNAVTLELTPHEAEKLDLARN 196

Query: 213 VAKLSLVLRSIAD 225
           +  LSLVLR+  D
Sbjct: 197 IGALSLVLRNEFD 209


>gi|157961833|ref|YP_001501867.1| SAF domain-containing protein [Shewanella pealeana ATCC 700345]
 gi|157846833|gb|ABV87332.1| SAF domain protein [Shewanella pealeana ATCC 700345]
          Length = 272

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 122/234 (52%), Gaps = 19/234 (8%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPE 73
           + +LV G+ A+ L + + ++T    TE  A   NV+    ++ +G ++    L      +
Sbjct: 10  ILSLVFGVTAVYL-AQNWLKTN-TKTEAVASTSNVMTMVTEVPLGTIIERKHLALTPVAD 67

Query: 74  ENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAA 132
             + +G I D+       E +G +V+  + +G+ +R E++  +G G  L+SL+    RA 
Sbjct: 68  NLIPEGAITDI------TEAEGFVVKHRLYQGEVLRKERITPKGEGSTLASLITPTMRAV 121

Query: 133 TMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDER--VL 190
           T+ ++    V G + P + VD++ + +    K    +VLSN++++AID    +DE   VL
Sbjct: 122 TIRVNDVVGVAGFLLPGNRVDIINIFTTPSLK--TDIVLSNVKILAIDQKASNDENKPVL 179

Query: 191 VGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGK 244
           V +  TLEL+  QA+ L+ A+S   L L LR     NP+ +   ++ D++E  K
Sbjct: 180 VRA-VTLELSLEQAETLMIAKSRGSLQLALR-----NPNDTAVIELADIEEANK 227


>gi|260778163|ref|ZP_05887056.1| flp pilus assembly protein RcpC/CpaB [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260606176|gb|EEX32461.1| flp pilus assembly protein RcpC/CpaB [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 279

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 105/211 (49%), Gaps = 25/211 (11%)

Query: 34  TEEVITENPAK-FINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQ- 91
           +E    E P + F  VL+S  D+ VG V TPN+  W +  EE + D ++D V +      
Sbjct: 28  SEHQTKEQPEQVFQRVLVSGQDIGVGDVYTPNMFRWQSLSEEQLSD-YVDYVTEDEITSI 86

Query: 92  ELDGVLVRVPILKGDPIRLEKLV-DRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPND 150
            L   +  + I +G  I    L+  +G   L+  +  G RA ++ +   +A  G ++P D
Sbjct: 87  NLASGIAHIAIKQGQVIAAADLIPPQGGASLALKVRAGYRAVSVPVDQVTANSGFVQPGD 146

Query: 151 HVDVVMVRS-LSERKP--------TVTVVLSNIRVIAIDHNIDSDE-----------RVL 190
            VD++++ S +SE K          V+ + +N+R++A + N+ S E           ++ 
Sbjct: 147 KVDILLLGSKVSELKKYDNVVEGLYVSTIATNVRILAFN-NLSSSEGFQEKRHDYGAKIP 205

Query: 191 VGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
             S+ +LE+TP QA  +V A  + +L+L LR
Sbjct: 206 DNSSVSLEVTPEQATQIVLANQLGRLTLSLR 236


>gi|292491518|ref|YP_003526957.1| Flp pilus assembly protein CpaB [Nitrosococcus halophilus Nc4]
 gi|291580113|gb|ADE14570.1| Flp pilus assembly protein CpaB [Nitrosococcus halophilus Nc4]
          Length = 265

 Score = 72.8 bits (177), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 99/183 (54%), Gaps = 10/183 (5%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V+++  ++  G  +    L+ +++P +N+ +G     H+ +A   ++G +    I  G+P
Sbjct: 47  VVVAALEIPFGQKIETMHLKVISWPADNMPEGIF---HETSA---VEGRVASQKIYPGEP 100

Query: 108 IRLEKLVDR-GNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL--SERK 164
           I  ++ V++ G   LS+++P+ KRA T+ ++    V G + P + VDV+  R +  S+ K
Sbjct: 101 IMKDRAVEQLGGSTLSAIVPRDKRAVTVRVNDVIGVAGFLLPGNQVDVLSSRKIDRSQNK 160

Query: 165 PTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSI 223
             +  +L N++V+A+D     D+ + LV    TLE  P QA+ L  A     + LVLR+ 
Sbjct: 161 VQIETILQNLKVLAVDQTASQDKNQPLVVRAVTLEADPKQAEKLFKATEEGTIQLVLRNP 220

Query: 224 ADL 226
            D+
Sbjct: 221 QDV 223


>gi|328953762|ref|YP_004371096.1| Flp pilus assembly protein CpaB [Desulfobacca acetoxidans DSM
           11109]
 gi|328454086|gb|AEB09915.1| Flp pilus assembly protein CpaB [Desulfobacca acetoxidans DSM
           11109]
          Length = 272

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 92/175 (52%), Gaps = 12/175 (6%)

Query: 54  DLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL 113
           ++A G V+ P +L+ V  P+E+V      D      ++ L+G + R  I+ G+ I+  +L
Sbjct: 51  NIAPGSVLIPELLKVVQLPKEHVAADAATD------LKALEGRVTRQLIVAGEVIQEHEL 104

Query: 114 VDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK--PTVTVV 170
             +G  GG++ ++   KRA T+ +  +S V G I P + VDV++    +E K  P   +V
Sbjct: 105 APKGAPGGMAGIIGNDKRAVTIKVDEASGVAGFIVPGNRVDVLLSLDRNEFKNDPVTQIV 164

Query: 171 LSNIRVIAIDHNID---SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRS 222
           L N+ V+    +I+   + ER  V  T TLE+TP + + L  A     ++L LR 
Sbjct: 165 LQNLPVLGTGQDIEQQKAGERPKVVPTVTLEVTPEEGERLALAAKEGTITLALRG 219


>gi|163742212|ref|ZP_02149600.1| CpaB family protein [Phaeobacter gallaeciensis 2.10]
 gi|161384542|gb|EDQ08923.1| CpaB family protein [Phaeobacter gallaeciensis 2.10]
          Length = 266

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/191 (29%), Positives = 92/191 (48%), Gaps = 12/191 (6%)

Query: 45  FINVLISKGDLAVGMVVTPNILEWVAFPEENVFDG---FIDDVHQPNAMQELDGVLVRVP 101
            ++V I+   L  G  +T   +  V +PE  + +G    +D +  P    +   VL R+ 
Sbjct: 27  LVDVFIANTQLKYGERLTKEHIRSVRWPENAIPEGAFLTMDALFPPQYPDDHRVVLRRME 86

Query: 102 ILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL 160
             K + I   K+   G + G++S L KG RA  + + +SS V G ++P DHVDV    SL
Sbjct: 87  --KDEAILAVKVTKPGEDAGITSRLSKGMRAFAIRVDVSSGVSGFLRPGDHVDVYWTGSL 144

Query: 161 SERK-----PTVTVVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVA 214
           +++          ++ +NI +IA+D     D +  ++  T T  + P Q  AL  AQS  
Sbjct: 145 NDQNGGRNGEFTRLIQTNIELIAVDQTAGGDLDGAVIARTVTAAVRPEQVAALAQAQSTG 204

Query: 215 KLSLVLRSIAD 225
           +LSL L    D
Sbjct: 205 RLSLSLVGAGD 215


>gi|83312839|ref|YP_423103.1| Flp pilus assembly protein CpaB [Magnetospirillum magneticum AMB-1]
 gi|82947680|dbj|BAE52544.1| Flp pilus assembly protein CpaB [Magnetospirillum magneticum AMB-1]
          Length = 300

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 110/241 (45%), Gaps = 30/241 (12%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEV----ITENPAKFINVLISKGDLAVGMVVTPNILEWV 69
           V AL AG  AM  ++   +  +E       + PA  + +LI   D+  G  +  + L + 
Sbjct: 10  VAALAAGGTAM--LAKSWLDRQEARRAKAADEPAT-VEILIINRDVPSGAALAGDDLRYE 66

Query: 70  AFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEK-LVDRGNGGLSSLLPKG 128
           ++P+  V    +      ++     G++ R P+ +G+P+          +G ++ LL  G
Sbjct: 67  SWPKAAVSPRLVTRKPGEDSKAAFVGMIARRPLAEGEPVSAATTFRPEASGVMAGLLAPG 126

Query: 129 KRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT--------------VVLSNI 174
            RA ++ I+  +AV G + P D VDVV+   + + +  +                VL+++
Sbjct: 127 MRAISIAITNPTAVSGFVTPGDRVDVVLASDIKKSEEGINAEAGSGLLLRYGAETVLADL 186

Query: 175 RVIAIDHNI--DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSE 232
           RV+AID  I    D   + G TATLE+TP QA+ L  A  +  L L LR      P   E
Sbjct: 187 RVLAIDQQITRGRDGAPIQGKTATLEVTPKQAEILTVAGMMGTLQLSLR------PQRGE 240

Query: 233 D 233
           D
Sbjct: 241 D 241


>gi|261252086|ref|ZP_05944659.1| flp pilus assembly protein RcpC/CpaB [Vibrio orientalis CIP 102891]
 gi|260935477|gb|EEX91466.1| flp pilus assembly protein RcpC/CpaB [Vibrio orientalis CIP 102891]
          Length = 247

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 77/152 (50%), Gaps = 7/152 (4%)

Query: 83  DVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSA 141
           D  Q    +EL G +    I  G+ I   +L   G G  L+SL+P+ KRA T+ ++    
Sbjct: 75  DELQFTKAEELVGQVAATTIYPGEIIHPNRLSSSGEGSTLASLIPENKRAVTIRVNDVIG 134

Query: 142 VGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELT 200
           V G + P + VD++      +   + + VL  I+V+A+D    S E + ++    TLE+T
Sbjct: 135 VAGFLLPGNKVDILNTVKYGKNSASTSTVLKEIKVLAVDQTARSKENKPVIVRAVTLEVT 194

Query: 201 PMQAKALVAAQSVAKLSLVLRSIADLNPSSSE 232
           P QA+ L++AQS   + L LR     NP   E
Sbjct: 195 PRQAEKLLSAQSRGNIQLTLR-----NPHEEE 221


>gi|134299960|ref|YP_001113456.1| SAF domain-containing protein [Desulfotomaculum reducens MI-1]
 gi|134052660|gb|ABO50631.1| SAF domain protein [Desulfotomaculum reducens MI-1]
          Length = 234

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 78/143 (54%), Gaps = 6/143 (4%)

Query: 89  AMQELDGVLVRVPILKGDPIRLEKLVDRGN--GGLSSLLPKGKRAATMDISISSAVGGMI 146
           A Q++ G + R  +   +PI L ++    N  G L+ L+P+G+RA T+ +   S V G++
Sbjct: 76  APQDVVGKITRSELYPEEPIMLNRIYKDSNTDGDLALLIPEGQRALTVAVDDVSGVAGLL 135

Query: 147 KPNDHVDVVMVRSLS-ERKPTVTVVLSNIRVIAIDHNIDSD---ERVLVGSTATLELTPM 202
           +P DHVD+++      E+    T++L NI+V+A+  ++D+    E+     T TL + P 
Sbjct: 136 QPGDHVDIIVTFDYEGEQTSLSTLLLQNIQVLAVGQSLDNTPKAEKKTSSQTVTLSVQPG 195

Query: 203 QAKALVAAQSVAKLSLVLRSIAD 225
           QA  L  A     + L+LRS  D
Sbjct: 196 QATPLTLATERGSIRLMLRSPKD 218


>gi|308050060|ref|YP_003913626.1| Flp pilus assembly protein CpaB [Ferrimonas balearica DSM 9799]
 gi|307632250|gb|ADN76552.1| Flp pilus assembly protein CpaB [Ferrimonas balearica DSM 9799]
          Length = 288

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 86/141 (60%), Gaps = 7/141 (4%)

Query: 91  QELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPN 149
           +++ G++ + P+++GD +  +KLV +G G  L+SL+    RA T+ ++    V G + P 
Sbjct: 77  EQVVGMVAKFPLVEGDFLSRQKLVPKGEGSVLASLIAPNMRAVTIRVNDVVGVAGFLLPG 136

Query: 150 DHVDVVMV---RSLSERKPTVTVVLSNIRVIAIDH--NIDSDERVLVGSTATLELTPMQA 204
           + VDV++    R  ++      VVLSN++V+A+D   N DS++ VLV +  TLE+T  QA
Sbjct: 137 NRVDVLVTLAKRRSADETAQTEVVLSNLKVLAVDQRANQDSNQPVLVRAV-TLEVTLEQA 195

Query: 205 KALVAAQSVAKLSLVLRSIAD 225
           + L++A+S   + L LR+  D
Sbjct: 196 EELMSARSRGNIQLALRNPND 216


>gi|116748929|ref|YP_845616.1| SAF domain-containing protein [Syntrophobacter fumaroxidans MPOB]
 gi|116697993|gb|ABK17181.1| SAF domain [Syntrophobacter fumaroxidans MPOB]
          Length = 292

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 100/200 (50%), Gaps = 12/200 (6%)

Query: 32  VQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQ 91
           VQT  V  +     + V ++  DL  G  +T  +++   +P +++  G+  D  +     
Sbjct: 34  VQTTVVTEKAEPGGVQVALASADLPWGTKLTREMVKMAEYPPKHLPAGYFSDPAK----- 88

Query: 92  ELDGVLVRVPILKGDPIRLEKLVDRG--NGGLSSLLPKGKRAATMDISISSAVGGMIKPN 149
            ++G ++  P+ +G+ +   KL       GG+S+++  GKRA  +       + G I+P 
Sbjct: 89  -IEGRVLITPVKQGEQLLESKLAPLSVTTGGVSAVVSVGKRAIAVAGDKVIGLAGFIQPG 147

Query: 150 DHVDV-VMVRSLSERKPTVT-VVLSNIRVIAIDHNIDSDERVLVGST--ATLELTPMQAK 205
           + VDV V +R   E+ P+ + VVL N++V+A    ID       G     TLE+TP +A+
Sbjct: 148 NFVDVLVTIRDTQEKTPSTSKVVLENVKVLATGTVIDKKAGTEPGPVDVFTLEVTPEEAE 207

Query: 206 ALVAAQSVAKLSLVLRSIAD 225
            L  A S+ KL   LR++ D
Sbjct: 208 RLAFAASLGKLHFALRNVTD 227


>gi|255262747|ref|ZP_05342089.1| Flp pilus assembly protein CpaB [Thalassiobium sp. R2A62]
 gi|255105082|gb|EET47756.1| Flp pilus assembly protein CpaB [Thalassiobium sp. R2A62]
          Length = 282

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 99/187 (52%), Gaps = 9/187 (4%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQ--PNAMQELDGVLVRVPIL 103
           +++  +K  L  G ++T   +  + +PE ++  G    + +  PN  ++L  VL   PI 
Sbjct: 48  VDIFAAKNPLVYGQMLTIEDVHHIRYPEASLPPGAFRTIEELFPNGDEKLRVVLR--PIE 105

Query: 104 KGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM--VRSL 160
             + I   K+   G + GL+  L +G RA  + + +SS V G ++P D VDV    V ++
Sbjct: 106 PNEVILPVKVTSPGEDAGLTQRLAQGMRAFAIRVDVSSGVSGFVRPGDRVDVYWSGVANV 165

Query: 161 SERKPTVT-VVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSL 218
            +R+  +T ++ S++++IAID + D ++    +  T T+E++ ++  AL  AQ+   LSL
Sbjct: 166 GQRRQDLTRLIQSSVKIIAIDQSADGNQSEARIARTVTVEVSQVEVAALAQAQATGNLSL 225

Query: 219 VLRSIAD 225
            L    D
Sbjct: 226 ALVGYGD 232


>gi|259417281|ref|ZP_05741200.1| Flp pilus assembly protein CpaB [Silicibacter sp. TrichCH4B]
 gi|259346187|gb|EEW58001.1| Flp pilus assembly protein CpaB [Silicibacter sp. TrichCH4B]
          Length = 267

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 90/184 (48%), Gaps = 9/184 (4%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDG-FIDDVHQPNAMQELDGVLVRVPILK 104
           +NV ++   L  G  +T   +  VA+PE  + +G F ++     +    D   V   + K
Sbjct: 28  VNVFVANKTLTYGEELTKENVRAVAWPENALPEGIFSEESDLFPSDSPKDARYVLRTMEK 87

Query: 105 GDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-----VR 158
            +P+   K+   G + G++S L KG RA  + + ++S V G ++P D VDV        R
Sbjct: 88  NEPLLAVKITAPGEDAGITSRLEKGMRAFAIRVDVASGVSGFLRPGDRVDVYWSGQPPAR 147

Query: 159 SLSERKPTVT-VVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKL 216
           S  ER   VT ++ SNI +IA+D     D    ++  T T++  P +   L  AQS  +L
Sbjct: 148 SGQERSGEVTRLIQSNIELIAVDQMSGGDFSNAIIARTVTVKAQPEEVARLAQAQSTGRL 207

Query: 217 SLVL 220
           SL L
Sbjct: 208 SLAL 211


>gi|197106488|ref|YP_002131865.1| Flp pilus assembly protein CpaB [Phenylobacterium zucineum HLK1]
 gi|196479908|gb|ACG79436.1| Flp pilus assembly protein CpaB [Phenylobacterium zucineum HLK1]
          Length = 310

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 73/252 (28%), Positives = 116/252 (46%), Gaps = 28/252 (11%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M++  ++ +  S V  L A ++A + V P     +       A  + V+++  ++  G  
Sbjct: 1   MRVVTIVSLAASAVLGLGALVVA-KTVLPGAGAAKGAAVVQEAPGVPVVVAAREIKYGDK 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQ---------PNAMQELDGVLVRVPILKGDPIRLE 111
           + P +L  V  P   V  G    V Q         P A+  L     R P+L   P ++ 
Sbjct: 60  LVPGMLTIVNAPAGLVPQGAFQTVDQVLSADKGGPPVALTRL---AAREPVL---PTKIS 113

Query: 112 KLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP----TV 167
               R    +S+ + +G RA T+ +  SS VGG   P D VDVV++R L+   P      
Sbjct: 114 GPGSRPT--VSAEVGEGMRAYTLKVDASSGVGGHALPGDRVDVVLLRDLTPSGPDRNFIS 171

Query: 168 TVVLSNIRVIAIDHNID-SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLR----- 221
            VV+ N RV+ +D N D + E+    STATLE++  +++ L  A ++  LSL LR     
Sbjct: 172 YVVVQNARVLGVDLNADPTSEKPATPSTATLEVSVEESQKLAIAATLGTLSLALRRSGEA 231

Query: 222 SIADLNPSSSED 233
            IAD  P  + D
Sbjct: 232 EIADAGPLRTGD 243


>gi|254477805|ref|ZP_05091191.1| Flp pilus assembly protein CpaB [Ruegeria sp. R11]
 gi|214032048|gb|EEB72883.1| Flp pilus assembly protein CpaB [Ruegeria sp. R11]
          Length = 286

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 95/186 (51%), Gaps = 12/186 (6%)

Query: 45  FINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFI---DDVHQPNAMQELDGVLVRVP 101
            ++V I+   L  G  +TP  +  V +P+  + +G     +++  P A +E   V++R  
Sbjct: 47  LVDVFIANEPLKYGERLTPERVRAVRWPQNAIPEGAFLTAEELFPPQA-EEKPRVVLRT- 104

Query: 102 ILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL 160
           + K + I   K+   G + GL+S L +G RA  + + +SS V G ++P D VDV     +
Sbjct: 105 MEKDEAILAIKVTKPGEDAGLTSRLERGMRAFAIRVDVSSGVSGFLRPGDRVDVYWTGRV 164

Query: 161 ----SERKPTVT-VVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVA 214
               SER    T ++ +NI +IAID +  SD +   +  T T+   P Q  AL  AQS  
Sbjct: 165 DDQTSERSGDFTRLIQANIELIAIDQSAGSDLDGATIARTVTVSARPEQVAALAQAQSTG 224

Query: 215 KLSLVL 220
           +L+L L
Sbjct: 225 RLTLSL 230


>gi|323491531|ref|ZP_08096710.1| Flp pilus assembly protein CpaB [Vibrio brasiliensis LMG 20546]
 gi|323314107|gb|EGA67192.1| Flp pilus assembly protein CpaB [Vibrio brasiliensis LMG 20546]
          Length = 247

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 79/149 (53%), Gaps = 7/149 (4%)

Query: 86  QPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGG 144
           Q  A ++L G +V   +  G+ + + +L ++G G  L+SL+P+ KRA T+ ++    V G
Sbjct: 78  QFTASEDLIGQVVASNVYPGEILHISRLANQGEGSTLASLIPENKRAVTIRVNDVIGVAG 137

Query: 145 MIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQ 203
            + P + VDV+      +       VL  I+V+A+D    + E + ++    TLE++P Q
Sbjct: 138 FLLPGNKVDVLNTIKYGKNSANTVTVLKEIKVLAVDQTARTKENKPIIVRAVTLEVSPRQ 197

Query: 204 AKALVAAQSVAKLSLVLRSIADLNPSSSE 232
           A+ L++AQS   + L LR     NP   E
Sbjct: 198 AEKLLSAQSRGDIQLALR-----NPHEEE 221


>gi|283769331|ref|ZP_06342230.1| Flp pilus assembly protein CpaB [Bulleidia extructa W1219]
 gi|283103988|gb|EFC05372.1| Flp pilus assembly protein CpaB [Bulleidia extructa W1219]
          Length = 228

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 94/187 (50%), Gaps = 16/187 (8%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V ++  ++     +T ++LE+   P   V +G   +        EL G + +V ILK   
Sbjct: 37  VYVASKNIKANQQITEDMLEYKKVPGNLVVEGAAKN------KDELLGKMAKVDILKNSV 90

Query: 108 IRLEKLVDRG----NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER 163
           I  E +   G    NGGL+ ++ KGKRA +  +  S+ +  +++  D VD+++ R+    
Sbjct: 91  ISKENVYKEGEPEKNGGLTYVIAKGKRAISFPVEYSTGISSLLRGGDRVDIILTRAKDSN 150

Query: 164 KPTVTVVLSNIRVIAI--DHNIDSDERVLVG---STATLELTPMQAKALVAAQSVAKLSL 218
             + T +LSN++++A+  D+++  ++    G   ST T+EL+P     L+       LSL
Sbjct: 151 FVSKT-ILSNVKILALGNDYSVGVNKSGSEGKSYSTVTVELSPEDCVKLMNGSKAGTLSL 209

Query: 219 VLRSIAD 225
            LR+  D
Sbjct: 210 SLRTPGD 216


>gi|323702114|ref|ZP_08113782.1| Flp pilus assembly protein CpaB [Desulfotomaculum nigrificans DSM
           574]
 gi|323532996|gb|EGB22867.1| Flp pilus assembly protein CpaB [Desulfotomaculum nigrificans DSM
           574]
          Length = 234

 Score = 69.3 bits (168), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 97/188 (51%), Gaps = 14/188 (7%)

Query: 45  FINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILK 104
           F  V++ K  +    ++T  +++    P E +  G   D       +++ G + R  +  
Sbjct: 38  FKQVVVPKQTIGPNTMLTAQMVKVKDIPVEMIQPGTAMDT------KDVVGKVTRSDLYP 91

Query: 105 GDPIRLEKL-VDR-GNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE 162
            +PI L +L  D+   G L+  +P G+RA T+++   S V GM+KP DHVD+++      
Sbjct: 92  EEPILLSRLHQDKDSTGELALAIPTGQRALTVEVDAVSGVAGMLKPGDHVDILVTFDYEV 151

Query: 163 RKPTVT-VVLSNIRVIAIDHNIDS----DERVLVGSTATLELTPMQAKALVAAQSVAKLS 217
            K T+T ++L NI+V+A+  ++ S    D++V    T TL +TP QA  L       K+ 
Sbjct: 152 EKTTLTSLLLQNIKVLAVGQSLVSAQKGDQKVNT-QTVTLAVTPEQAPPLTLGSERGKIR 210

Query: 218 LVLRSIAD 225
           L+LRS  D
Sbjct: 211 LMLRSPKD 218


>gi|212635454|ref|YP_002311979.1| Flp pilus assembly protein CpaB [Shewanella piezotolerans WP3]
 gi|212556938|gb|ACJ29392.1| Flp pilus assembly protein CpaB [Shewanella piezotolerans WP3]
          Length = 267

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 113/223 (50%), Gaps = 18/223 (8%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNI 65
           L+ +V+S VF + A  +A   +  +    +EVI+        V+    ++ +G ++    
Sbjct: 6   LLFVVLSLVFGVTAVYLAQNWLKSN--TKDEVISTTGT----VITMATEVPLGAILQRKH 59

Query: 66  LEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSL 124
           L     PE  +  G + D      + E +G +V+  +  G+ +R E+L  +G G  L+SL
Sbjct: 60  LSLTTLPESLIPKGAVLD------LAEAEGKVVKQKLYAGEVLRAERLTAKGEGSTLASL 113

Query: 125 LPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNID 184
           +    RA T+ ++    V G + P + VD++ +   S  K    +VLSN++++AID    
Sbjct: 114 ITPTMRAVTIRVNDVVGVAGFLLPGNRVDIINIFKSSGLK--TDIVLSNVKILAIDQRAS 171

Query: 185 SDER--VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           +DE   VLV +  TLEL+  QA+ L+ A+S   L L LR+  D
Sbjct: 172 NDENKPVLVRA-VTLELSLDQAEILMIAKSRGSLQLALRNPND 213


>gi|21673268|ref|NP_661333.1| hypothetical protein CT0429 [Chlorobium tepidum TLS]
 gi|21646356|gb|AAM71675.1| conserved hypothetical protein [Chlorobium tepidum TLS]
          Length = 278

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 79/133 (59%), Gaps = 2/133 (1%)

Query: 95  GVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVD 153
           G +  VP++ G+P+   KL   G  GGLSS++P GKRA ++ ++    V G   P  +VD
Sbjct: 76  GRIALVPMIPGEPVLPGKLAPIGATGGLSSIIPAGKRAISVRVNDVVGVAGFALPGSYVD 135

Query: 154 VVMVRSLSERKPTVTVVLSNIRVIAIDHN-IDSDERVLVGSTATLELTPMQAKALVAAQS 212
           +++       +P   +VLS ++V+A++ + +   ++  V +  TLEL+P +++ L  A++
Sbjct: 136 ILVSGRDVSGQPFSRIVLSKVKVLAVEQDTVAEKDKPKVVNAVTLELSPQESEKLDLARN 195

Query: 213 VAKLSLVLRSIAD 225
           +  LSLVLR+  D
Sbjct: 196 IGALSLVLRNELD 208


>gi|77919344|ref|YP_357159.1| Flp pilus assembly protein CpaB [Pelobacter carbinolicus DSM 2380]
 gi|77545427|gb|ABA88989.1| Flp pilus assembly protein CpaB [Pelobacter carbinolicus DSM 2380]
          Length = 272

 Score = 68.6 bits (166), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 104/227 (45%), Gaps = 17/227 (7%)

Query: 7   MGIVVSGVFALVAGIIAMRLVS---PHHVQTEEVITENPAKFINVLISKGDLAVGMVVTP 63
            G +++   A++ G+IA+ LV+      V  E            ++++  D+ +G  +  
Sbjct: 4   YGTIIALALAVIFGVIAVILVNRWLSSKVSQEATTPRESIAMTEIVVAAADVNIGTRLDQ 63

Query: 64  NILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILK---GDPIRLEKLVDRGNG- 119
            +L    +P+ +V  G  +D+ Q         V+ RV + K   G PI   +L    +G 
Sbjct: 64  TLLAMAQWPKASVPKGAFEDIEQ---------VVGRVSVSKMVTGTPILAAELAAPNSGA 114

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAI 179
           GL +L+  G RA  + ++    VGG I PN  VD++ +   S+R       L  + V+AI
Sbjct: 115 GLVALIKPGMRAMAIKVNEVVGVGGFILPNTFVDIISLDERSKRTKVADTFLHKVEVLAI 174

Query: 180 DHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
                 +E +  V  T TLELTP  A+ LV       + LVLR+  D
Sbjct: 175 AQETFIEEGKPKVVRTVTLELTPEDAEKLVEKTHEGPIQLVLRNPLD 221


>gi|118581114|ref|YP_902364.1| SAF domain-containing protein [Pelobacter propionicus DSM 2379]
 gi|118503824|gb|ABL00307.1| SAF domain protein [Pelobacter propionicus DSM 2379]
          Length = 291

 Score = 68.6 bits (166), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 55/191 (28%), Positives = 96/191 (50%), Gaps = 15/191 (7%)

Query: 44  KFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPIL 103
           K   ++++  D+ VG  +    L+ +A+P  ++  G   D         +D + +R PI 
Sbjct: 40  KGKGIVVASADIPVGSKLNTTHLKMMAWPATSIPPGSFTDTKA-----LIDRISIR-PIG 93

Query: 104 KGDPIRLEKLVDR----GNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVR- 158
            G+P+   KL+ R    G G ++ ++P G RA T+ ++  + V G + P++ VDVV+   
Sbjct: 94  PGEPLTEAKLMPRDGAPGAGIMTYIIPDGHRAVTVAVNEVAGVAGFLSPHNKVDVVLTTI 153

Query: 159 SLSERKPTVT---VVLSNIRVIAIDHNIDS-DERVLVGSTATLELTPMQAKALVAAQSVA 214
                 P  T   +VL N+ ++A     +  D + +V  T T++LTP  A+ LV A S  
Sbjct: 154 PPGSNDPNATISKIVLQNVPILATGQITEQKDGKPVVVPTVTIDLTPEDAEKLVVASSKG 213

Query: 215 KLSLVLRSIAD 225
            L ++LR I D
Sbjct: 214 SLQMLLRGIRD 224


>gi|39936739|ref|NP_949015.1| hypothetical protein RPA3677 [Rhodopseudomonas palustris CGA009]
 gi|192292565|ref|YP_001993170.1| Flp pilus assembly protein CpaB [Rhodopseudomonas palustris TIE-1]
 gi|39650595|emb|CAE29118.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
 gi|192286314|gb|ACF02695.1| Flp pilus assembly protein CpaB [Rhodopseudomonas palustris TIE-1]
          Length = 193

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 57/104 (54%), Gaps = 3/104 (2%)

Query: 43  AKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFID-DVHQPNAMQELDGVLVRVP 101
           A+ + VL++K D+ +G  VTP  L+W  +P       FI  D+H P A  ++ G + R P
Sbjct: 44  AQTVEVLVAKNDIPLGQAVTPGDLQWQTWPAATASSNFIRRDLH-PGATTDIGGSITRAP 102

Query: 102 ILKGDPIRLEKLVDR-GNGGLSSLLPKGKRAATMDISISSAVGG 144
            + G+PIR +KLV   G+  + + +P G RA + + ++     G
Sbjct: 103 FIAGEPIRRQKLVQADGSSSVPAFVPTGMRAISTETALEPGATG 146


>gi|159043679|ref|YP_001532473.1| SAF domain-containing protein [Dinoroseobacter shibae DFL 12]
 gi|157911439|gb|ABV92872.1| SAF domain protein [Dinoroseobacter shibae DFL 12]
          Length = 280

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 106 DPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK 164
           +P+   K+ + G + G+SS L KG RA  + ++++S V G ++P D VDV    S S+ +
Sbjct: 108 EPVLAVKVTEPGQDAGVSSRLGKGMRAFAISVTVTSGVSGFLRPGDRVDVYWSGS-SKGQ 166

Query: 165 PTVTVVLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSI 223
               ++ S++++I ID N D D     +  T T+E TP Q   L  AQ    LSL L   
Sbjct: 167 DVTKLIQSSMQIIGIDQNADMDRTAPTIARTVTVEATPQQVAGLAQAQRTGSLSLSLVGA 226

Query: 224 AD 225
           AD
Sbjct: 227 AD 228


>gi|37680845|ref|NP_935454.1| Flp pilus assembly protein CpaB [Vibrio vulnificus YJ016]
 gi|37199594|dbj|BAC95425.1| Flp pilus assembly protein CpaB [Vibrio vulnificus YJ016]
          Length = 248

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 84/153 (54%), Gaps = 7/153 (4%)

Query: 83  DVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSA 141
           ++ Q    +EL G +V   I  G+ I  ++L   G G  L++L+P+ KRA T+ ++    
Sbjct: 75  ELSQYTDPKELVGQIVAGAIYPGEIIIEQRLTVPGEGSTLAALIPENKRAITIRVNDVIG 134

Query: 142 VGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELT 200
           V G + P + VDV+   S S+   +   VL +I+V+A+D    + E + ++    TLE+T
Sbjct: 135 VAGFLLPGNRVDVLNTVSYSKGSASTKTVLKDIKVLAVDQTARTKENKPIIVRAVTLEVT 194

Query: 201 PMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
           P QA+ L++A+S  ++ L LR     NP   E+
Sbjct: 195 PDQAEKLLSAKSKGEIQLTLR-----NPHEPEE 222


>gi|89899602|ref|YP_522073.1| Flp pilus assembly CpaB [Rhodoferax ferrireducens T118]
 gi|89344339|gb|ABD68542.1| Flp pilus assembly CpaB [Rhodoferax ferrireducens T118]
          Length = 286

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 98/188 (52%), Gaps = 16/188 (8%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
            + ++  D+ +G  ++P ++    +P  +   G   +  +      L+G +V V + +G+
Sbjct: 36  RIAVANTDIELGGRISPEMIRMADWPLGSTPTGAYKEAAK------LEGRVVLVSMQRGE 89

Query: 107 PIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE--- 162
           P+   +L   G  GGLS+++P+GKRA T+ ++    V G   P   VD VMV +  E   
Sbjct: 90  PLIEARLAPIGTKGGLSAVVPQGKRAMTVRVNDVVGVAGFALPGTFVD-VMVNTQDEGGQ 148

Query: 163 ---RKPTVT-VVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLS 217
              R  +V+ +VL  I V+A+    D D  +  V +  TLE+TP  A+ L  A+SV  LS
Sbjct: 149 RNDRDRSVSKIVLERILVLAVAQEADRDSTKPRVVNAVTLEVTPRDAEMLDLARSVGTLS 208

Query: 218 LVLRSIAD 225
           LVLR+  D
Sbjct: 209 LVLRNQTD 216


>gi|260431083|ref|ZP_05785054.1| Flp pilus assembly protein CpaB [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260414911|gb|EEX08170.1| Flp pilus assembly protein CpaB [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 293

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 92/197 (46%), Gaps = 7/197 (3%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKG 105
           + VL++   L  G  +T   +  V +PE  V +G   ++         +   V   + K 
Sbjct: 56  VGVLVANRPLKYGERLTEEDIRVVDWPENAVPEGAFTEMAALFPETGANERFVLRAMEKD 115

Query: 106 DPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS--- 161
           + I   K+   G   GL+S L KG RA  + + ++S V G ++P D VDV    SLS   
Sbjct: 116 EAIMEVKVTKPGELAGLTSRLEKGMRAFAISVDVASGVSGFLRPGDVVDVYWTGSLSGAV 175

Query: 162 --ERKPTVTVVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSL 218
              R     ++ +NI +IA+D +  SD     +  T T+  TP Q  AL  AQ+  +LSL
Sbjct: 176 EGARGEITRLIQTNIELIAVDQSAGSDVTGTTIARTVTVAATPEQVAALAQAQNTGRLSL 235

Query: 219 VLRSIADLNPSSSEDSD 235
            L  + D   +S+ + D
Sbjct: 236 ALVGVHDETVASAIEVD 252


>gi|120602160|ref|YP_966560.1| SAF domain-containing protein [Desulfovibrio vulgaris DP4]
 gi|120562389|gb|ABM28133.1| SAF domain [Desulfovibrio vulgaris DP4]
          Length = 272

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 117/244 (47%), Gaps = 18/244 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+ T ++ ++ + V ALVAGI+  R V  + V  +   T+ P   + +++S  D+  G  
Sbjct: 1   MRRTAVIQVIAALVLALVAGILVFRFVQVNRVAQQ---TQQPPGVV-LVVSAVDMEKGAK 56

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV--DRGN 118
           +  + L+   F   +   G   D       + L G ++  P+  G+ I   +L+  D  +
Sbjct: 57  IRADQLKTSTFLSASAPPGGFTDA------KSLVGRVLATPVTTGEVITETRLLPADATS 110

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV---RSLSERKPTVTVVLSNIR 175
           GG+S+++  G RA  +  +    + G I+P + VD+++     +  + K    V+L+ I+
Sbjct: 111 GGVSTMIAPGMRAVAVKGNKVMGLAGFIRPGNRVDIMVTIDDETREKAKARTKVILAGIK 170

Query: 176 VIAIDHNIDSDERVLVGS---TATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSE 232
           V+A    +  +      S     TLE+TP QA+ L  A S  +L   LR+ AD  P  + 
Sbjct: 171 VLATGTELRQEGDDTATSPVEVYTLEVTPEQAELLSLAASRGELHFALRNPADDLPVRTA 230

Query: 233 DSDV 236
            +DV
Sbjct: 231 GTDV 234


>gi|323499922|ref|ZP_08104881.1| Flp pilus assembly protein CpaB [Vibrio sinaloensis DSM 21326]
 gi|323315163|gb|EGA68215.1| Flp pilus assembly protein CpaB [Vibrio sinaloensis DSM 21326]
          Length = 247

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 76/149 (51%), Gaps = 7/149 (4%)

Query: 86  QPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGG 144
           Q    +EL G +V   I +G+ +   +L   G G  L+SL+P+ KRA T+ ++    V G
Sbjct: 78  QFTKAEELIGQVVATTIYQGEVVHQNRLAAPGEGSTLASLIPENKRAVTIRVNDVIGVAG 137

Query: 145 MIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQ 203
            + P + VDV+     S        VL +I+V+A+D    + E + ++    TLE++P  
Sbjct: 138 FLLPGNRVDVLNTIKYSSTYANTVTVLKDIKVLAVDQTARTKENKPIIVRAVTLEVSPKD 197

Query: 204 AKALVAAQSVAKLSLVLRSIADLNPSSSE 232
           A+ L+ A+S  ++ L LR     NP   E
Sbjct: 198 AEKLLTARSKGEIQLTLR-----NPHEEE 221


>gi|83954513|ref|ZP_00963224.1| CpaB family protein [Sulfitobacter sp. NAS-14.1]
 gi|83840797|gb|EAP79968.1| CpaB family protein [Sulfitobacter sp. NAS-14.1]
          Length = 287

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 93/186 (50%), Gaps = 13/186 (6%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDG-FIDDVHQ-PNAMQELDGVLVRVPIL 103
           + V ++ G L  G  +T   +  V +PE+ + +G FI++    P    +L  VL    + 
Sbjct: 48  VGVYVANGPLKYGQRLTREDVRQVKWPEDAIPEGTFIEEAALFPENSDDLRVVLR--AME 105

Query: 104 KGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV----R 158
           K + I   K+ + G + GL+S L +G RA  + + +SS V G ++P D VDV       R
Sbjct: 106 KDEAIMAAKVTEPGADTGLTSQLERGSRAFAIRVDVSSGVSGFLRPGDRVDVYWTGRINR 165

Query: 159 SLSERKPT---VTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVA 214
             ++R  T     ++ + +++IAID +   +     + +T T+ + P Q  AL  AQS  
Sbjct: 166 GGNDRADTGDVTKLIEAGVKIIAIDQSAGGERSEAAIANTVTVAVQPYQVAALAQAQSTG 225

Query: 215 KLSLVL 220
            LSL L
Sbjct: 226 DLSLSL 231


>gi|225181998|ref|ZP_03735430.1| Flp pilus assembly protein CpaB [Dethiobacter alkaliphilus AHT 1]
 gi|225167283|gb|EEG76102.1| Flp pilus assembly protein CpaB [Dethiobacter alkaliphilus AHT 1]
          Length = 229

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 101/202 (50%), Gaps = 11/202 (5%)

Query: 30  HHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNA 89
           H++   E  +++ A    +L+++ ++     ++ ++      P++ +    I +      
Sbjct: 23  HYLNEMERQSKSAANLTTILVAREEIPARTRLSASMFTTAEVPQDAIHGDAIRET----- 77

Query: 90  MQELDGVLVRVPILKGDPIRLEKLV-DRGNGGLSSLLPKGKRAATMDISISSAVGGMIKP 148
             ELDG   R  ++ G+ +   +LV ++   GLS  +  G RA T+ ++  S V G I P
Sbjct: 78  -SELDGAYARERLVAGEQVLSARLVFEQSETGLSYKVSDGHRAVTVPVNNVSGVAGYILP 136

Query: 149 NDHVDVVMVRSLSERKPTVT-VVLSNIRVIAI-DHNIDSDERVLVGSTATLELTPMQA-K 205
            D+VD ++    +E + TVT VV S I+V+A   + ++ D   L+  T TL+ TP  A  
Sbjct: 137 GDYVDAIVTIESTEDEDTVTKVVESKIKVLASGQYTVEQDREQLIVETVTLD-TPADAVT 195

Query: 206 ALVAAQSVAKLSLVLRSIADLN 227
           A++ A     L LVLR + + N
Sbjct: 196 AIIQASERGSLRLVLRPVEESN 217


>gi|27365105|ref|NP_760633.1| Flp pilus assembly protein CpaB [Vibrio vulnificus CMCP6]
 gi|27361251|gb|AAO10160.1| Flp pilus assembly protein CpaB [Vibrio vulnificus CMCP6]
          Length = 248

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 83/153 (54%), Gaps = 7/153 (4%)

Query: 83  DVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSA 141
           ++ Q    +EL G +V   I  G+ I  ++L   G G  L++L+P+ KRA T+ ++    
Sbjct: 75  ELSQYTDPKELVGQIVAGAIYPGEIIIEQRLTVPGEGSTLAALIPENKRAITIRVNDVIG 134

Query: 142 VGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELT 200
           V G + P + VDV+   S S+       VL +I+V+A+D    + E + ++    TLE+T
Sbjct: 135 VAGFLLPGNRVDVLNTVSYSKGSAVTKTVLKDIKVLAVDQTARTKENKPIIVRAVTLEVT 194

Query: 201 PMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
           P QA+ L++A+S  ++ L LR     NP   E+
Sbjct: 195 PDQAEKLLSAKSKGEIQLTLR-----NPHEPEE 222


>gi|320155488|ref|YP_004187867.1| flp pilus assembly protein RcpC/CpaB [Vibrio vulnificus MO6-24/O]
 gi|319930800|gb|ADV85664.1| flp pilus assembly protein RcpC/CpaB [Vibrio vulnificus MO6-24/O]
          Length = 248

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 83/153 (54%), Gaps = 7/153 (4%)

Query: 83  DVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSA 141
           ++ Q    +EL G +V   I  G+ I  ++L   G G  L++L+P+ KRA T+ ++    
Sbjct: 75  ELSQYTDPKELVGQIVAGAIYPGEIIIEQRLTVPGEGSTLAALIPENKRAITIRVNDVIG 134

Query: 142 VGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELT 200
           V G + P + VDV+   S S+       VL +I+V+A+D    + E + ++    TLE+T
Sbjct: 135 VAGFLLPGNRVDVLNTISYSKGSAVTKTVLKDIKVLAVDQTARTKENKPIIVRAVTLEVT 194

Query: 201 PMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
           P QA+ L++A+S  ++ L LR     NP   E+
Sbjct: 195 PDQAEKLLSAKSKGEIQLTLR-----NPHEPEE 222


>gi|220922531|ref|YP_002497833.1| Flp pilus assembly protein CpaB [Methylobacterium nodulans ORS
           2060]
 gi|219947138|gb|ACL57530.1| Flp pilus assembly protein CpaB [Methylobacterium nodulans ORS
           2060]
          Length = 307

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 60/103 (58%), Gaps = 3/103 (2%)

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVR--SLSERKPTVTVVLSNIRVIA 178
           LS+L+ +G RA  + +     V G I PND VDVV+ R     E K    ++L N++V+A
Sbjct: 114 LSTLIEEGMRAVAVRVDDVRGVAGFILPNDRVDVVLTRDEEARESKGFADILLQNVKVLA 173

Query: 179 IDH-NIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVL 220
           ID    D  ++  V    TLEL P+QA+ ++ AQ V +LSL+L
Sbjct: 174 IDQLANDHADKPTVARAVTLELNPVQAQKIILAQGVGRLSLIL 216


>gi|323700358|ref|ZP_08112270.1| Flp pilus assembly protein CpaB [Desulfovibrio sp. ND132]
 gi|323460290|gb|EGB16155.1| Flp pilus assembly protein CpaB [Desulfovibrio desulfuricans ND132]
          Length = 273

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 114/231 (49%), Gaps = 16/231 (6%)

Query: 2   KLTR-LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           K TR L+ I +S   A++AG+I  +  +      +   T      + V+++K DL  G+ 
Sbjct: 3   KSTRALVQITLSLFLAVIAGVIIFKWTNGVK---QAAPTAVVENTVPVVVAKTDLGRGVK 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG--N 118
           +T ++LE   F +++   G   +V Q      ++G ++   +  GD +   KL D+    
Sbjct: 60  LTEDMLEIRKFTQDSRPSGAFAEVKQ------VEGRVLNQTVGMGDALTPLKLADKSIMG 113

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE-RKPTVTVVLSNIRVI 177
           GG+S+L+  GKRA  +  +    + G ++P D VDV++  ++    KP   +VL  I+VI
Sbjct: 114 GGVSALITPGKRAMAVKGNEVMGLSGFVRPGDRVDVIVSLTVGRNEKPVTKLVLEQIKVI 173

Query: 178 AIDHNI---DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           A    +   + + +V      TLELTP +++ L  A +   L   LR+  D
Sbjct: 174 ATGTQLTPPNEEGKVASVGVYTLELTPAESERLALASTQGTLHFALRNEQD 224


>gi|294012432|ref|YP_003545892.1| Flp pilus assembly protein CpaB [Sphingobium japonicum UT26S]
 gi|292675762|dbj|BAI97280.1| Flp pilus assembly protein CpaB [Sphingobium japonicum UT26S]
          Length = 338

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 104/191 (54%), Gaps = 15/191 (7%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGF-IDDVHQPNAMQELDGVLVRVPILKG 105
           +VL++   L VG ++      +  +P++ V   + I     P   Q+L G ++R  I  G
Sbjct: 48  HVLVATKALPVGTILDAESFRFQPWPKDLVEQAYYIKGQADP---QKLVGSVIRTAISAG 104

Query: 106 DPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS--- 161
            P+ L  ++  G  G L++ L  G RA T+ +S  ++V G + P D VD+V+ +S+S   
Sbjct: 105 QPMTLGSVIKPGERGFLAAALGPGMRAVTVPVSAQNSVAGFVFPGDRVDLVLTQSVSGGG 164

Query: 162 ERKP--TVTVVLSNIRVIAIDHNIDS---DERVLVG--STATLELTPMQAKALVAAQSVA 214
           E +P      +L N+RV+A D  +D+   D + +V   S  T+E+TP  A+ +  AQ++ 
Sbjct: 165 EGEPLKVSETILRNLRVLATDQRMDALGDDGKPVVQTYSNVTIEVTPKIAEKIAVAQTIG 224

Query: 215 KLSLVLRSIAD 225
            LSL LRS+AD
Sbjct: 225 SLSLSLRSLAD 235


>gi|90406751|ref|ZP_01214944.1| Flp pilus assembly protein CpaB [Psychromonas sp. CNPT3]
 gi|90312204|gb|EAS40296.1| Flp pilus assembly protein CpaB [Psychromonas sp. CNPT3]
          Length = 286

 Score = 66.6 bits (161), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 125/274 (45%), Gaps = 39/274 (14%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIA--MRLVSPHHVQTEEVITENPAKFINVLISKGDLAVG 58
           M   RLM      VF  + G++   M + SP    T   + +   K + +L+S  ++  G
Sbjct: 1   MTAKRLMYF---SVFISLIGLLGLFMSVSSP----TAPALIKEENKTLTILVSSQEIKSG 53

Query: 59  MVVTPNILEWVAFPEENVFDG--FIDDVHQPNAMQELDGVLVRVP----ILKGDPIRLEK 112
            + + +I  W   PE ++ +   +I  +   N   +   V   +P    + + D + LE 
Sbjct: 54  RLYSASIFAWKKVPESDLAEQIDYIQKIDFNNKAYKKSIVTGDLPAGHIMSQSDFLTLED 113

Query: 113 LVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE---------R 163
                   LS LL  G RA ++ +   +A  G+I+P DHVDV+++ S  +         R
Sbjct: 114 -----GAFLSVLLRPGYRAVSVGVDHITANSGLIRPGDHVDVLLLASKEKELRSTGNETR 168

Query: 164 KPTVTVVLSNIRVIAIDHNIDSDER----------VLVGSTATLELTPMQAKALVAAQSV 213
              V  ++ N+RV+A++  +  D            +   S  TLE+ P QA  ++ A  +
Sbjct: 169 SLYVKTIVQNVRVLALNDALQIDRYQEEKKRNKGMLPEKSAVTLEVLPAQANTVILANQL 228

Query: 214 AKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQ 247
             LS++LR+ +D +  ++   D+ D+  E K++Q
Sbjct: 229 GTLSMLLRNSSDNSILANTQVDIGDIFPEIKQVQ 262


>gi|303248301|ref|ZP_07334563.1| Flp pilus assembly protein CpaB [Desulfovibrio fructosovorans JJ]
 gi|302490326|gb|EFL50238.1| Flp pilus assembly protein CpaB [Desulfovibrio fructosovorans JJ]
          Length = 304

 Score = 66.6 bits (161), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 113/239 (47%), Gaps = 24/239 (10%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVS----PHHVQTEEVITENPAKFINVLISKGDLA 56
           MK   +  ++++ + A+ AG++ +R +     P   Q  +V     AK ++VL++   + 
Sbjct: 1   MKSKAIPHMILAVILAVAAGVLTIRWLGSVRGPGQAQRPKVE----AKKVDVLVAARAIP 56

Query: 57  VGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR 116
            G  +   +L    +  E V  G +       A+ E +G +    I K DPI  +KL+ +
Sbjct: 57  KGARLDAAMLRLKPYEAEAVPGGAL------RAVAEAEGRVAARDISKDDPITPDKLMAK 110

Query: 117 G--NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV--RSLSERKPTVTVVLS 172
           G   GGL + +  GKRA T+  +     GG++ P   VDVV+   R   + +    V+L 
Sbjct: 111 GVTRGGLDAAVAPGKRAVTVKGTKVMGSGGLVTPGSRVDVVVTYSRPGKQEEKVSKVILE 170

Query: 173 NIRVIA----IDHNIDSDERVLVGSTA--TLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           NI V+A    ++  I  D R  + ST   TL +TP +A+ L  A  +  + + LR   D
Sbjct: 171 NIPVLATGTELEPRIGKDGREELASTDSFTLMVTPEEAERLALAADLGSMHMALRKPGD 229


>gi|114764945|ref|ZP_01444118.1| CpaB family protein [Pelagibaca bermudensis HTCC2601]
 gi|114542657|gb|EAU45681.1| CpaB family protein [Roseovarius sp. HTCC2601]
          Length = 286

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 89/192 (46%), Gaps = 34/192 (17%)

Query: 55  LAVGMVVTPNILEWVAFPEENVFDGFIDDVHQP------------NAMQELDGVL-VRVP 101
           +A G ++TP+ ++   +P E + +G   +  +P            NAM + D VL  RV 
Sbjct: 57  IARGEILTPDAVKLAPWPMEIMPEGIFTE-KRPLFVEGDAPRVVVNAMDKFDAVLDGRVS 115

Query: 102 ILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS 161
              GD             GL+S L +G+RA  + + +++ V G ++P D VDV     + 
Sbjct: 116 EPGGD------------AGLTSRLERGERAFAIKVDVATGVSGFLRPGDRVDVYWTGRVP 163

Query: 162 ERKPTV------TVVLSNIRVIAIDHNIDSDER--VLVGSTATLELTPMQAKALVAAQSV 213
              P +       ++ + IR+IA+D   +S+      +  T T+ +TP Q   L  AQS 
Sbjct: 164 GNDPNLPQGDVTKLIETGIRLIAVDQTAESETANPTTIARTVTVAITPQQVAGLAQAQST 223

Query: 214 AKLSLVLRSIAD 225
            +LSL L +  D
Sbjct: 224 GRLSLSLMAAND 235


>gi|294139869|ref|YP_003555847.1| Flp pilus assembly protein CpaB [Shewanella violacea DSS12]
 gi|293326338|dbj|BAJ01069.1| Flp pilus assembly protein CpaB, putative [Shewanella violacea
           DSS12]
          Length = 288

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 130/276 (47%), Gaps = 41/276 (14%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLV--SPH---HVQTEEVITENPAKFINVLISKGDL 55
           M + RLM      VF  +AG+I + L   +P    +++TE V  E       +L++K  +
Sbjct: 1   MTVKRLMYF---SVFISLAGLIGLYLSISAPQKQINIKTENVRHE-------ILVAKQLI 50

Query: 56  AVGMVVTPNILEWVAFPEENVFDGFID--DVHQPNAMQELDGVLVRVPILKGDPIRLEKL 113
             G   + ++ EW A  E+ +    +D  D  + + ++  D VLV      G  + L   
Sbjct: 51  KSGQRFSASLFEWQALNEDQL-TNLVDYIDRDKFDILKFNDSVLVS-SFTAGHIMSLSDF 108

Query: 114 VDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT------ 166
           +    GG LS  L  G RA ++ +   +A  G++ P D VDV+++ S  +   T      
Sbjct: 109 LKPEEGGFLSVSLRPGYRAVSVPVDQVTANSGLVGPGDFVDVLLLASQEQELRTRGNDTQ 168

Query: 167 ---VTVVLSNIRVIAIDHNIDSDERVLV----------GSTATLELTPMQAKALVAAQSV 213
              V  +  N+RV+A +H +  ++ +             S  TLE+ P QA  ++ A  +
Sbjct: 169 SLYVKTIARNVRVLAFNHAVKVEQYIAAQKEYKGFIPDDSAVTLEVLPKQANRIILANQL 228

Query: 214 AKLSLVLRSIAD-LNPSSSEDS-DVWDVQEEGKEIQ 247
             L+LVLRS  D ++ ++S+D  ++ D+  + K +Q
Sbjct: 229 GILTLVLRSNNDSVDEANSQDQINIADIFPDIKRVQ 264


>gi|307293449|ref|ZP_07573295.1| Flp pilus assembly protein CpaB [Sphingobium chlorophenolicum L-1]
 gi|306881515|gb|EFN12731.1| Flp pilus assembly protein CpaB [Sphingobium chlorophenolicum L-1]
          Length = 338

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 102/190 (53%), Gaps = 13/190 (6%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
           +VL++   L VG ++      +  +P+E V   +   +   +  Q+L G ++R  I  G 
Sbjct: 48  HVLVATKALPVGTILDAESFRFQPWPKELVEQAYY--LKGQSDPQKLVGSVIRTAISAGQ 105

Query: 107 PIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS---- 161
           P+ L  ++  G  G L++ L  G RA T+ +S  ++V G + P D VD+++ +S+S    
Sbjct: 106 PMTLGSVIKPGERGFLAAALGPGMRAVTVPVSAQNSVAGFVFPGDRVDLMLTQSVSGGGD 165

Query: 162 -ERKPTVTVVLSNIRVIAIDHNIDS---DERVLVG--STATLELTPMQAKALVAAQSVAK 215
            E       +L N+RV+A D  +D+   D + +V   S  T+E+TP  A+ +  AQ++  
Sbjct: 166 GEPLKVSETILRNLRVLATDQRMDALGDDGKPVVQTYSNVTIEVTPKIAEKIAVAQTIGS 225

Query: 216 LSLVLRSIAD 225
           LSL LRS+AD
Sbjct: 226 LSLSLRSLAD 235


>gi|46580523|ref|YP_011331.1| hypothetical protein DVU2118 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46449942|gb|AAS96591.1| conserved hypothetical protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311234262|gb|ADP87116.1| Flp pilus assembly protein CpaB [Desulfovibrio vulgaris RCH1]
          Length = 272

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 117/244 (47%), Gaps = 18/244 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+ T ++ ++ + V ALVAG++  R V  + V  +   T+ P   + ++++  D+  G  
Sbjct: 1   MRRTAVIQVIAALVLALVAGVLVFRFVQVNRVAQQ---TQQPPGVV-LVVAAVDMEKGAK 56

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV--DRGN 118
           +  + L+   F   +   G   D       + L G ++  P+  G+ I   +L+  D  +
Sbjct: 57  IRADQLKTSTFLSASAPPGGFTDA------KSLVGRVLATPVTTGEVITETRLLPADATS 110

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV---RSLSERKPTVTVVLSNIR 175
           GG+S+++  G RA  +  +    + G I+P + VD+++     +  + K    V+L+ I+
Sbjct: 111 GGVSTMIAPGMRAVAVKGNKVMGLAGFIRPGNRVDIMVTIDDETREKAKARTKVILAGIK 170

Query: 176 VIAIDHNIDSDERVLVGS---TATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSE 232
           V+A    +  +      S     TLE+TP QA+ L  A S  +L   LR+ AD  P  + 
Sbjct: 171 VLATGTELRQEGDDTATSPVEVYTLEVTPEQAELLSLAASRGELHFALRNPADDLPVRTA 230

Query: 233 DSDV 236
            +DV
Sbjct: 231 GTDV 234


>gi|227819322|ref|YP_002823293.1| CpaB pilus assembly protein [Sinorhizobium fredii NGR234]
 gi|227338321|gb|ACP22540.1| CpaB pilus assembly protein [Sinorhizobium fredii NGR234]
          Length = 352

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 102/221 (46%), Gaps = 40/221 (18%)

Query: 25  RLVSPHHVQTEE---VITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFI 81
           RLVS +  + EE   V+   P +F            G  V    L+ + +P E   +G  
Sbjct: 53  RLVSANAPKAEERTLVVAAKPMRF------------GDRVRSENLKAIPWPSEERPEGSF 100

Query: 82  --------DDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAA 132
                   DD     AM+ +D          G+P+   K+   G    LS+ L +G +A 
Sbjct: 101 QTLEAVLGDDTEPRYAMEAID---------PGEPVLTSKITGTGERATLSAALDQGMKAV 151

Query: 133 TMDISISSAVGGMIKPNDHVDVVMVRSLSER----KPTVTVVLSNIRVIAIDHNID--SD 186
           ++ ++    V G ++P+D VDV++ R + ++    +  V V+L  ++V+A+D   D   D
Sbjct: 152 SIRVNDVLGVAGFVRPSDRVDVLLTRVVRQQNNSEQTYVDVLLQGVKVLAVDQTADERKD 211

Query: 187 ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLN 227
           E  +V  T T E+T  +A+ L    S+  LSL LR+IA  N
Sbjct: 212 EPSIV-KTVTFEVTTDEAQRLTLGASIGTLSLTLRNIASSN 251


>gi|319788662|ref|YP_004148137.1| Flp pilus assembly protein CpaB [Pseudoxanthomonas suwonensis 11-1]
 gi|317467174|gb|ADV28906.1| Flp pilus assembly protein CpaB [Pseudoxanthomonas suwonensis 11-1]
          Length = 274

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 106/239 (44%), Gaps = 28/239 (11%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTE-EVITENPAKFINVLISKGDLAVGMVVTPN 64
            + I ++   AL+A  +A+     ++VQT     T++    + V +   D+  G ++ P 
Sbjct: 10  FLYIAIAVGMALLAAFVAV-----NYVQTTVAERTQDNRPMVEVAVPMDDMPQGAILQPG 64

Query: 65  ILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSL 124
            L     P E        D   P    + +G ++R P+  G P+    LV   +   S L
Sbjct: 65  DLALRRIPAEYA----PADAVTPENHGQFEGRMLRSPVRGGAPLSASALVPLYDQ-FSRL 119

Query: 125 LPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT-----VVLSNIRVIAI 179
           +P+GK A T+ +  ++++ GMI P D +D++ ++   E     T      +L  +RV+A 
Sbjct: 120 IPRGKVAYTLSVDENNSISGMIAPGDLIDILFLKDKDESSGARTGALALPLLQQVRVLAT 179

Query: 180 DHNIDSDERVLVG----------STATLELTPMQAKALVAAQSVAKLSLVLRSIADLNP 228
              I   ERV             S+ TLEL   QAK L  A     L ++LR + D +P
Sbjct: 180 GTRI--GERVAPDGRPADDGQGFSSVTLELDHGQAKTLAVASEAGSLRVLLRELEDDSP 236


>gi|163733543|ref|ZP_02140986.1| pilus assembly domain protein [Roseobacter litoralis Och 149]
 gi|161393331|gb|EDQ17657.1| pilus assembly domain protein [Roseobacter litoralis Och 149]
          Length = 276

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 85/184 (46%), Gaps = 8/184 (4%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVH--QPNAMQELDGVLVRVPILKG 105
           V ++   L  G  + P  +  V +P   + DG   D+    P    E    L+  P+   
Sbjct: 44  VFVATRHLRYGDTLNPEDVRAVNWPTNAIPDGIFTDIAVLFPEGTDEPR--LIIRPMEPN 101

Query: 106 DPIRLEKLVDRGNG-GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM---VRSLS 161
           + +   K+ + G   GL++ L KG RA  + + +++ V G ++P D VDV     V++ +
Sbjct: 102 EALLAVKITEPGEDIGLTTRLEKGMRAFAIRVDVATGVSGFLRPGDKVDVYWTGGVQTSN 161

Query: 162 ERKPTVTVVLSNIRVIAIDHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
            R+    ++ S +R+IA+D   D      +  T T+  +P Q  AL  AQS   LSL L 
Sbjct: 162 GREDVTKLIQSAVRLIAVDQTEDQMNGARIARTVTVAASPEQVAALAQAQSTGNLSLSLV 221

Query: 222 SIAD 225
              D
Sbjct: 222 GAGD 225


>gi|300856049|ref|YP_003781033.1| putative cell wall-binding protein [Clostridium ljungdahlii DSM
           13528]
 gi|300436164|gb|ADK15931.1| putative cell wall binding protein [Clostridium ljungdahlii DSM
           13528]
          Length = 321

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 93/201 (46%), Gaps = 24/201 (11%)

Query: 43  AKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPI 102
           AK   +L++   ++ G ++   +++ +  P   +FD +I D  +      + G      I
Sbjct: 37  AKKTTILVAAETISPGTLIDKKMIKKIQVPYNPIFDNYIKDSSK------IAGKYTTETI 90

Query: 103 LKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE 162
            K +   ++KL+++G   L+  +    RA ++ ++  S V G++KP D+VD+++  S   
Sbjct: 91  SKNEGFHIDKLLEKGGDELNLKIDNDYRAISISVTGDSGVSGLLKPKDYVDIIVYTSEKR 150

Query: 163 ------RKPTVTVVLSNIRVIAIDHNIDSDERVLVGSTA------------TLELTPMQA 204
                 R     +VL NI+V+A+D  I  D +    + +            TL +     
Sbjct: 151 DGIKVVRPDEAKIVLQNIQVLAVDKQISRDNKESNSNKSSDNGKAPTNFLVTLSVKVSDL 210

Query: 205 KALVAAQSVAKLSLVLRSIAD 225
           + +V AQS+  + L LR + D
Sbjct: 211 EKVVLAQSIGSIKLALRPLKD 231


>gi|302037440|ref|YP_003797762.1| pilus assembly protein CpaB [Candidatus Nitrospira defluvii]
 gi|300605504|emb|CBK41837.1| Pilus assembly protein CpaB (modular protein) [Candidatus
           Nitrospira defluvii]
          Length = 403

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 98/206 (47%), Gaps = 26/206 (12%)

Query: 40  ENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVR 99
           E  ++ I + ++  DLA G V+  + +  V FP + V +G         + + L G +V 
Sbjct: 41  EAKSRTIPIAVAAADLAWGAVLADDAVRMVPFPADTVPEGHF------ASAETLKGRVVI 94

Query: 100 VPILKGDPIRLEKLVDRG--NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV 157
           + + + +PI   KL      +GG++++    KRA  + +    AVGG IKP D VDV+  
Sbjct: 95  MDVKQHEPILESKLAPATVTSGGVAAVTHPEKRAVAVKVDDVVAVGGFIKPGDRVDVLTT 154

Query: 158 --RSLSERKPTVTVVLSNIRVIAIDHNID-----------SDERVLVGSTATLELTPMQA 204
             R      P   VVL N+RV+A+  + +            + ++ V S  TLE+ P +A
Sbjct: 155 VRRPGKTDDPVTKVVLENVRVLAMGQDTERAAQTDKAAKNQETKLSVPSVMTLEVAPDEA 214

Query: 205 KALVAAQSVAKLSLVLRSIADLNPSS 230
           + L  A +  K+ L LR     NP S
Sbjct: 215 EKLALASTEGKVQLALR-----NPQS 235


>gi|83943940|ref|ZP_00956397.1| CpaB family protein [Sulfitobacter sp. EE-36]
 gi|83845187|gb|EAP83067.1| CpaB family protein [Sulfitobacter sp. EE-36]
          Length = 287

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 92/186 (49%), Gaps = 13/186 (6%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDG-FIDDVHQ-PNAMQELDGVLVRVPIL 103
           + V ++ G L  G  +T   +  V +PE  + +G FI++    P    +L  VL    + 
Sbjct: 48  VGVYVANGPLKYGQRLTREDVRQVNWPENAIPEGTFIEEAALFPENSDDLRVVLR--AME 105

Query: 104 KGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV----R 158
           K + I   K+ + G + GL+S L +G RA  + + +SS V G ++P D VDV       R
Sbjct: 106 KDEAIMAVKVTEPGADTGLTSQLERGSRAFAIRVDVSSGVSGFLRPGDRVDVYWTGRINR 165

Query: 159 SLSERKPT---VTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVA 214
             ++R  T     ++ + +++IAID +   +     + +T T+ + P Q  AL  AQS  
Sbjct: 166 GGNDRADTGDVTKLIEAGVKIIAIDQSAGGERSEAAIANTVTVAVQPYQVAALAQAQSTG 225

Query: 215 KLSLVL 220
            LSL L
Sbjct: 226 DLSLSL 231


>gi|78062907|ref|YP_372815.1| Flp pilus assembly CpaB [Burkholderia sp. 383]
 gi|77970792|gb|ABB12171.1| Flp pilus assembly CpaB [Burkholderia sp. 383]
          Length = 342

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 95/205 (46%), Gaps = 20/205 (9%)

Query: 34  TEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDG-FIDDVHQPNAMQE 92
           T  V TE       V ++  DL  G+++  N L W   P   V  G F++   QP A  +
Sbjct: 30  TPSVATET--DQARVRVAAADLPEGLLLRDNDLAWKRMPRAQVPAGAFVE--SQPGA--D 83

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDH 151
           L G L+R  +  G PIR+E ++  G    L++ L  G RA ++ +   S   G+I+P D 
Sbjct: 84  LKGALLRNHVGAGAPIRVENVIPAGAPDFLAAALQPGMRAISVPVDDVSGNAGLIQPGDF 143

Query: 152 VDVVMVRSL--SERKP---TVTVVLSNIRVIAIDHNID-------SDERVLVGSTATLEL 199
           VDV++ + +  S   P       V+   RV+A+            + +      T TLE+
Sbjct: 144 VDVLLTQQIGGSATSPGTFEAETVVRRARVLAVGSEFQRAKAPASAPDATARARTVTLEV 203

Query: 200 TPMQAKALVAAQSVAKLSLVLRSIA 224
            P  A+ ++ A  +  LSL LRS A
Sbjct: 204 APRTAQVVLVATRLGSLSLALRSFA 228


>gi|99082185|ref|YP_614339.1| Flp pilus assembly CpaB [Ruegeria sp. TM1040]
 gi|99038465|gb|ABF65077.1| pilus assembly protein [Ruegeria sp. TM1040]
          Length = 287

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 104/227 (45%), Gaps = 13/227 (5%)

Query: 7   MGIVVSGVFALVAGIIAM---RLVSPHHVQTEEVITENPA-KFINVLISKGDLAVGMVVT 62
            G+V+    AL  G + M    + +  H   +E    + A   +NV ++   L  G  +T
Sbjct: 5   FGLVLIVGVALAGGAVMMAKNYIEAYQHALAQERSNRDAAVPTVNVFVANKTLTYGEELT 64

Query: 63  PNILEWVAFPEENVFDG-FIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGG 120
              +  VA+PE  + +G F ++     +    D   V   + K +P+   K+   G + G
Sbjct: 65  KESVRSVAWPENALPEGVFHEEAELFPSDSPKDARFVLRTMEKNEPLLAVKVTAPGEDAG 124

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-----VRSLSERKPTVT-VVLSNI 174
           ++S L KG RA  + + ++S V G ++P D VDV        R   E    VT ++ SNI
Sbjct: 125 ITSRLEKGMRAFAIRVDVASGVSGFLRPGDRVDVYWSGQPPARGGQELGGEVTRLIQSNI 184

Query: 175 RVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVL 220
            +IA+D     D    ++  T T++  P +   L  AQ+  +LSL L
Sbjct: 185 ELIAVDQMSGGDFSSAIIARTVTVKAQPEEVARLAQAQATGRLSLAL 231


>gi|260426594|ref|ZP_05780573.1| Flp pilus assembly protein CpaB [Citreicella sp. SE45]
 gi|260421086|gb|EEX14337.1| Flp pilus assembly protein CpaB [Citreicella sp. SE45]
          Length = 286

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 91/186 (48%), Gaps = 9/186 (4%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           + ++   +  G V+    ++   +P+E + +G  D+ + P A  E   V+ R  + K + 
Sbjct: 50  IYVTTQAVPTGEVLRKEYVKLAPWPQEILPEGVFDETNPPFADGEAPRVVTRA-MDKFEA 108

Query: 108 IRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS----- 161
           +   ++ + G + GL++ L +G+RA  + + ++S V G ++P D VDV     +      
Sbjct: 109 VLTTRISEPGGDAGLTTRLERGQRAFAIKVDVTSGVSGFLRPGDRVDVYWTGKMPGTDAN 168

Query: 162 -ERKPTVTVVLSNIRVIAIDHNID-SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLV 219
             R     ++ + +++IAID   +  +    +  T T+ ++P Q   L  AQS  +LSL 
Sbjct: 169 LPRGEVTKLIETAVKLIAIDQTAEVENSDATIARTVTVAVSPQQVAGLAQAQSTGRLSLS 228

Query: 220 LRSIAD 225
           L +  D
Sbjct: 229 LLAAND 234


>gi|239814525|ref|YP_002943435.1| Flp pilus assembly protein CpaB [Variovorax paradoxus S110]
 gi|239801102|gb|ACS18169.1| Flp pilus assembly protein CpaB [Variovorax paradoxus S110]
          Length = 280

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 97/187 (51%), Gaps = 15/187 (8%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
            V+++  D+ +G  V P +L  V +P  ++  G   D       + L+  +V+V +L+G+
Sbjct: 38  KVVVAAVDIELGSRVNPQMLSLVDWPSGSLPAGSFKDA------KSLEDRVVKVGVLRGE 91

Query: 107 PIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER-- 163
            I   KL   G  GGLS+++  GKRA T+ ++    V G   P ++VD VMV +  ++  
Sbjct: 92  AILEGKLAPVGTQGGLSAVIASGKRAMTVRVNDVVGVAGFALPGNYVD-VMVNAQQDKNR 150

Query: 164 ----KPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSL 218
               +     VL  + V+A+    + D+ +  V S  TLEL+   ++ L  A+SV  LSL
Sbjct: 151 GEEGRQISKTVLEKVLVLAVAQEANRDDTKPKVVSAVTLELSLEDSEKLDLARSVGTLSL 210

Query: 219 VLRSIAD 225
           VLR+  D
Sbjct: 211 VLRNQMD 217


>gi|319779650|ref|YP_004130563.1| SAF domain protein [Taylorella equigenitalis MCE9]
 gi|317109674|gb|ADU92420.1| SAF domain protein [Taylorella equigenitalis MCE9]
          Length = 325

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 101/221 (45%), Gaps = 14/221 (6%)

Query: 15  FALVAGIIAMRLVSPHHVQTEEVITENPAK-FINVLISKGDLAVGMVVTPNILEWVAFPE 73
           FA+ AGI+A    + +  +    I  N  +  I  +++ GD+  G ++  +IL     PE
Sbjct: 13  FAIGAGILATFSANKYMKEKISQIEANHRQVMIPRIVAAGDIPEGTIIDSSILAVRDIPE 72

Query: 74  ENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAAT 133
             V      D   P+  + ++G ++  P+  GDP+             S  +  G+RA T
Sbjct: 73  NWVSS----DSLSPDEFERIEGKIITSPLTAGDPVLWAHTSTVSRRPFSEKVAVGRRAVT 128

Query: 134 MDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTV-VLSNIRVIAIDHNI----DSDER 188
           M +   ++V G+I P D +D+ +  S   R   +T  +L  + V+A D       D  ER
Sbjct: 129 MPVDTINSVSGLIVPGDLIDLYV--SFKYRNRDITAPLLQGVLVLATDKESKLTNDGSER 186

Query: 189 VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
               ST TL+ +P +A  LVAA+    ++  LR+  D   S
Sbjct: 187 EF--STVTLDTSPEEAAKLVAARQDGVITAFLRNPDDKKAS 225


>gi|86159250|ref|YP_466035.1| Flp pilus assembly CpaB [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85775761|gb|ABC82598.1| Flp pilus assembly CpaB [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 307

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 92/185 (49%), Gaps = 16/185 (8%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V+++  DL     +  ++L  V +P  NV +G   D  +      L   +VR  ++KG+P
Sbjct: 62  VVVATIDLPEATTLRADVLTVVQWPSANVPEGAASDPAK------LVDRVVRARVIKGEP 115

Query: 108 IRLEKLVDRGNG-GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV---RSLSER 163
           +   +L     G GL+++LP G RAA + ++    V G I P D VDV++V    S    
Sbjct: 116 VIESRLAAADAGHGLAAILPPGMRAAAVRVNDVVGVSGFIHPGDSVDVIVVMRPESNGNS 175

Query: 164 KPTV--TVVLSNIRVIAIDHNIDSDERVLVGS----TATLELTPMQAKALVAAQSVAKLS 217
            P     ++L N+ V+A+   ++ +ER L  S     ATL +   Q++ L  AQ+   + 
Sbjct: 176 NPAYFSKIILQNVPVLAVGKELERNERSLEKSLPATVATLMVDSEQSEKLALAQTKGNIL 235

Query: 218 LVLRS 222
           L LRS
Sbjct: 236 LTLRS 240


>gi|84685163|ref|ZP_01013062.1| pilus assembly protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84666895|gb|EAQ13366.1| pilus assembly protein [Rhodobacterales bacterium HTCC2654]
          Length = 275

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 70/133 (52%), Gaps = 6/133 (4%)

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
           + S L  G RA  + ++  +AVGG + P DHVD+V+ +   +   T  V+L + RV+A+D
Sbjct: 119 IGSTLSPGTRAVAIRVNADTAVGGFVSPGDHVDIVLTQGRGDTLRT-GVILQDTRVLAVD 177

Query: 181 HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS----DV 236
            + ++        T T+E+ P  ++ LV AQ   +LSL+LR+   +  +   D     DV
Sbjct: 178 QDTEA-RGARKARTITVEVAPRDSQRLVLAQEAGQLSLILRNDDAIGDTGEMDQITLRDV 236

Query: 237 WDVQEEGKEIQII 249
           W   E   E +++
Sbjct: 237 WGDPEPTPEPEVV 249


>gi|197123318|ref|YP_002135269.1| Flp pilus assembly protein CpaB [Anaeromyxobacter sp. K]
 gi|196173167|gb|ACG74140.1| Flp pilus assembly protein CpaB [Anaeromyxobacter sp. K]
          Length = 307

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 92/185 (49%), Gaps = 16/185 (8%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP 107
           V+++  DL     +  ++L  V +P  NV +G   D  +      L   +VR  ++KG+P
Sbjct: 62  VVVATIDLPEATTLRADVLSVVQWPSANVPEGAASDPAK------LVDRVVRARVIKGEP 115

Query: 108 IRLEKLVDRGNG-GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV---RSLSER 163
           +   +L     G GL+++LP G RAA + ++    V G I P D VDV++V    +    
Sbjct: 116 VVESRLAAADAGHGLAAILPPGMRAAAVPVNDVVGVAGFIHPGDSVDVIVVMRPETNGNS 175

Query: 164 KPTV--TVVLSNIRVIAIDHNIDSDERVLVGS----TATLELTPMQAKALVAAQSVAKLS 217
            P     ++L N++V+A+   +  +ER L  S     ATL +   Q++ L  AQ+   + 
Sbjct: 176 NPAFFSKIILQNVQVLAVGKELGRNERSLEKSLPATVATLMVDSEQSEKLALAQTKGSIL 235

Query: 218 LVLRS 222
           L LRS
Sbjct: 236 LTLRS 240


>gi|126729099|ref|ZP_01744913.1| CpaB family protein [Sagittula stellata E-37]
 gi|126710089|gb|EBA09141.1| CpaB family protein [Sagittula stellata E-37]
          Length = 288

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 85/189 (44%), Gaps = 23/189 (12%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVH-------QPN-AMQELDGVLV 98
            + +S   +A G  +T   +    +PEE + +G  D+         +P  A++ +D    
Sbjct: 49  QIYVSARPIAYGQEITEEDIRLAPWPEEIMPEGIFDEETPLLTENMEPRVALRAIDAFEA 108

Query: 99  RVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVR 158
            VP     P         G+ GL+  L  G+ A  + + ++S V G ++P D VDV    
Sbjct: 109 IVPSKVSQP--------GGSAGLTHYLKPGESAFAIRVDVASGVSGFLRPGDRVDVYWTG 160

Query: 159 SLSERKPTV------TVVLSNIRVIAIDHNIDSDER-VLVGSTATLELTPMQAKALVAAQ 211
            +  R P +       ++L+ IR+IAID N ++D     +  T T+  T  Q   L  AQ
Sbjct: 161 RVDSRDPNMPRGEVTKMILAGIRLIAIDQNSEADTSGTSIARTVTVAATREQTLVLTHAQ 220

Query: 212 SVAKLSLVL 220
           S  +L+L L
Sbjct: 221 STGQLTLSL 229


>gi|269962016|ref|ZP_06176371.1| hypothetical protein VME_27550 [Vibrio harveyi 1DA3]
 gi|269833339|gb|EEZ87443.1| hypothetical protein VME_27550 [Vibrio harveyi 1DA3]
          Length = 251

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 115/229 (50%), Gaps = 30/229 (13%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEV--ITENPAKFINVLISKGDLAVGMVV-- 61
           +M +++S VF L A +IA + +   +  T E+  I  +P     VL++  +L  GMV+  
Sbjct: 7   VMLLLLSIVFGLAAVLIAKQWIDGQNQPTVELEEIERHP-----VLVAAMELEPGMVLEE 61

Query: 62  ---TPNILE--WVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR 116
              T  ++E  W+   EE+               ++  G +V   I  G+ +   +L   
Sbjct: 62  KHLTTKLMEVDWI---EEDTLK----------VSEQALGRIVANTIYSGEMVNPNRLALP 108

Query: 117 GNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT-VVLSNI 174
           G G  L++L+P+ KRA T+ ++    V G + P + VD++   S  + K   T  VL NI
Sbjct: 109 GEGATLAALIPENKRAITIRVNDVIGVAGFLLPGNKVDILNTISSGKGKSASTKTVLKNI 168

Query: 175 RVIAIDHNIDS-DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRS 222
           +V+A+D    + D + ++    TLE+TP +A+ L++  S  K+ L LR+
Sbjct: 169 KVLAVDQTAKTNDNKPVIVRAVTLEVTPKEAEKLLSENSKGKIQLALRN 217


>gi|110679398|ref|YP_682405.1| pilus assembly domain-containing protein [Roseobacter denitrificans
           OCh 114]
 gi|109455514|gb|ABG31719.1| pilus assembly domain protein [Roseobacter denitrificans OCh 114]
          Length = 282

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 99/230 (43%), Gaps = 12/230 (5%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFI----NVLISKGDLAVGMVV 61
           + G+V+    AL  G + M        Q E    +     I     V ++   L  G  +
Sbjct: 4   IFGMVLLAGVALAGGAVYMAKGYIGQYQAELARAQQMHSAIVPTQQVFVATRHLRYGDTL 63

Query: 62  TPNILEWVAFPEENVFDGFIDDVHQ--PNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG 119
            P  +  V +P   +  G   D+    P    E    L+  P+   + +   K+ + G  
Sbjct: 64  KPEDVRAVNWPVNAIPQGVFTDIAALFPEGTDEPR--LIIRPMEPSEAVLAVKITEPGED 121

Query: 120 -GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM---VRSLSERKPTVTVVLSNIR 175
            GL++ L KG RA  + + ++S V G ++P D VDV     V++ + R+    ++ + +R
Sbjct: 122 IGLTTRLEKGMRAFAIRVDVASGVSGFLRPGDKVDVYWTGGVQTGNGREDVTKLIQTAVR 181

Query: 176 VIAIDHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           +IA+D   D      +  T T+  TP Q  AL  AQS   LSL L  + D
Sbjct: 182 LIAVDQIDDQMNGARIARTVTVAATPEQVAALAQAQSTGNLSLSLVGVGD 231


>gi|163751743|ref|ZP_02158961.1| hypothetical Flp pilus assembly protein [Shewanella benthica KT99]
 gi|161328395|gb|EDP99554.1| hypothetical Flp pilus assembly protein [Shewanella benthica KT99]
          Length = 270

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 93/163 (57%), Gaps = 12/163 (7%)

Query: 90  MQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKP 148
            +E +G++V+  +  G+ +R E+++ +G G  L+SL+    RA T+ ++    V G + P
Sbjct: 78  FEEAEGMVVKHNLYSGEILRSERIIKKGEGSTLASLISPNMRAVTIRVNDVIGVAGFLLP 137

Query: 149 NDHVDVVMVRSLSERKPTVT--VVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAK 205
            + VDV+   +L ++  ++   +VL+NI+++AID    +DE +  +    TLE++  QA+
Sbjct: 138 GNRVDVL---NLFKKDGSLHTDIVLANIKILAIDQRSSNDENKPTLVRAVTLEMSLEQAE 194

Query: 206 ALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQI 248
            L+ A+   KL L LR     NP+ S + ++  + E+ +  +I
Sbjct: 195 TLLIAKGRGKLQLALR-----NPNDSAEVELALINEKQQREEI 232


>gi|28899194|ref|NP_798799.1| putative pilus assembly protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153836767|ref|ZP_01989434.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus AQ3810]
 gi|260361568|ref|ZP_05774595.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus K5030]
 gi|260876725|ref|ZP_05889080.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus AN-5034]
 gi|260898196|ref|ZP_05906692.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus Peru-466]
 gi|260900396|ref|ZP_05908791.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus AQ4037]
 gi|28807418|dbj|BAC60683.1| putative pilus assembly protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149749913|gb|EDM60658.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus AQ3810]
 gi|308089099|gb|EFO38794.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus Peru-466]
 gi|308091466|gb|EFO41161.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus AN-5034]
 gi|308109142|gb|EFO46682.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus AQ4037]
 gi|308114026|gb|EFO51566.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus K5030]
 gi|328474269|gb|EGF45074.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus 10329]
          Length = 251

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 79/146 (54%), Gaps = 4/146 (2%)

Query: 80  FIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISI 138
           +IDD       Q L G +V   I  G+ +   +L   G G  L++L+P+ KRA T+ ++ 
Sbjct: 73  WIDDETLKVPEQAL-GRIVANTIYAGELVNPNRLAQPGEGATLAALIPENKRAVTIRVND 131

Query: 139 SSAVGGMIKPNDHVDVVMVRSLSERKPTVTV-VLSNIRVIAIDHNIDS-DERVLVGSTAT 196
              V G + P + VDV+   S  + K   T+ VL NI V+A+D    + D + ++    T
Sbjct: 132 VIGVAGFLLPGNKVDVLSTVSYGKGKQATTLTVLKNINVLAVDQTAKTNDNKPVIVRAVT 191

Query: 197 LELTPMQAKALVAAQSVAKLSLVLRS 222
           LE+TP +A+ L++A S  ++ L LR+
Sbjct: 192 LEVTPKEAEKLLSANSKGEIQLALRN 217


>gi|209515950|ref|ZP_03264811.1| Flp pilus assembly protein CpaB [Burkholderia sp. H160]
 gi|209503608|gb|EEA03603.1| Flp pilus assembly protein CpaB [Burkholderia sp. H160]
          Length = 375

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 107/245 (43%), Gaps = 24/245 (9%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
           + R++ IV+  + A V  II   L     V   +     P     V ++  DL  GM++ 
Sbjct: 1   MPRILKIVILVILASVGAIIFRALF----VAASQPGQARPPAMDRVRVAAADLPEGMLLR 56

Query: 63  PNILEWVAFPEENVFDGFI--DDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD-RGNG 119
            + L W   P + V  G +   D     A  +L G ++R  +  G  +    ++     G
Sbjct: 57  ESDLAWKEVPHKQVLQGALVKGDAESAEAT-DLKGDVLRHAVTAGTMLGTADVIPPNAPG 115

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL---------SERKPTVTVV 170
            L++ L  G RA ++ I   S   G+I+P D+VDV++ + L         + R      V
Sbjct: 116 FLAAALKPGMRAISVAIDDVSGNAGLIQPGDYVDVLLTQQLDGPVHAPQNTARSVESETV 175

Query: 171 LSNIRVIAIDH-----NIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA- 224
           ++ +RV+A+         D+ +      T T E+TP  A+ +  A  +  LSL LRS A 
Sbjct: 176 VNRVRVLAVGSIFQRPKADAADANTRARTVTFEVTPHTAQVIAVATHLGSLSLALRSFAT 235

Query: 225 -DLNP 228
            D NP
Sbjct: 236 SDRNP 240


>gi|260771479|ref|ZP_05880404.1| flp pilus assembly protein RcpC/CpaB [Vibrio furnissii CIP 102972]
 gi|260613605|gb|EEX38799.1| flp pilus assembly protein RcpC/CpaB [Vibrio furnissii CIP 102972]
 gi|315181061|gb|ADT87975.1| Flp pilus assembly protein CpaB [Vibrio furnissii NCTC 11218]
          Length = 249

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 78/144 (54%), Gaps = 7/144 (4%)

Query: 92  ELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPND 150
           E+ G +    I   + I  ++L   G G  L++L+P+ KRA T+ ++    V G + P +
Sbjct: 84  EVIGKIAESDIYPNEIIVAQRLSIPGEGATLAALIPEDKRAVTIRVNDVIGVAGFLLPGN 143

Query: 151 HVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVA 209
            VDV+     S+     T +L +IRV+A+D    + E + ++    TLE++P +A+ L++
Sbjct: 144 KVDVLNTIQYSKTSANTTTILKDIRVLAVDQTAKTQENKPIIVRAVTLEVSPKEAEKLLS 203

Query: 210 AQSVAKLSLVLRSIADLNPSSSED 233
           A+S   + LVLR     NP + E+
Sbjct: 204 AKSKGDIQLVLR-----NPHAVEE 222


>gi|322434103|ref|YP_004216315.1| Flp pilus assembly protein CpaB [Acidobacterium sp. MP5ACTX9]
 gi|321161830|gb|ADW67535.1| Flp pilus assembly protein CpaB [Acidobacterium sp. MP5ACTX9]
          Length = 291

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 83/176 (47%), Gaps = 12/176 (6%)

Query: 55  LAVGMVVTPNILEWVAFPEEN-VFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL 113
           L  G  + P+ +E V +P  N +  GF+         ++L G  V  P+ K  P+  + L
Sbjct: 48  LQSGEQLKPDSMELVNWPASNPIAGGFLKP-------EDLVGRSVLYPVEKDQPLTDKLL 100

Query: 114 VDRGNG-GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDV-VMVRSLSERKPTVTVVL 171
              G+G GL++ +P G RA ++       V G + P  H+DV V  R+    +P    VL
Sbjct: 101 STAGSGPGLAARIPAGMRAISLKSDEIMGVAGFLSPGSHLDVLVTYRTDKNPEPVTLTVL 160

Query: 172 SNIRVIAIDHNI--DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
            +  V+A    I  D D + +  +  TL LTP  A+  V A S   +  +LRS +D
Sbjct: 161 QDAEVLAAGQKIQPDPDGKPVTATVVTLLLTPEDAQRAVLASSQGAIHFILRSGSD 216


>gi|332284570|ref|YP_004416481.1| putative secreted protein [Pusillimonas sp. T7-7]
 gi|330428523|gb|AEC19857.1| putative secreted protein [Pusillimonas sp. T7-7]
          Length = 326

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 97/224 (43%), Gaps = 15/224 (6%)

Query: 14  VFALVAGIIAMRLVSPH---HVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVA 70
           + A VAG+ A      H    VQ  E     P   +  +++  DL  G  + P  L    
Sbjct: 14  LLAGVAGLGAAWAAKQHIDGKVQLLEAQARTP--MVERIVAAYDLPAGTRLGPEHLALRH 71

Query: 71  FPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKR 130
           FP      G +     P    EL G ++R P+  GD +       + +   SS L  G+R
Sbjct: 72  FPANVASSGSL----APGRFTELTGTMLRAPLRGGDAVLEVHTTGQDHAAFSSHLSAGRR 127

Query: 131 AATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHN---IDSDE 187
           A +M +   ++V G+++P D +D + V    +R+     +L  + V+A D N   +    
Sbjct: 128 AISMPVDAINSVSGLLQPGDLID-LYVSFEYQRRHITAPLLQGVLVLATDANTQFVQDAG 186

Query: 188 RVLVGS--TATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
               GS  T TL+ +P  A  LVAA+    ++ VLR   D+  S
Sbjct: 187 HASRGSYATVTLDASPEDAVKLVAARQGGTITAVLRPPQDVASS 230


>gi|149912018|ref|ZP_01900612.1| Flp pilus assembly protein CpaB [Moritella sp. PE36]
 gi|149804917|gb|EDM64951.1| Flp pilus assembly protein CpaB [Moritella sp. PE36]
          Length = 288

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 97/204 (47%), Gaps = 22/204 (10%)

Query: 40  ENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPN-AMQELDGVLV 98
           ++  K   VL+S  D+ +G   + ++  W    E +V D  ID + + N ++Q L   + 
Sbjct: 35  QDTVKTYEVLVSTQDVVIGRPYSASLFAWKTVDESSVRDR-IDFIDKANFSIQALKNTVA 93

Query: 99  RVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV 157
               + G  +     +    GG LS +L    RA ++ +   +A  G+I P DHVDV+++
Sbjct: 94  AADFVTGQILSPSDFLKPEQGGFLSVMLRPNYRAVSIPVDEVTANSGLIGPGDHVDVLLL 153

Query: 158 RSLSE---------RKPTVTVVLSNIRVIAIDHNID---------SDERVLV-GSTATLE 198
            S S+         +   V  +  N+RV+A +  +           ++ V+   ST TLE
Sbjct: 154 ASKSQELRSRGNETQSLYVKTIAQNVRVLAFNDALQLARYMEKQKHNKGVIPDNSTVTLE 213

Query: 199 LTPMQAKALVAAQSVAKLSLVLRS 222
           ++P+QA  +  A  +  LS+VLRS
Sbjct: 214 VSPLQANQITLANQLGTLSMVLRS 237


>gi|312883753|ref|ZP_07743472.1| Flp pilus assembly protein CpaB, putative [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309368502|gb|EFP96035.1| Flp pilus assembly protein CpaB, putative [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 279

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 106/223 (47%), Gaps = 27/223 (12%)

Query: 22  IAMRLVSPHHVQTEEVITENPAK-FINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGF 80
           IA+ L++P   Q E+  ++  A+ F  VL++K  + VG   T N+ +W    E+ +   +
Sbjct: 18  IAILLLNPSKPQFEQ--SQAAAEIFKRVLVAKQRVVVGQPYTLNMFQWEKVSEQEL-SNY 74

Query: 81  IDDVHQPNAMQ-ELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLP--KGKRAATMDIS 137
           +D + + +  + +L   +    I  G  +  +   +  NGG+S       G RA ++ + 
Sbjct: 75  LDFISEEDFSRLDLKSGIAHTAIQSGQVMSKDDF-ETPNGGISMAFKVQNGHRAISVPVD 133

Query: 138 ISSAVGGMIKPNDHVDVVMVRSLSERKP---------TVTVVLSNIRVIAIDHNIDSDE- 187
             +A  G ++P D VD++++ S  E             VT +  N+RV+A +   D  + 
Sbjct: 134 AVTANSGFVQPGDKVDILLLGSQVEELKKYDNQVAGLYVTTIAVNVRVLAFNQYADPQDF 193

Query: 188 ---RVLVG------STATLELTPMQAKALVAAQSVAKLSLVLR 221
              R   G      S+ +LE+TP QA  +V A  + KL+L LR
Sbjct: 194 QKNRSAYGADIPDNSSVSLEVTPEQATQIVLANQIGKLTLSLR 236


>gi|260892925|ref|YP_003239022.1| Flp pilus assembly protein CpaB [Ammonifex degensii KC4]
 gi|260865066|gb|ACX52172.1| Flp pilus assembly protein CpaB [Ammonifex degensii KC4]
          Length = 233

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 101/210 (48%), Gaps = 21/210 (10%)

Query: 43  AKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELD---GVLVR 99
           A +++V+++  D+ V   +TP++L+    P   V          P A++ ++   G +  
Sbjct: 36  AHYVSVVVAAQDIPVRTSLTPSLLKLQDLPSSCV---------HPLAVRRIEDAVGRVTT 86

Query: 100 VPILKGDPIRLEKLVDRGNGG--LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV 157
           VP+++G+ +   KL    +    L+  L  G+RA T+ ++  S VGG++KP D VDVV  
Sbjct: 87  VPLVRGEVLLQSKLASSKDEKQELALSLQPGERAVTLAVNAVSGVGGVLKPGDRVDVVAT 146

Query: 158 RSLSER--KPTVT-VVLSNIRVIAIDHNIDSDERVLVGSTATLELTPMQAKALVAAQSVA 214
             L  +  K T T +V SN+RV+A+  + +         T TL +TP Q   +  A    
Sbjct: 147 FDLESQGTKTTYTALVASNVRVLALGSSGEKKPY----DTVTLAVTPRQGALITLATERG 202

Query: 215 KLSLVLRSIADLNPSSSEDSDVWDVQEEGK 244
            + L LR   +   +      + D+ E GK
Sbjct: 203 SVRLFLRGPKEQEATQLLPVKLPDLLEAGK 232


>gi|148976308|ref|ZP_01813032.1| Flp pilus assembly protein CpaB [Vibrionales bacterium SWAT-3]
 gi|145964402|gb|EDK29657.1| Flp pilus assembly protein CpaB [Vibrionales bacterium SWAT-3]
          Length = 290

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 109/227 (48%), Gaps = 26/227 (11%)

Query: 22  IAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFI 81
           +++ L S  +  +E+V      + I VL+    + +G   TPN  +W A P   + + +I
Sbjct: 18  LSVLLFSQGNNASEKVSVPTTQQTIKVLVPSRTIDIGQNYTPNSFQWKAIPLGEL-ENYI 76

Query: 82  DDVHQPNAMQE---LDGVLVRVPILKGDPIRLEKLVD-RGNGGLSSLLPKGKRAATMDIS 137
           D V  P ++ E   + G+  +  +++G  +    + + +G   LS  L  G RA ++ + 
Sbjct: 77  DYV-TPESISEDHSMSGI-AQTKLVEGSVLSHADITEPKGGYSLSFKLQPGYRAISVPVD 134

Query: 138 ISSAVGGMIKPNDHVDVVMVRSL---------SERKPTVTVVLSNIRVIAIDHNIDSDER 188
             +A  G I+P D VD++++ S          S +   VT ++ + RV+A ++   ++  
Sbjct: 135 QITANSGFIQPGDRVDILLLGSQDGELLRYGNSSQGLYVTTIVHDARVLAFNNTQAAESY 194

Query: 189 VLV----------GSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
             V           S+ +LE+TP QA  +V A+ + KL+L LR   D
Sbjct: 195 QKVRDSYGAVIPDNSSVSLEVTPEQANQVVLAEQLGKLTLALRGQND 241


>gi|117619605|ref|YP_855990.1| Flp pilus assembly protein CpaB [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117561012|gb|ABK37960.1| Flp pilus assembly protein CpaB [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 296

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 98/218 (44%), Gaps = 37/218 (16%)

Query: 43  AKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFD-------GFIDDVHQPNAMQELDG 95
           A+   VL++   +  G  + P  L W   P     +       GF D        + L G
Sbjct: 45  ARLAQVLVAAHRVQAGAFIHPEDLVWQTLPAAEEMNLPGLFLFGFTD-------TKALKG 97

Query: 96  VLVRVPILKGDPIRLEKLV-DRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDV 154
            LV   +  G  +  + LV    +  LS+++  G RA T+ +   +A  G+I+P + VDV
Sbjct: 98  SLVTRTLEAGQIVSADDLVRPEQSHYLSAMMAPGMRAVTLALGREAASHGLIRPGNRVDV 157

Query: 155 VMVRSLSER----------KPTVTVVLSNIRVIAIDHNIDSDERVLVGSTA--------- 195
           ++    + +          K +  ++L++I+++AID  + +D   L G+ A         
Sbjct: 158 ILTSKHTHQRNAQGAEVTSKQSAEIILTDIKLLAIDAQV-TDIAALNGTVAAQDNFDQVA 216

Query: 196 -TLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSE 232
            T EL P  A  L+ A  + +L+LVLRS A   P+ SE
Sbjct: 217 VTFELAPSAAARLLLAHRLGELALVLRS-AQAAPTGSE 253


>gi|115358170|ref|YP_775308.1| Flp pilus assembly CpaB [Burkholderia ambifaria AMMD]
 gi|115283458|gb|ABI88974.1| Flp pilus assembly CpaB [Burkholderia ambifaria AMMD]
          Length = 342

 Score = 62.4 bits (150), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 90/193 (46%), Gaps = 18/193 (9%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDG-FIDDVHQPNAMQELDGVLVRVPILK 104
           + V ++  DL  G+++  N L W       V  G F++   QP A  +L G L+R  +  
Sbjct: 40  VRVRVAAADLPEGLLLRDNDLAWKPMARAQVPAGAFVE--SQPGA--DLKGALLRSRVEA 95

Query: 105 GDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER 163
           G PIR + ++  G    L++ L  G RA ++ +   S   G+I+P D VDVV+ + +   
Sbjct: 96  GAPIRADNVISAGAPDFLAAALQPGMRAISVPVDDVSGNAGLIQPGDFVDVVLTQQIGGS 155

Query: 164 KPT-----VTVVLSNIRVIAIDHNID-------SDERVLVGSTATLELTPMQAKALVAAQ 211
             T        V+   RV+A+            + +  +   T TLE+ P  A+ ++ A 
Sbjct: 156 ATTPGTFEAETVVRRARVLAVGSEFQRAKGPASAPDAPVRARTVTLEVAPRTAQVVLVAT 215

Query: 212 SVAKLSLVLRSIA 224
            +  LSL LRS A
Sbjct: 216 RLGSLSLALRSFA 228


>gi|254506783|ref|ZP_05118923.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus 16]
 gi|219550364|gb|EED27349.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus 16]
          Length = 233

 Score = 62.4 bits (150), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 71/140 (50%), Gaps = 7/140 (5%)

Query: 95  GVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVD 153
           G +V   I  G+ +   +L   G G  L+SL+P+ KRA T+ ++    V G + P + VD
Sbjct: 73  GQVVATTIFPGEVLHQNRLTVPGEGSTLASLIPENKRAVTIRVNDVIGVAGFLLPGNRVD 132

Query: 154 VVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQS 212
           V+     S        VL +I+V+A+D    + E + ++    TLE++P  A+ L+ A+S
Sbjct: 133 VLNTIKYSATSANTVTVLKDIKVLAVDQTARTKENKPIIVRAVTLEVSPKDAEKLLTARS 192

Query: 213 VAKLSLVLRSIADLNPSSSE 232
             ++ L LR     NP   E
Sbjct: 193 KGEIQLTLR-----NPHEEE 207


>gi|254229331|ref|ZP_04922748.1| Flp pilus assembly protein CpaB [Vibrio sp. Ex25]
 gi|262393416|ref|YP_003285270.1| flp pilus assembly protein RcpC/CpaB [Vibrio sp. Ex25]
 gi|151938139|gb|EDN56980.1| Flp pilus assembly protein CpaB [Vibrio sp. Ex25]
 gi|262337010|gb|ACY50805.1| flp pilus assembly protein RcpC/CpaB [Vibrio sp. Ex25]
          Length = 251

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 111/222 (50%), Gaps = 16/222 (7%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEV--ITENPAKFINVLISKGDLAVGMVVTP 63
           +M +++S VF L A +IA + +   +  T E+  +  +P     VL++  +L  G +++ 
Sbjct: 7   IMLLLLSIVFGLAAVLIAKQWMDGRNQPTVELEEVERHP-----VLVAAMELEPGTILSE 61

Query: 64  NILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LS 122
             L       +     +IDD       Q L G +V   I  G+ +   +L   G G  L+
Sbjct: 62  KHLSTKLMEVD-----WIDDETLKVQEQAL-GRIVANTIYAGELVNSNRLALPGEGATLA 115

Query: 123 SLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE-RKPTVTVVLSNIRVIAIDH 181
           +L+P+ KRA T+ ++    V G + P + VDV+   S  + +  T   VL NI V+A+D 
Sbjct: 116 ALIPENKRAITIRVNDVIGVAGFLLPGNKVDVLNTVSYGQGKNATTKTVLKNINVLAVDQ 175

Query: 182 NIDS-DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRS 222
              + D + ++    TLE+TP +A+ L++A S   + L LR+
Sbjct: 176 TAKTNDNKPVIVRAVTLEVTPKEAEKLLSANSKGDIQLALRN 217


>gi|330830433|ref|YP_004393385.1| Flp pilus assembly protein CpaB [Aeromonas veronii B565]
 gi|328805569|gb|AEB50768.1| Flp pilus assembly protein CpaB [Aeromonas veronii B565]
          Length = 296

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 104/233 (44%), Gaps = 43/233 (18%)

Query: 42  PAKFINVLISKGDLAVGMVVTPNILEWVAFPEEN-------VFDGFIDDVHQPNAMQELD 94
           P +   VL++   +  G  + P  L W A PE            GF D        + L 
Sbjct: 44  PDRVAQVLVAAHRVQAGSFIHPEDLRWQALPEAEERNLPGLFLFGFTD-------TKALK 96

Query: 95  GVLVRVPILKGDPIRLEKLV-DRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVD 153
           G LV   +  G  +  + LV    +  LS+++  G RA T+ +   +A  G+I+P + VD
Sbjct: 97  GSLVTRTLEAGQIVSADDLVRPEQSHYLSAMMAPGMRAVTLALGREAASHGLIRPGNRVD 156

Query: 154 VVMV----RSLSERKPTVT------VVLSNIRVIAIDHNIDSDERVLVGSTA-------- 195
           V++     R  + +   VT      ++L++I+++AID  + +D   L G+ A        
Sbjct: 157 VILTSKHARQHNAQGAEVTSNQSAEIILTDIKLLAIDAQV-TDIAALNGNPAAQDNFDQV 215

Query: 196 --TLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSS------EDSDVWDVQ 240
             T EL P  A  L+ A  + +L+LVLRS A   P+ S      E S +W  Q
Sbjct: 216 AVTFELPPRAAARLLLAHRLGELALVLRS-AQSAPAGSPAMALPEGSLIWAEQ 267


>gi|172062958|ref|YP_001810609.1| Flp pilus assembly protein CpaB [Burkholderia ambifaria MC40-6]
 gi|171995475|gb|ACB66393.1| Flp pilus assembly protein CpaB [Burkholderia ambifaria MC40-6]
          Length = 342

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 91/193 (47%), Gaps = 18/193 (9%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDG-FIDDVHQPNAMQELDGVLVRVPILK 104
           + V ++  DL  G+++  N L W +     V  G F++   QP A  +L G L+R  +  
Sbjct: 40  VRVRVAAADLPEGLLLRDNDLAWKSMARAQVPAGAFVE--SQPGA--DLKGALLRNRVDA 95

Query: 105 GDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER 163
           G PIR + ++  G    L++ L  G RA ++ +   S   G+I+P D VDVV+ + +   
Sbjct: 96  GAPIRADNVISAGAPDFLAAALQPGMRAISVPVDDVSGNAGLIQPGDFVDVVLTQQIGGS 155

Query: 164 KPT-----VTVVLSNIRVIAIDHNID-------SDERVLVGSTATLELTPMQAKALVAAQ 211
             T        V+   RV+A+            + +  +   T TLE+ P  A+ ++ A 
Sbjct: 156 ATTPGTFEAETVVRRARVLAVGSEFQRAKGPASAPDAPVRARTVTLEVAPRTAQVVLVAT 215

Query: 212 SVAKLSLVLRSIA 224
            +  LSL LRS A
Sbjct: 216 RLGSLSLALRSFA 228


>gi|323493504|ref|ZP_08098626.1| Flp pilus assembly protein CpaB [Vibrio brasiliensis LMG 20546]
 gi|323312327|gb|EGA65469.1| Flp pilus assembly protein CpaB [Vibrio brasiliensis LMG 20546]
          Length = 280

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 103/217 (47%), Gaps = 25/217 (11%)

Query: 45  FINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDV-HQPNAMQELDGVLVRVPIL 103
           F  VL++K  + +G   T N+ EW    ++ + D ++D +  +  ++Q+    +    IL
Sbjct: 40  FKRVLVAKQKVDIGQPYTLNMFEWKQVSQQEL-DNYLDYISREAFSVQQFTPGIAHSEIL 98

Query: 104 KGDPIRLEKL-VDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS-LS 161
            G  +        +G   L+  +  G RA ++ +   +A  G ++P D VD++++ S + 
Sbjct: 99  AGQVMSAGDFSTPKGGVSLAFKVRNGYRAISVPVDSVTANSGFVQPGDKVDILLLGSEVE 158

Query: 162 ERKP--------TVTVVLSNIRVIAIDHNIDSD----ERVLVG------STATLELTPMQ 203
           E K          VT +  ++RV+A +   D+D    +R   G      S+ +LE+ P Q
Sbjct: 159 ELKKYDNKVSGLYVTTIAKDVRVLAFNQYSDADNFQKKRSAYGADLPDNSSVSLEVNPEQ 218

Query: 204 AKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQ 240
           A  +V A  + KL+L LR   +     S+D  ++ V+
Sbjct: 219 ATQIVLANQIGKLTLSLRGAGE---DDSDDQSIYTVK 252


>gi|269966891|ref|ZP_06180964.1| putative pilus assembly protein [Vibrio alginolyticus 40B]
 gi|269828558|gb|EEZ82819.1| putative pilus assembly protein [Vibrio alginolyticus 40B]
          Length = 251

 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 64/222 (28%), Positives = 111/222 (50%), Gaps = 16/222 (7%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEV--ITENPAKFINVLISKGDLAVGMVVTP 63
           +M +++S VF L A +IA + +   +  T E+  +  +P     VL++  +L  G +++ 
Sbjct: 7   IMLLLLSIVFGLAAVLIAKQWMDGRNQPTVELEEVERHP-----VLVAAMELEPGTILSE 61

Query: 64  NILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LS 122
             L       +     +IDD       Q L G +V   I  G+ +   +L   G G  L+
Sbjct: 62  KHLSTKLMEVD-----WIDDETLKVKEQAL-GRIVANTIYAGELVNPHRLALPGEGATLA 115

Query: 123 SLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK-PTVTVVLSNIRVIAIDH 181
           +L+P+ KRA T+ ++    V G + P + VDV+   S  + K  T   VL NI V+A+D 
Sbjct: 116 ALIPENKRAITIRVNDVIGVAGFLLPGNKVDVLNTVSYGQGKNATTKTVLKNINVLAVDQ 175

Query: 182 NIDS-DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRS 222
              + D + ++    TLE+TP +A+ L++A S   + L LR+
Sbjct: 176 TAKTNDNKPVIVRAVTLEVTPKEAEKLLSANSKGDIQLALRN 217


>gi|260463893|ref|ZP_05812089.1| Flp pilus assembly protein CpaB [Mesorhizobium opportunistum
           WSM2075]
 gi|259030268|gb|EEW31548.1| Flp pilus assembly protein CpaB [Mesorhizobium opportunistum
           WSM2075]
          Length = 299

 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 112/244 (45%), Gaps = 33/244 (13%)

Query: 6   LMGIV-VSGVFALVAGIIAMRLVSPHHVQTEEVITENPAK--FINVLISKGDLAVGMVVT 62
           ++GI  V G  ++ A    ++  +    +T  +    P K  F  ++++   L  GM + 
Sbjct: 1   MIGIAAVFGAISIFAADFWVKSQADAQEKTASIAAPAPPKIEFKTIVVANAPLRYGMELD 60

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVL------VRVPILKGDPIRLEKLVD- 115
              L  + +P++++  G         A   +DG+L      V  PI   +P+ L KL   
Sbjct: 61  RTKLIEIPWPQDSLPQG---------AFATIDGLLGEGGRVVLSPIEVNEPVLLTKLSGP 111

Query: 116 RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP---------- 165
            G   LS++L  G RA T+     + VGG + P D VDVV+ R   E +           
Sbjct: 112 NGRATLSNMLTPGMRAVTIRTDEIAGVGGFVTPGDRVDVVLTRDAGEIQEVAKNAQGAAG 171

Query: 166 ---TVTVVLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
              T  +V+++ +V+++    D  +    + ++ TLE+T   A+ +  A++V  LSL LR
Sbjct: 172 STITSEIVVADAKVLSVGQGADERQTAPQIANSVTLEVTTEGAQKVALARTVGTLSLSLR 231

Query: 222 SIAD 225
           S ++
Sbjct: 232 SASE 235


>gi|78357402|ref|YP_388851.1| putative pilus assembly protein CpaB [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78219807|gb|ABB39156.1| putative pilus assembly protein CpaB [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 272

 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 112/247 (45%), Gaps = 24/247 (9%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLV-SPHHVQTEEVITENPAKFINVL--ISKGDLAV 57
           MK + L+ I V+ V AL AG +  R++ +P         T  P K  +V+  ++  D+  
Sbjct: 1   MKKSSLIQIAVALVLALGAGALVFRMMQAPAR-------TAQPPKVASVMLAVAAADMTK 53

Query: 58  GMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG 117
           G  +    +    F  +    G        ++  EL G ++   +  G+PI   +LV+  
Sbjct: 54  GTRIRAEQITMAEFLLQTAPAGAF------SSADELTGRVLASAVTAGEPITPARLVEDT 107

Query: 118 --NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER---KPTVTVVLS 172
              GG+S+++  GKRA  +  +    + G I+P +HVDV++    + R   K     VL 
Sbjct: 108 VRYGGVSTMISPGKRAVAVKGNNVLGMAGFIRPGNHVDVLVTIDDNRRPQDKAVTKTVLE 167

Query: 173 NIRVIAIDHNIDS---DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
           NIRV+A    ++    D         TLE+ P + + L  A S  ++   LR+ AD +  
Sbjct: 168 NIRVLATGTELEQQGDDTATSPVDIYTLEMLPREVEVLSLAASRGEVHFSLRNPADTDSV 227

Query: 230 SSEDSDV 236
            +  +DV
Sbjct: 228 KTAGTDV 234


>gi|197118221|ref|YP_002138648.1| Flp pilus assembly protein CpaB [Geobacter bemidjiensis Bem]
 gi|197087581|gb|ACH38852.1| Flp pilus assembly protein CpaB [Geobacter bemidjiensis Bem]
          Length = 289

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 117/232 (50%), Gaps = 18/232 (7%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
           +TR   +    + AL+ G +A  +++ ++++ +    + P + + +  +  DL +G  + 
Sbjct: 1   MTRPSAMTTVTIIALLLGGLAT-IMANNYLKKQ---ADKPYEGVPIASAAVDLPLGSKLN 56

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-- 120
              ++   +P++ +  G   D ++P     L G +V  P+  G+ I   KL+   + G  
Sbjct: 57  ATQVKLATWPKDALPAGGYQD-YKP-----LVGRIVVRPLSAGEVITENKLMPLNSSGGI 110

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV----RSLSERKPTVTVVLSNIRV 176
           ++ ++P G RA T+ ++  + V G I PN  VDV++      S +ER     ++L N+ V
Sbjct: 111 MTYMVPDGHRAVTVSVNEVAGVAGFITPNSRVDVLLTIPRPGSTNERDNISKIILQNVPV 170

Query: 177 IAIDHNIDSDE--RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADL 226
           +A     +  E  +  V  T TL++TP++A+ L+       L L+LR++ D+
Sbjct: 171 LATGQVTEQKEGGKPGVVPTVTLDVTPIEAEKLIVGTKKGSLQLLLRNVIDV 222


>gi|317154606|ref|YP_004122654.1| Flp pilus assembly protein CpaB [Desulfovibrio aespoeensis Aspo-2]
 gi|316944857|gb|ADU63908.1| Flp pilus assembly protein CpaB [Desulfovibrio aespoeensis Aspo-2]
          Length = 273

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 114/232 (49%), Gaps = 21/232 (9%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNI 65
           L+ I +S + AL  G++     S     T++ +    A+ + V+++  DL  G+ +TP +
Sbjct: 8   LIQIGISLILALGTGVLIFMWTSGV---TQQPVAAPRAETVPVVVALTDLRPGIKLTPAM 64

Query: 66  LEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG--NGGLSS 123
           LE   F  ++   G      +P     LDG ++ V +   + +   KL D     GG+S+
Sbjct: 65  LETRQFTPDSRPSGAF---GEPGL---LDGRVLGVAVGANEAVTEAKLADASVIGGGVSA 118

Query: 124 LLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL-----SERKPTVTVVLSNIRVIA 178
           L+  GKRA ++  +    + G ++P D VDV++  SL     ++ +P   +VL  ++V+A
Sbjct: 119 LIEPGKRAMSVKGNAVMGLAGFVRPGDRVDVIV--SLVQGRGNQEEPVTKLVLERVKVLA 176

Query: 179 IDHNI---DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLN 227
               +   D++ +       TLELTP +++ L  A +   L+  LR+  D +
Sbjct: 177 TGTELQAPDTEGKAASVDVYTLELTPDESERLALAATQGTLNFALRNATDTD 228


>gi|294140773|ref|YP_003556751.1| Flp pilus assembly protein CpaB [Shewanella violacea DSS12]
 gi|293327242|dbj|BAJ01973.1| Flp pilus assembly protein CpaB [Shewanella violacea DSS12]
          Length = 270

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 89/159 (55%), Gaps = 12/159 (7%)

Query: 90  MQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKP 148
            +E +G++V+  +  G+ +R E+++ +G G  L+SL+    RA T+ ++    V G + P
Sbjct: 78  FEEAEGMVVKHNLYTGEILRSERIIKKGEGSTLASLISPNMRAVTIRVNDVVGVAGFLLP 137

Query: 149 NDHVDVVMVRSLSERKPTVT--VVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAK 205
            + VDV+   +L ++   +   +VL+N++++AID    +DE +  +    TLEL+  QA+
Sbjct: 138 GNRVDVL---NLFKKDGALHTDIVLANVKILAIDQRSSNDENKPKLVRAVTLELSLEQAE 194

Query: 206 ALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGK 244
            L+ A+   KL L LR     NP+ S + ++  + E  K
Sbjct: 195 ILLIAKGRGKLQLALR-----NPNDSAEVELALINETEK 228


>gi|237653357|ref|YP_002889671.1| Flp pilus assembly protein CpaB [Thauera sp. MZ1T]
 gi|237624604|gb|ACR01294.1| Flp pilus assembly protein CpaB [Thauera sp. MZ1T]
          Length = 286

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 114/235 (48%), Gaps = 15/235 (6%)

Query: 9   IVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEW 68
           + V+ +F L A  +A R +     +  E+      +  + +++K DLAVG  +T +++  
Sbjct: 12  LAVASLFGLGAAWLAARYLE---ERATEIELRQQGQMGHAVVAKTDLAVGTPLTRDLVAV 68

Query: 69  VAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKG 128
              P E +    I     P   +   G ++  P   G+P+   +L +R    LS+ L  G
Sbjct: 69  REVPVEWLHSSAI----TPEQFERAAGAVLAQPARGGEPLVWSQLEERRPATLSAQLAPG 124

Query: 129 KRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE- 187
           +RA T+ +  +S++ G+++P D +D++          T+  +L  +RV+A        E 
Sbjct: 125 RRATTIPVDETSSLSGLLRPGDRIDLLATVQRDHHHLTLP-LLQGVRVLATGSRTRPGED 183

Query: 188 ----RVLVGS--TATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDV 236
                +L GS  T TL+L+  +A  LVAA+++A+L+ VLR   D   +  + +D 
Sbjct: 184 DGAGDLLGGSFGTLTLDLSEEEATRLVAARALARLTAVLRHPRDTRTAPLQRTDA 238


>gi|89053489|ref|YP_508940.1| Flp pilus assembly CpaB [Jannaschia sp. CCS1]
 gi|88863038|gb|ABD53915.1| Flp pilus assembly CpaB [Jannaschia sp. CCS1]
          Length = 274

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 91/185 (49%), Gaps = 8/185 (4%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENV-FDGF--IDDVHQPNAMQELDGVLVRVPI 102
           + +++    L  G  +TP+ ++ + +P E+V F  F  +D++  P+  +E    ++R+ +
Sbjct: 45  VELIVVSRQLRYGEQITPDDVQLIRWPAEHVPFGAFTTMDELFPPD--EEGARTVLRM-M 101

Query: 103 LKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS 161
            + +PI L K+   G + G++S L  G RA  + + ++S V G ++P D VDV       
Sbjct: 102 EQDEPILLVKVTAPGEDAGVASRLEAGMRAIALRVDVNSGVSGFLRPGDRVDVYWTGPGR 161

Query: 162 ERKPTVTVVLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVL 220
                  ++ +N+++IAID   D       +  T T+   P    AL  AQ    L+L L
Sbjct: 162 NGDTVTRLIRANVQLIAIDQIADEQRNSPTIARTITVTARPEDVAALTQAQGSGSLTLAL 221

Query: 221 RSIAD 225
             + D
Sbjct: 222 VGVGD 226


>gi|218710407|ref|YP_002418028.1| Flp pilus assembly protein CpaB [Vibrio splendidus LGP32]
 gi|218323426|emb|CAV19603.1| Flp pilus assembly protein CpaB [Vibrio splendidus LGP32]
          Length = 279

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 70/133 (52%), Gaps = 2/133 (1%)

Query: 92  ELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPND 150
           EL G +V   I  G+ +   +    G G  L++L+P+ KRA T+ +     V G + P +
Sbjct: 114 ELVGKVVANTIYAGEVLHKMRFTIPGEGSTLAALIPENKRAVTIRVDDVIGVAGFLLPGN 173

Query: 151 HVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVA 209
            VD++   S S+       VL +I+V+A+D    ++E   ++    TLE++P  A+ L+ 
Sbjct: 174 KVDILSTVSYSKNSAATRTVLKDIKVLAVDQTAKTNENSPIIVRAVTLEVSPKDAEKLLT 233

Query: 210 AQSVAKLSLVLRS 222
           A+S   + L LR+
Sbjct: 234 AKSKGSIQLTLRN 246


>gi|87312293|ref|ZP_01094391.1| probable pilus assembly protein CpaB [Blastopirellula marina DSM
           3645]
 gi|87284997|gb|EAQ76933.1| probable pilus assembly protein CpaB [Blastopirellula marina DSM
           3645]
          Length = 363

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 88/169 (52%), Gaps = 13/169 (7%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
           N+ ++  D+ +   ++P +++   +P++ V +G + +      ++E++    RV +  G+
Sbjct: 26  NIFVAIEDIDINEQLSPELIKLEPWPKDKVPEGAVTN------LEEIENRRPRVRLYAGE 79

Query: 107 PIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDV-VMVRSLSERK 164
           PI   KL     + G S ++PKG R  ++ ++  ++  G+I P D VDV V +R+     
Sbjct: 80  PILERKLFGSNEDKGASKMIPKGFRVHSVRVTAETSASGLILPGDRVDVLVYLRNSGSIN 139

Query: 165 PTVT-VVLSNIRVIAIDHN----IDSDERVLVGSTATLELTPMQAKALV 208
            T+T  +L N+RV A++       DS+   +   T +L + P Q + L+
Sbjct: 140 KTLTRTILKNVRVFAVNEQTHRETDSEGNTITAKTVSLLVKPSQVEVLM 188


>gi|149911410|ref|ZP_01900028.1| Flp pilus assembly protein CpaB [Moritella sp. PE36]
 gi|149805518|gb|EDM65523.1| Flp pilus assembly protein CpaB [Moritella sp. PE36]
          Length = 264

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 99/197 (50%), Gaps = 15/197 (7%)

Query: 42  PAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVP 101
           P   + +  S   + +G ++    ++    PE    D  + D   P+   E+ G++ +  
Sbjct: 35  PENQVYIAFSTMVIPIGTIIEAKHIKLKILPESMSPDNTVTD---PD---EIYGMIAKDT 88

Query: 102 ILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL 160
           I   D IRLE+L+ +G G  L+SL+ +  RA ++ +     V G + P + +D++   S 
Sbjct: 89  IYIDDIIRLERLLIKGQGSTLASLISENMRAVSIRVDDVVGVAGFLLPGNRIDILNTVSG 148

Query: 161 SERKPTVTVVLSNIRVIAIDHN--IDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSL 218
           +    +  V+L NI+++AID    ID ++  LV +  T+E+   QA+ L+ A++  +L L
Sbjct: 149 NGGATSTEVILHNIKILAIDQRAAIDENKPQLVRAI-TVEVNLEQAEILMTARNQGRLQL 207

Query: 219 VLRSIADLNPSSSEDSD 235
            LR     NP+ S   D
Sbjct: 208 ALR-----NPTDSHAVD 219


>gi|84386798|ref|ZP_00989823.1| Flp pilus assembly protein CpaB [Vibrio splendidus 12B01]
 gi|84378326|gb|EAP95184.1| Flp pilus assembly protein CpaB [Vibrio splendidus 12B01]
          Length = 293

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 112/246 (45%), Gaps = 31/246 (12%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   RLM +    +F  V GI  + L   ++        +   + + VL+    + +G  
Sbjct: 1   MTAKRLMLL---SLFCSVLGISVLLLSQTNNESASTSSKQAVKQTVKVLVPTRTIEIGQA 57

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPN--AMQELDGVLVRVPILKGDPIRLEKLVDRGN 118
            TPN   W   P++   + +ID V   +  A   + G L R  ++K D I  +  +    
Sbjct: 58  YTPNSFRWKEVPQQE-LENYIDHVTPEDISADHTMSG-LARTKLVK-DSILSKADITEPE 114

Query: 119 GG--LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL---------SERKPTV 167
           GG  LS  L  G RA ++ +   ++  G I+P D VD++++ S          S +   V
Sbjct: 115 GGYSLSLKLQPGYRAISVPVDQVTSNSGFIEPGDRVDILLLGSQDGELLRYGNSSQGLYV 174

Query: 168 TVVLSNIRVIAIDHNI---------DSDERVLV---GSTATLELTPMQAKALVAAQSVAK 215
           T ++ + RV+A +            +S++   V    S+ +LE+TP QA  +V A+ + K
Sbjct: 175 TTIVHDARVLAFNDKQTAESYQKARESNQHKKVVPDDSSVSLEVTPEQANQVVLAKQLGK 234

Query: 216 LSLVLR 221
           L+LVLR
Sbjct: 235 LTLVLR 240


>gi|258405292|ref|YP_003198034.1| Flp pilus assembly protein CpaB [Desulfohalobium retbaense DSM
           5692]
 gi|257797519|gb|ACV68456.1| Flp pilus assembly protein CpaB [Desulfohalobium retbaense DSM
           5692]
          Length = 295

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 119/257 (46%), Gaps = 24/257 (9%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQ--TEEVITENPAKFINVLISKGDLAVGM 59
           +L  L+ I ++ V A+   +     +     +  T E   E       V+++  D++ G 
Sbjct: 3   RLRALIPIALALVIAIAGSVFIYNWMQEQTTRQDTVEKAREKAPSTQEVVVAALDISAGS 62

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL--VDRG 117
            +T  +L+   + ++N+  G   D  Q      L G +   P  K +PI   +L   D  
Sbjct: 63  QLTEEMLQTGQYLKKNLPPGSFTDPDQ------LLGRVALAPFKKNEPIVDHRLAPTDIK 116

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTV-VLSNIRV 176
           +GG+S+L+ KG RA ++  +    + G + P   VDV++  +  +    +T  +L N+++
Sbjct: 117 SGGVSALISKGNRAVSLGGNKVLGISGFVLPGSRVDVMVTWNDPDSGEQITKRILDNVKI 176

Query: 177 IAIDHNIDSDERVLVGSTA-----TLELTPMQAKALVAAQSVAKLSLVLRSIADLNP--- 228
           +A    +   E    G TA     TLE+TP +A+ L   ++   L + LR+  D  P   
Sbjct: 177 LATSTKMQETES---GGTAPVDVYTLEVTPEEAEILTHIRNQGSLQMALRNPTDNEPVMT 233

Query: 229 --SSSEDSDVWDVQEEG 243
             ++++DS  + ++E G
Sbjct: 234 DGATAKDSMAYMLKENG 250


>gi|317122047|ref|YP_004102050.1| Flp pilus assembly protein CpaB [Thermaerobacter marianensis DSM
           12885]
 gi|315592027|gb|ADU51323.1| Flp pilus assembly protein CpaB [Thermaerobacter marianensis DSM
           12885]
          Length = 236

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 79/157 (50%), Gaps = 18/157 (11%)

Query: 95  GVLVRVPILKGDPIRLEKLVDRGNG--GLSSLLPKGKRAATMDISISSAVGGMIKPNDHV 152
           G + +VP+ +G+ +   KL  RG+G  GL+  LP+G RA T+      AVGG ++P D V
Sbjct: 84  GKVTKVPLAEGEFVLASKLA-RGDGTDGLAYRLPEGTRALTVAADPVIAVGGFVQPGDRV 142

Query: 153 DVVMVRSLSE---RKPTVTVVLSNIRVIAIDHNIDSDERVLVGSTA-------TLELTPM 202
           DV +     +    +P V +++ N+ V+A+     ++     G  A       TL ++P 
Sbjct: 143 DVFIGLPGGQPGVAQPEVRLLVENVLVLAVQQQTAAE-----GQPAGEGLTHLTLAVSPA 197

Query: 203 QAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDV 239
            A A+V A+   +L L LR   D  P+    + + D+
Sbjct: 198 HAAAIVLAEQEGRLRLALRPAGDDTPAGPITARLADL 234


>gi|149176582|ref|ZP_01855195.1| Flp pilus assembly CpaB [Planctomyces maris DSM 8797]
 gi|148844695|gb|EDL59045.1| Flp pilus assembly CpaB [Planctomyces maris DSM 8797]
          Length = 349

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 123/259 (47%), Gaps = 31/259 (11%)

Query: 14  VFALVAGIIAM---RLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVA 70
           V A+  G++AM   R V     Q  EV      K  NVL++  ++  G  +  + +++ +
Sbjct: 4   VIAVGCGLVAMLGVRQVLNKDDQQAEV------KTANVLMTIAEIPPGTPLNESNVKFKS 57

Query: 71  FPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKR 130
           +P + V +G +        +++     ++   + G+ +   KL ++G  G S  +P GKR
Sbjct: 58  WPIDQVPEGAV------TKLEQYKDRSIKTRAVPGEIVMKAKLSEQGVRGASVEIPDGKR 111

Query: 131 AATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP-----TVT-VVLSNIRVIAIDHNID 184
             T  + ++    G+I P D VDV +  + + RKP     T+T V+L  +++ A DH  D
Sbjct: 112 VFTTSVDMTKTHSGLILPGDFVDVYV--TFTARKPEGGMSTITKVILERVKIFATDHLTD 169

Query: 185 ---SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQE 241
              ++   +     +L L+P +   L  A+   ++ L LR+ +D    S++  DV    +
Sbjct: 170 VGGTESNQVKSKNISLLLSPREGAMLKLAEKKGEVHLALRAQSD----STDSEDVQFDDD 225

Query: 242 EGKEIQIIKAGVIVNKDGE 260
           E  E+  I+    + KDGE
Sbjct: 226 ELAEVFSIEGSEYL-KDGE 243


>gi|153834044|ref|ZP_01986711.1| Flp pilus assembly protein CpaB [Vibrio harveyi HY01]
 gi|148869599|gb|EDL68589.1| Flp pilus assembly protein CpaB [Vibrio harveyi HY01]
          Length = 251

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 113/222 (50%), Gaps = 16/222 (7%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEV--ITENPAKFINVLISKGDLAVGMVVTP 63
           +M +++S VF L A +IA + +   +  T E+  +  +P     VL++  +L  G     
Sbjct: 7   VMLLLLSIVFGLAAVLIAKQWIDGQNQPTVELEEVERHP-----VLVAAMELEPG----- 56

Query: 64  NILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LS 122
            ILE      + +   +I++     + Q L G +V   I  G+ +   +L   G G  L+
Sbjct: 57  TILEEKHLTTKLMEVDWIEESTLKVSEQAL-GRIVANTIYSGEMVNPNRLALPGEGATLA 115

Query: 123 SLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT-VVLSNIRVIAIDH 181
           +L+P+ KRA T+ ++    V G + P + VD++   S  + K   T  VL NI+V+A+D 
Sbjct: 116 ALIPENKRAITIRVNDVIGVAGFLLPGNKVDILNTISSGKGKSASTKTVLKNIKVLAVDQ 175

Query: 182 NIDS-DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRS 222
              + D + ++    TLE+TP +A+ L++  S  K+ L LR+
Sbjct: 176 TAKTNDNKPVIVRAVTLEVTPKEAEKLLSENSKGKIQLALRN 217


>gi|326797326|ref|YP_004315146.1| Flp pilus assembly protein CpaB [Marinomonas mediterranea MMB-1]
 gi|326548090|gb|ADZ93310.1| Flp pilus assembly protein CpaB [Marinomonas mediterranea MMB-1]
          Length = 315

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 119/277 (42%), Gaps = 51/277 (18%)

Query: 9   IVVSG--VFALVAGIIAMRLVS--PHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPN 64
             VSG  +FAL   ++   L++  P      +V+ + P  +  VL++   L  G  +   
Sbjct: 7   FFVSGALIFALGGALLGSALLTSEPPPKTVTKVVPKKP-NYRAVLVASNTLRPGDFMNAT 65

Query: 65  ILEWVA----FPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
            +EW A    +PE+  F   +D+  Q      L G  V  PI  G  +  + LV  G  G
Sbjct: 66  SIEWRAADKQYPEDAFFLKGLDEKSQ------LYGATVTQPIPAGTELESDLLVSPGEPG 119

Query: 121 L-SSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-----VRSLSERKPTVTV----- 169
             +S+L  G RA  +   + ++  G+I   D VDV++         ++  P  T+     
Sbjct: 120 FIASVLKPGMRAVAIPADVVTSNAGLISGGDRVDVILSLKRDYEQGADNNPLATIKLPKL 179

Query: 170 ----VLSNIRVIAIDHNI------------------DSDERVLVGSTATLELTPMQAKAL 207
               +L N+RV++++  +                  DS++R     T TLE+ P   + L
Sbjct: 180 ASQTLLRNVRVLSLNGTLDAFREKVQKVESKKEKKTDSNKRKSY-ETVTLEVLPKDVERL 238

Query: 208 VAAQSVAKLSLVLRSI--ADLNPSSSEDSDVWDVQEE 242
             A+ V  L L LRS+   DL  S+S + D  + Q E
Sbjct: 239 TVAREVGILQLALRSVQGQDLALSTSPEKDSKESQSE 275


>gi|126737255|ref|ZP_01752990.1| CpaB family protein [Roseobacter sp. SK209-2-6]
 gi|126721840|gb|EBA18543.1| CpaB family protein [Roseobacter sp. SK209-2-6]
          Length = 285

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 118/247 (47%), Gaps = 23/247 (9%)

Query: 6   LMGIVVSGVFALVAGIIAM--RLVSPHHV-------QTEEVITENPAKFINVLISKGDLA 56
           + G+V+    AL  G + M  + +S H            EVI   P   I V + +  L 
Sbjct: 4   VFGLVLIVGVALAGGAVMMAKKYISAHQAALAHERANRAEVI---PTTEIYVAVKQ--LK 58

Query: 57  VGMVVTPNILEWVAFPEENVFDGFIDDVHQ--PNAMQELDGVLVRVPILKGDPIRLEKLV 114
            G  +T   ++ V +P E++ +G  +   +  P A      V++R+ I   + I   K+ 
Sbjct: 59  YGERLTAEAVKKVRWPTESLPEGAFEMEAELFPTAKPSDQRVVLRM-IEPNEAILAVKVT 117

Query: 115 DRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVV---MVRSLSERKPTVT-V 169
             G + G++S L +G RA  + + ++S V G ++P D VDV    + R  S +   +T +
Sbjct: 118 KPGEDAGITSQLQRGMRAFAIKVDVTSGVSGFLRPGDRVDVYWTGVARGASGQDGEMTRL 177

Query: 170 VLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNP 228
           + S+I +IA+D +  +D    ++  T T+ + P Q  AL  AQ+  +LSL L    D   
Sbjct: 178 IESSIELIAVDQSASTDVNGAMIARTVTVAVQPEQVAALAQAQTTGRLSLSLVGAGDDTV 237

Query: 229 SSSEDSD 235
           +S+ + D
Sbjct: 238 ASAIEVD 244


>gi|148976663|ref|ZP_01813350.1| Flp pilus assembly protein CpaB [Vibrionales bacterium SWAT-3]
 gi|145964014|gb|EDK29272.1| Flp pilus assembly protein CpaB [Vibrionales bacterium SWAT-3]
          Length = 249

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 69/134 (51%), Gaps = 2/134 (1%)

Query: 91  QELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPN 149
           +EL G +V   I  G+ +   +    G G  L++L+P+ KRA T+ +     V G + P 
Sbjct: 83  EELIGKVVANTIYAGEVLHKLRFTVPGEGSTLAALIPENKRAVTIRVDDVIGVAGFLLPG 142

Query: 150 DHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALV 208
           + VD++   S  +       VL +I+V+A+D    + E   ++    TLE+TP  A+ L+
Sbjct: 143 NKVDILNTVSYGKNSAATQTVLKDIKVLAVDQTARTKENSPIIVRAVTLEVTPKDAEKLL 202

Query: 209 AAQSVAKLSLVLRS 222
            A+S   + L LR+
Sbjct: 203 TAKSKGSIQLTLRN 216


>gi|87199533|ref|YP_496790.1| Flp pilus assembly CpaB [Novosphingobium aromaticivorans DSM 12444]
 gi|87135214|gb|ABD25956.1| Flp pilus assembly CpaB [Novosphingobium aromaticivorans DSM 12444]
          Length = 260

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 73/140 (52%), Gaps = 10/140 (7%)

Query: 102 ILKGDPIRLEKLVDR-GNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL 160
           I  G+PI   ++    G   L++ LP G  A ++ IS  + V G ++P D VD+++ R +
Sbjct: 58  IAAGEPILASRVTGTDGRATLAAALPPGMVAVSLPISDVTGVSGFVRPGDLVDIILTRQI 117

Query: 161 -----SERKPTVTVVLSNIRVIAIDHNID-SDERVLVGSTATLELTPMQAKALVAAQSVA 214
                 ++     V+L  + V+ ID   D S    +VG TAT+++  + A+ L  A+ + 
Sbjct: 118 PGEGAGQQDKMTDVILRQVAVLGIDQVADKSKTEAVVGKTATVQVDTLGAQKLALARELG 177

Query: 215 KLSLVLRSIA---DLNPSSS 231
            LSL LRS+A   D  P+ +
Sbjct: 178 TLSLGLRSLASVEDTGPTRT 197


>gi|84387246|ref|ZP_00990267.1| Flp pilus assembly protein CpaB [Vibrio splendidus 12B01]
 gi|84377893|gb|EAP94755.1| Flp pilus assembly protein CpaB [Vibrio splendidus 12B01]
          Length = 249

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 75/146 (51%), Gaps = 4/146 (2%)

Query: 81  IDDVHQPNAMQELD--GVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDIS 137
           +D +++ N   + D  G +V   I  G+ +   +    G G  L++L+P+ KRA T+ + 
Sbjct: 71  VDWINENNYSDKADLIGKVVANTIYAGEVLHKLRFTVPGEGSTLAALIPENKRAVTIRVD 130

Query: 138 ISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDERV-LVGSTAT 196
               V G + P + VD++   S  +       VL +I+V+A+D    + E   ++    T
Sbjct: 131 DVIGVAGFLLPGNKVDILNTISYGKNSAATQTVLKDIKVLAVDQTAKTKENSPIIVRAVT 190

Query: 197 LELTPMQAKALVAAQSVAKLSLVLRS 222
           LE+TP +A+ L+ A+S   + L LR+
Sbjct: 191 LEMTPKEAEKLLTAKSKGSIQLTLRN 216


>gi|297581607|ref|ZP_06943529.1| flp pilus assembly protein CpaB [Vibrio cholerae RC385]
 gi|297534014|gb|EFH72853.1| flp pilus assembly protein CpaB [Vibrio cholerae RC385]
          Length = 294

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 106/223 (47%), Gaps = 42/223 (18%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEEN---VFDGFIDDVHQPNAMQELDGVLV-----R 99
            L +K  +  G ++      WV    E+   + D F+++  Q +A   L+G L+      
Sbjct: 52  ALAAKYPVQAGALLRAQDFHWVELGSEHNASLNDLFLENFSQLDA---LEGSLITRHQDE 108

Query: 100 VPILK-GDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-- 156
             +L   D IR E+     +  +S++L  GKRA T++++ +    G+++P + VDVV+  
Sbjct: 109 SQLLNVNDIIRPEQ-----SHYVSAMLAPGKRAVTLELTQAGVSHGLLRPGNWVDVVLTN 163

Query: 157 ---VRSLSERKPTVTVVLSNIRVIAIDH---------------NIDSDERVLVGSTATLE 198
              V S S  K   T VL  +R++AI                 N +S E V V    T E
Sbjct: 164 ESNVESASTPKYAATTVLEGVRLLAIGSVVTEFIAKQSVENGANPNSYEPVRV----TFE 219

Query: 199 LTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDV-WDVQ 240
           ++P  AK L+ AQ +  LSLVLRS  + + +  E+  + WD Q
Sbjct: 220 VSPSDAKHLLLAQRLGVLSLVLRSQFESDLAEMEEGSILWDEQ 262


>gi|148261012|ref|YP_001235139.1| SAF domain-containing protein [Acidiphilium cryptum JF-5]
 gi|326404412|ref|YP_004284494.1| putative pilus assembly protein [Acidiphilium multivorum AIU301]
 gi|146402693|gb|ABQ31220.1| SAF domain protein [Acidiphilium cryptum JF-5]
 gi|325051274|dbj|BAJ81612.1| putative pilus assembly protein [Acidiphilium multivorum AIU301]
          Length = 275

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 57/191 (29%), Positives = 93/191 (48%), Gaps = 15/191 (7%)

Query: 44  KFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPIL 103
           K + +L +   LA G ++ P        P   V    + D   P       G +VR  + 
Sbjct: 37  KMVALLATGRPLAPGTLLQPADFVAENRPPSKVPADAVPDT--PANRAAYTGAMVRHRLS 94

Query: 104 KGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE 162
            GD +  + ++  G+ G L+++L  G RA ++ +   +   G+I P DHVD+++ + L+ 
Sbjct: 95  AGDLLATDIVIRPGDHGFLAAVLQPGMRAVSVGVDAITGAAGLIWPGDHVDLLLTQHLTG 154

Query: 163 RK--PTVTV----VLSNIRVIAIDHNI---DSDERVLVGSTA---TLELTPMQAKALVAA 210
               PT  V    VLS++RVIAID  +    S       +TA   TLE+TP QA+ +  A
Sbjct: 155 ANLLPTQRVAAETVLSDVRVIAIDQRLVQGASGTHPAAKNTARTVTLEVTPEQAERVEVA 214

Query: 211 QSVAKLSLVLR 221
             +  LSL++R
Sbjct: 215 AHLGPLSLIVR 225


>gi|86137992|ref|ZP_01056568.1| CpaB family protein [Roseobacter sp. MED193]
 gi|85825584|gb|EAQ45783.1| CpaB family protein [Roseobacter sp. MED193]
          Length = 286

 Score = 59.7 bits (143), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 94/190 (49%), Gaps = 14/190 (7%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDG---FIDDVHQPNAMQELDGVLVRVPIL 103
           +V ++   L  G  +T + +  V +P + + +G    ++ +  P    +L  VL     +
Sbjct: 49  DVFVATKQLKYGERLTEDAVRKVRWPSDAIPEGAFTTLETLFPPANPGDLRVVLR---TM 105

Query: 104 KGDPIRLE-KLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS 161
           + D   LE KL + G + G++S L +G RA  + + +SS V G ++P DHVDV     + 
Sbjct: 106 EKDEALLEAKLTNPGQDAGITSQLQRGMRAFAISVDVSSGVSGFLRPGDHVDVYWTGGVR 165

Query: 162 E----RKPTVTVVLS-NIRVIAIDHNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAK 215
           +    R   +T ++  +I +IA+D +  ++     +  T T+ + P Q  AL  AQ+  +
Sbjct: 166 DGSGGRGQEITRLIEPSIELIAVDQSASTETNGATIARTVTVAVQPEQVAALAQAQTTGR 225

Query: 216 LSLVLRSIAD 225
           LSL L    D
Sbjct: 226 LSLSLVGAGD 235


>gi|85859140|ref|YP_461342.1| flp pilus assembly protein [Syntrophus aciditrophicus SB]
 gi|85722231|gb|ABC77174.1| flp pilus assembly protein [Syntrophus aciditrophicus SB]
          Length = 295

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 99/210 (47%), Gaps = 18/210 (8%)

Query: 26  LVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVH 85
           L++ + +Q        P +   V+++  D+    V+T +++    F +E++ +G+  D  
Sbjct: 22  LLAYNWIQKTATAKAKPQEMQKVVVAAFDVPWSTVLTKDMVRTATFLKESLPNGYYLDPA 81

Query: 86  QPNAMQELDGVLVRVPILKGDPIRLEKLVDRG--NGGLSSLLPKGKRAATMDISISSAVG 143
           Q      + G  V  PI   +PI   +L       GG+++++   KRA ++ +     V 
Sbjct: 82  Q------IVGRTVIQPIRTNEPITEARLAPTSIRTGGVAAVITPSKRAMSVKVDKVVGVS 135

Query: 144 GMIKPNDHVDVVMVRSLSERK-----PTVTVVLSNIRVIAIDHNIDSD---ERVLVGSTA 195
           G I P + VDV++  +L+E++     P   +VL NI V+A     +     E+       
Sbjct: 136 GYIHPGNRVDVLV--TLNEQRGEVTAPVTKIVLENILVLASGPEFNETKKGEKPANVDVI 193

Query: 196 TLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           TLE+TP + + L  A +  K+ L LR+  D
Sbjct: 194 TLEVTPEEGEKLALASTEGKIQLALRNFGD 223


>gi|319783875|ref|YP_004143351.1| Flp pilus assembly protein CpaB [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169763|gb|ADV13301.1| Flp pilus assembly protein CpaB [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 301

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 101/219 (46%), Gaps = 24/219 (10%)

Query: 28  SPHHVQTEEVITENPA------KFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFI 81
           S     +EE  +  PA      +F  ++++   L  GM +    L  + + +E+V  G  
Sbjct: 22  SQAKADSEEKTSSIPAPVVPKVEFKTIVVANAPLRYGMELDRAQLSEIPWSQESVPQGAF 81

Query: 82  DDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISS 140
             +   NA+      +V  PI   +P+ L KL    G   LS+++  G RA T+     +
Sbjct: 82  TTI---NALLADGSRVVLSPIEVNEPVLLTKLSGPNGRATLSNMMTPGMRAVTIRTDEIA 138

Query: 141 AVGGMIKPNDHVDVVMVRSLSERKP-------------TVTVVLSNIRVIAIDHNIDSDE 187
            VGG + P D VDVV+ R   E +              T  +V+++ +V+++    D  +
Sbjct: 139 GVGGFVTPGDRVDVVLTRDAGEIQEVAKNAQGAAGSTITSEIVVADAKVLSVGQGADERQ 198

Query: 188 RV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
               + ++ T+E+T   A+ +  A++V  LSL LRS ++
Sbjct: 199 TTPQISNSVTIEVTTDGAQKVALARTVGTLSLSLRSASE 237


>gi|83950065|ref|ZP_00958798.1| CpaB family protein [Roseovarius nubinhibens ISM]
 gi|83837964|gb|EAP77260.1| CpaB family protein [Roseovarius nubinhibens ISM]
          Length = 281

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 94/194 (48%), Gaps = 16/194 (8%)

Query: 41  NPA-KFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQ--PNAMQELDGVL 97
            PA K ++V ++K  LA G  +T   +  V +P   + +G    V    P   +E   VL
Sbjct: 34  QPAIKTVDVYVAKRALAYGDRLTKEDVVQVKYPARALPEGVFQTVEDLFPEGQKEFRTVL 93

Query: 98  VRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM 156
               + K + +   K+   G + G+ + L +GKRA  + +  +S V G ++P D VDV  
Sbjct: 94  R--AMEKYEALLGVKVTAPGEDAGILTKLERGKRAFAIKVDTTSGVAGFLRPGDRVDVYW 151

Query: 157 --------VRSLSERKPTVT-VVLSNIRVIAIDHNI-DSDERVLVGSTATLELTPMQAKA 206
                   +R+  +    VT ++L+ + +IA+D +  D     ++  T T+ ++P +  A
Sbjct: 152 TGNTGRGGLRTEGDSTGDVTKLILTGVNLIAVDQSSNDQTTGAILARTVTVAVSPQEVAA 211

Query: 207 LVAAQSVAKLSLVL 220
           L  AQ+  KL+L L
Sbjct: 212 LAQAQATGKLTLSL 225


>gi|157375509|ref|YP_001474109.1| Flp pilus assembly protein CpaB-like protein [Shewanella sediminis
           HAW-EB3]
 gi|157317883|gb|ABV36981.1| Flp pilus assembly protein CpaB-like protein [Shewanella sediminis
           HAW-EB3]
          Length = 274

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 81/150 (54%), Gaps = 8/150 (5%)

Query: 94  DGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHV 152
           +G++V+  +  G+ +R E++  +G G  L+SL+    RA T+ ++    V G + P + V
Sbjct: 82  EGMVVKQNLYAGEVLRSERITVKGEGSTLASLISPQMRAVTIRVNDVVGVAGFLLPGNRV 141

Query: 153 DVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQ 211
           DV+ +     R  T  VVL+N++++AID    +DE +  +    TLEL   QA+ L+ A+
Sbjct: 142 DVLNLFKRGGRLQT-DVVLANVKILAIDQRSSNDENKPKLVRAVTLELNLEQAEVLMIAK 200

Query: 212 SVAKLSLVLRSIADLNPSSSEDSDVWDVQE 241
              KL L LR     NP+ S   ++  + E
Sbjct: 201 GRGKLQLALR-----NPNDSTKVELALINE 225


>gi|254512153|ref|ZP_05124220.1| Flp pilus assembly protein CpaB [Rhodobacteraceae bacterium KLH11]
 gi|221535864|gb|EEE38852.1| Flp pilus assembly protein CpaB [Rhodobacteraceae bacterium KLH11]
          Length = 290

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 108/233 (46%), Gaps = 28/233 (12%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITENPAKF---------------------INVLISK 52
           VF LV  II + L         E IT+N AK                      ++VL+S 
Sbjct: 4   VFGLVL-IIGVALAGGAVYMAREYITDNQAKLAQERKLREEALANAKAGLVPTVDVLVSN 62

Query: 53  GDLAVGMVVTPNILEWVAFPEENVFDG-FIDDVHQPNAMQELDGVLVRVPILKGDPIRLE 111
             L  G  +T   +  V +PE  + +G F++        ++ +  ++R  + K + I   
Sbjct: 63  RSLKYGEQLTQEDIRVVQWPENAIPEGTFVEIAALFPDTRDNERFVLRA-MEKDEAIMAV 121

Query: 112 KLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL-SERKPTVT- 168
           K+   G   GL S LPKG RA  + + ++S V G ++P D VDV    ++ SE +  +T 
Sbjct: 122 KVTAPGETAGLRSQLPKGMRAFAISVDVASGVSGFLRPGDTVDVYWTGAVRSEGRGEITR 181

Query: 169 VVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVL 220
           +VL+NI ++A+D     D     +  T T+  TP Q  AL  AQ+  ++SL L
Sbjct: 182 LVLTNIELVAVDQTAGLDVTGTTIARTVTVAATPQQIAALAQAQNTGRMSLAL 234


>gi|86147468|ref|ZP_01065780.1| Flp pilus assembly protein CpaB [Vibrio sp. MED222]
 gi|85834761|gb|EAQ52907.1| Flp pilus assembly protein CpaB [Vibrio sp. MED222]
          Length = 249

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 97/221 (43%), Gaps = 15/221 (6%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEV--ITENPAKFINVLISKGDLAVGMVVTP 63
            +  ++S VF L A   A + +      T EV  +  +P    +  I  G +     +T 
Sbjct: 7   FLLFLLSVVFGLAAVFFAKQWMDNQVQPTIEVEEVERHPVVVASQEIEAGTVIEDQYLTT 66

Query: 64  NILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LS 122
            ++E     E N  D             EL G +V   I  G+ +   +    G G  L+
Sbjct: 67  KLMEVDWINENNYSD-----------QNELIGKVVANTIYAGEVLHKLRFTVPGEGSTLA 115

Query: 123 SLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHN 182
           +L+P+ KRA T+ +     V G + P + VD++   S  +       VL +I+V+A+D  
Sbjct: 116 ALIPENKRAVTIRVDDVIGVAGFLLPGNKVDILNTVSYGKNSAATRTVLKDIKVLAVDQT 175

Query: 183 IDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLRS 222
             + E   ++    TLE+TP  A+ L+ A+S   + L LR+
Sbjct: 176 ARTKENSPIIVRAVTLEVTPKDAEKLLTAKSKGSIQLTLRN 216


>gi|121534342|ref|ZP_01666166.1| SAF domain [Thermosinus carboxydivorans Nor1]
 gi|121307112|gb|EAX48030.1| SAF domain [Thermosinus carboxydivorans Nor1]
          Length = 286

 Score = 58.9 bits (141), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 109/229 (47%), Gaps = 25/229 (10%)

Query: 7   MGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNIL 66
           M +   GV A +A ++++      +   +E   + P + + V+++K D+     +T  ++
Sbjct: 1   MKLSTKGVLA-IALVLSLATTGLIYKYLQEATQKTPQEGVVVVVAKVDIPPKTKITAEMV 59

Query: 67  EWVAFPEENVFDGFIDDVHQPNAMQELD---GVLVRVPILKGDPIRLEKLVDRG-NGGLS 122
                P E V         QP A++EL    G + R  I+ G+ I   +LV +G + G +
Sbjct: 60  ATAKVPAEYV---------QPGAVRELKTAVGAIAREHIVAGEQIAERRLVIQGKSAGFT 110

Query: 123 SLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT-VVLSNIRVIAIDH 181
            ++P  KRA T+ ++  + V G +KP D+VDVV     +     V+ ++L N+ V+A + 
Sbjct: 111 GIIPPDKRAVTIAVTEVTGVAGFVKPGDYVDVVATFDQNTVGDNVSQIILQNVLVLAANR 170

Query: 182 NI---------DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
           +          D  E +   +T TL +TP +   L  A+   K+ L LR
Sbjct: 171 DAEAGAADGAKDKKEAIKT-ATVTLAVTPDEVAQLALAEDKGKVRLALR 218


>gi|13471033|ref|NP_102602.1| hypothetical protein mll0900 [Mesorhizobium loti MAFF303099]
 gi|14021777|dbj|BAB48388.1| mll0900 [Mesorhizobium loti MAFF303099]
          Length = 308

 Score = 58.9 bits (141), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 98/203 (48%), Gaps = 30/203 (14%)

Query: 44  KFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVL------ 97
           +F  ++++K  L  G  +    L  + +P++++  G         A   +DG+L      
Sbjct: 51  EFKTIVVAKAPLRYGQELDRAKLIEIPWPQDSLPQG---------AFATIDGLLGEGNRI 101

Query: 98  VRVPILKGDPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM 156
           V  PI   +P+ L KL    G   LS++L  G RA T+     + VGG + P D VDVV+
Sbjct: 102 VLSPIEVNEPVLLTKLSGPNGRATLSNMLTPGMRAVTIRTDEIAGVGGFVTPGDRVDVVL 161

Query: 157 VRSLSERK-----------PTVT--VVLSNIRVIAIDHNIDSDERV-LVGSTATLELTPM 202
            R   E +            TVT  +V+++ +V+++    D  +    + ++ T+E+T  
Sbjct: 162 TRDAGEIQEVAKNAQGAAGSTVTSEIVVADAKVLSVGQGADERQTTPQITNSVTIEVTTE 221

Query: 203 QAKALVAAQSVAKLSLVLRSIAD 225
            A+ +  A++V  LSL LRS ++
Sbjct: 222 GAQKVALARTVGTLSLSLRSASE 244


>gi|148253053|ref|YP_001237638.1| hypothetical protein BBta_1513 [Bradyrhizobium sp. BTAi1]
 gi|146405226|gb|ABQ33732.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 309

 Score = 58.9 bits (141), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 103/233 (44%), Gaps = 27/233 (11%)

Query: 35  EEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELD 94
           E  +   PA    VL++   +A+G ++    + W       V  G++       A  E  
Sbjct: 38  ERSVESRPA----VLVAARTIALGTLLRKEDIAWKDVMPGEVRPGYLMRGQVSEA--EFL 91

Query: 95  GVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVD 153
           G + R    + +P+   + V  G+   L+++L  G RA ++ +  + +  GM  P D VD
Sbjct: 92  GAISRRNFAQDEPLIASEFVKPGDRQFLAAVLKPGSRAISIFVDAAQSAAGMALPGDRVD 151

Query: 154 VVMVRSLSE------RKPTVTVVLSNIRVIAIDHNIDSDERVL--------VGSTATLEL 199
           V++ +S  E      RK     +L ++RVIAID ++     V         +  T TLEL
Sbjct: 152 VILTQSFGEQATDPGRKTVSETMLRDVRVIAIDQSLTPSTNVAAAISTEARIPKTVTLEL 211

Query: 200 TPMQAKALVAAQSVAKLSLV---LRSIADLNP-SSSEDSDVW--DVQEEGKEI 246
              QA+AL+ A  + K  L    L  +A  +P   +E   VW  DV    +E+
Sbjct: 212 LERQAEALMVAAQLGKFQLAVLPLERVAVEHPEEQTEAGPVWASDVSPALREV 264


>gi|294676058|ref|YP_003576673.1| Flp pilus assembly protein CpaB [Rhodobacter capsulatus SB 1003]
 gi|294474878|gb|ADE84266.1| Flp pilus assembly protein CpaB [Rhodobacter capsulatus SB 1003]
          Length = 291

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 107/235 (45%), Gaps = 22/235 (9%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITE--NPAKFINVLISKGDLAVGMV 60
           L  ++G+ ++G+    A  +A + +S   V+ + ++ E  N  + ++V++ +  LA G  
Sbjct: 7   LVLVLGVALAGL----AVYMAQQQISQFQVERDRLVAEQRNAPQLVDVVVLRRPLAYGER 62

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDP------------I 108
            T   L  +     ++  G    V  P    E        P  +  P            I
Sbjct: 63  FTAADLGVIKMQVGHLPAGIFHSVATPQGAPEEAQAASVFPGGETRPRAALRAYDAYEAI 122

Query: 109 RLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTV 167
              K+   G + G+++ L    RA T+ +  ++ V G ++P D VDV     ++  + T 
Sbjct: 123 LANKITAPGVDAGITASLSPNMRAFTISVDATTGVSGFLRPGDRVDVYWSGEVNGERVT- 181

Query: 168 TVVLSNIRVIAIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVL 220
            ++ +N+R+IAID + D+D  E   +  T T E+TP Q  +L  AQ   +L+L L
Sbjct: 182 KLIDTNLRLIAIDQSADADRAEETQLAKTVTAEVTPEQVASLTLAQGTGELTLSL 236


>gi|218887828|ref|YP_002437149.1| Flp pilus assembly protein CpaB [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758782|gb|ACL09681.1| Flp pilus assembly protein CpaB [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 274

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 108/233 (46%), Gaps = 17/233 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+ + L+ I ++ V ALVAG++  R +  +     ++      + + + ++  D+  G  
Sbjct: 1   MRASSLIQISLALVLALVAGVLVFRFMQVNRAAAPQMAAP---EQVELAVAAADVPRGAK 57

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG--N 118
           +    ++   F + +   G       P       G ++   +  G+PI   +L+  G  +
Sbjct: 58  LAAEQIKLAPFLKSSAPSGAFTKDTLPV------GRVLSSAVAAGEPITEARLLQDGASH 111

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV---RSLSERKPTVTVVLSNIR 175
           GG+S+L+  G RA  +  +    + G I+P + VDV++     +  + K    +VL N+R
Sbjct: 112 GGVSTLIAPGMRAVAVKGNKVLGLSGFIRPGNRVDVLVTLDDETREKSKSRTKLVLENVR 171

Query: 176 VIAIDHNIDSDERVLVGST---ATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           V+A    +  +      S+    TLE++P QA+ L  A S  +L   LR+ AD
Sbjct: 172 VLATGTELKQEGDDTSTSSVDVYTLEISPPQAEPLALAASRGELHFALRNPAD 224


>gi|89068016|ref|ZP_01155433.1| CpaB family protein [Oceanicola granulosus HTCC2516]
 gi|89046255|gb|EAR52312.1| CpaB family protein [Oceanicola granulosus HTCC2516]
          Length = 281

 Score = 58.5 bits (140), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 91/191 (47%), Gaps = 7/191 (3%)

Query: 35  EEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQ--PNAMQE 92
           E  +       + V      +  G  +TP+ +  V + E  + DG      +  P    +
Sbjct: 37  ERAVAAQATPTVEVYAVTRQIGYGEQLTPDDVTLVKYAEPFLPDGVFRAEEELFPEGDTQ 96

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDH 151
           L  VL   P+   +P+   K+ + G + G++S L +G RA  + + ++S V G ++P D 
Sbjct: 97  LRVVLR--PMEVNEPVLAVKVTEPGEDAGITSRLGRGMRAFAIRVDVASGVSGFLRPGDK 154

Query: 152 VDVVMVRSLSERKPTVT-VVLSNIRVIAIDHNID-SDERVLVGSTATLELTPMQAKALVA 209
           VD+      S     VT ++ SN+ +IAID + D S     +  T T+E+TP Q  AL  
Sbjct: 155 VDIYWTGRNSRGGEEVTKLIESNVNLIAIDQSADGSALNTTIARTVTVEITPQQVAALAQ 214

Query: 210 AQSVAKLSLVL 220
           AQS  +LSL L
Sbjct: 215 AQSTGRLSLSL 225


>gi|217978827|ref|YP_002362974.1| Flp pilus assembly protein CpaB [Methylocella silvestris BL2]
 gi|217504203|gb|ACK51612.1| Flp pilus assembly protein CpaB [Methylocella silvestris BL2]
          Length = 338

 Score = 58.5 bits (140), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 64/119 (53%), Gaps = 16/119 (13%)

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE-----RKPTVTVVLSNIR 175
           L+++L  G+RA ++ +  + +  G++ P D+VDV++ +   +     R+     VL N+R
Sbjct: 122 LAAVLKPGRRALSVSVDAAQSAAGLVLPGDYVDVILTQDFGDKIDIGRRTVSETVLWNVR 181

Query: 176 VIAIDHNIDSD-----ERVLVGS------TATLELTPMQAKALVAAQSVAKLSLVLRSI 223
           VIA+D ++D+      E   +G+      T TLE+   QA+ L+ A  + K  L +R +
Sbjct: 182 VIAVDQSLDAQTSTVAEHTALGAESHIPKTVTLEMFERQAETLLVAAQLGKFQLAVRPL 240


>gi|255597441|ref|XP_002536774.1| conserved hypothetical protein [Ricinus communis]
 gi|223518588|gb|EEF25608.1| conserved hypothetical protein [Ricinus communis]
          Length = 302

 Score = 58.5 bits (140), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 104/224 (46%), Gaps = 27/224 (12%)

Query: 17  LVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENV 76
           L+A I+   + S  H   + V T      + + +S  DL  G+++  + L W   P  NV
Sbjct: 16  LIALIVRTVVASISHPAAQAVST------VKIRVSAADLPQGLLLRDDDLAWKDVPAGNV 69

Query: 77  FDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRGNGGLSSLLPKGKRAATMD 135
               I   + PNA+ EL G L+R     G  +  + ++     G L++ L    RA ++ 
Sbjct: 70  PAAAIV-ANAPNAI-ELKGALLRHAAAAGTVLGPDDVILPSAPGFLAATLKPDMRAVSVA 127

Query: 136 ISISSAVGGMIKPNDHVDVVMVRSLSER--KPTVTV----VLSNIRVIAIDHNI------ 183
           I   S   G+I+P D+VD+++ + +  R   P + V    V+  +RV+A+   +      
Sbjct: 128 IDDVSGNAGLIQPGDYVDLLLTQQMDHRTDSPDLAVSSETVVERVRVLAVGSELSRPKTS 187

Query: 184 ---DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
              D++ R     T TLE+TP  A+ +  A  +  LS  LRS A
Sbjct: 188 DAPDANNR---ARTVTLEVTPHMAEVVSVAARLGSLSFALRSFA 228


>gi|239908022|ref|YP_002954763.1| Flp pilus assembly CpaB domain protein [Desulfovibrio magneticus
           RS-1]
 gi|239797888|dbj|BAH76877.1| Flp pilus assembly CpaB domain protein [Desulfovibrio magneticus
           RS-1]
          Length = 300

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 115/248 (46%), Gaps = 20/248 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAK-FINVLISKGDLAVGM 59
           MK   +  I+++ + AL AG++ +R +    V+  +V    PA   + V+++   +  G 
Sbjct: 1   MKTKAVPHIILAVILALTAGVLTIRWLG--SVRAPKVEQAKPAAPKVEVVVAARAIPKGG 58

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-- 117
            +  ++++   F  E    G + DV      QE  G +    I   DPI  +KL+ +G  
Sbjct: 59  RLDASMVKSKGFEAEAAPQGALRDV------QEAYGRISARDISPDDPITPDKLMPKGAT 112

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK---PTVTVVLSNI 174
           +GGL + +  GKRA T+  S     GG+I P   VDV++   +   K       ++L N+
Sbjct: 113 SGGLDASVAPGKRAFTIKGSKIMGSGGLITPGCRVDVLVTYPVPNGKNDEKINKIILENV 172

Query: 175 RVIAI----DHNIDSDERVLVGST--ATLELTPMQAKALVAAQSVAKLSLVLRSIADLNP 228
            ++      +  I  D R  + +T   TL + P +A+ L  A     L L LR+  D + 
Sbjct: 173 PILTTGTERETKIGKDGREELANTDFYTLMVAPEEAERLALASDTGSLHLALRTPGDADI 232

Query: 229 SSSEDSDV 236
            ++  +DV
Sbjct: 233 VTTSGADV 240


>gi|302391028|ref|YP_003826848.1| Flp pilus assembly protein CpaB [Acetohalobium arabaticum DSM 5501]
 gi|302203105|gb|ADL11783.1| Flp pilus assembly protein CpaB [Acetohalobium arabaticum DSM 5501]
          Length = 278

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 108/216 (50%), Gaps = 13/216 (6%)

Query: 35  EEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELD 94
           +E + E P    +V+++K ++     +T + ++    P+E V    +  + Q      L 
Sbjct: 30  QEAVKEQPK--ASVVVAKQNIEPREQITRSKVQLKQVPQETVHSQAVTSISQAVEKFALK 87

Query: 95  GVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDV 154
            ++    +LK   +  E++    + GL+  L   KRA T+ ++  S V G + P D+VDV
Sbjct: 88  DIISGEQLLKPRLLGKEEV----SSGLAFNLADDKRAVTVPVTEVSGVAGFLTPGDYVDV 143

Query: 155 VMVRSLSERKPTVT-VVLSNIRVIAIDHNI--DSDERVLVGSTATLELTPMQAKALVAAQ 211
           V V S  E + TV   VL  ++V+A+  ++  + D++  V  + TL +   +A+ LV A 
Sbjct: 144 VSVFSTYEAQQTVAKTVLQKVKVLAVAQDMVRERDQKPKVTKSVTLGVGLAEAEKLVLAD 203

Query: 212 SVAKLSLVLRSIADLNPSSSE----DSDVWDVQEEG 243
              ++ LVLRS  + + S S     +  V +++EEG
Sbjct: 204 RKGEIRLVLRSAQNESFSMSNGVKFEELVGNLEEEG 239


>gi|261251599|ref|ZP_05944173.1| flp pilus assembly protein RcpC/CpaB [Vibrio orientalis CIP 102891]
 gi|260938472|gb|EEX94460.1| flp pilus assembly protein RcpC/CpaB [Vibrio orientalis CIP 102891]
          Length = 279

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 118/248 (47%), Gaps = 29/248 (11%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAK-FINVLISKGDLAVGM 59
           M   RLM  ++S + + V   IA+ L++P   Q+E+   +  A+ F  VL++K  + VG 
Sbjct: 1   MTAKRLM--LLSLILSAVG--IAILLLNPSKPQSEQ--RQAAAEVFKRVLVAKQGVVVGQ 54

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQ-ELDGVLVRVPILKGDPIRLEKLVDRGN 118
             T N+ +W +  E+ + + ++D + +    + +L   +    I  G  +  +      +
Sbjct: 55  PYTLNMFQWKSVSEQEL-NNYLDFISEEEFSRLDLKPGIAHTAIQSGQVMSSDDFETPAS 113

Query: 119 G-GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP---------TVT 168
           G  ++  +  G RA ++ +   +A  G ++P D VD++++ S  E             VT
Sbjct: 114 GISMAFKVQSGHRAISVPVDAVTANSGFVQPGDKVDILLLGSQVEELKKYDNQVAGLYVT 173

Query: 169 VVLSNIRVIAIDHNIDSDE----RVLVG------STATLELTPMQAKALVAAQSVAKLSL 218
            +  ++RV+A +   D  +    R   G      S+ +LE+TP QA  +V A  + KL+L
Sbjct: 174 TIAIDVRVLAFNQYADPQDFQKNRSAYGADIPDNSSVSLEVTPEQATQIVLANQIGKLTL 233

Query: 219 VLRSIADL 226
            LR   ++
Sbjct: 234 SLRGAGEM 241


>gi|147677784|ref|YP_001211999.1| flp pilus assembly protein CpaB [Pelotomaculum thermopropionicum
           SI]
 gi|146273881|dbj|BAF59630.1| flp pilus assembly protein CpaB [Pelotomaculum thermopropionicum
           SI]
          Length = 242

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 93/195 (47%), Gaps = 20/195 (10%)

Query: 45  FINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILK 104
           F  V +++  +     +T  ++E    P +     +I+++   +  +E+ G + +  IL 
Sbjct: 38  FTRVAVARQRITARTRITAQMIELKDIPAK-----YINELAAVSP-EEIVGKIAKSEILP 91

Query: 105 GDPIRLEKLVDRGNG--GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL-- 160
           G+ I  ++L    +   GL+ +L  GKRA T+ ++  S + G+IKP D VDVV    L  
Sbjct: 92  GEQILRDRLAQGSSATDGLAFMLQPGKRAVTVAVNEVSGLAGLIKPGDRVDVVGTFDLQG 151

Query: 161 ---SERKPTVTVVLSNIRVIAIDH-------NIDSDERVLVGSTATLELTPMQAKALVAA 210
               E+    ++++ ++ V++ D        N  + ++     T TL +TP QA+ LV  
Sbjct: 152 APGQEKSSITSILIQDVDVLSTDQATIPLQENGQNGKKEAPARTVTLSVTPEQAQPLVLC 211

Query: 211 QSVAKLSLVLRSIAD 225
                + L+LR   D
Sbjct: 212 SEKGTIRLILRPATD 226


>gi|84501677|ref|ZP_00999849.1| CpaB family protein [Oceanicola batsensis HTCC2597]
 gi|84390298|gb|EAQ02857.1| CpaB family protein [Oceanicola batsensis HTCC2597]
          Length = 265

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 59/109 (54%), Gaps = 6/109 (5%)

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS--ERKPT---VTVVLS 172
           + GL+S L KG RA  + + ++S V G ++P D VD+     +S  +R  +     ++ +
Sbjct: 99  DAGLTSRLEKGMRAFAIKVDVASGVSGFLRPGDKVDIYWTGRVSGMDRNASGEVTKLIET 158

Query: 173 NIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVL 220
            I++IA+D   + D    ++  T T+ + P Q  AL  AQS  +L+L L
Sbjct: 159 GIQLIAVDQMANGDHSEAMIARTVTVAVNPQQVGALAQAQSTGRLALSL 207


>gi|254487761|ref|ZP_05100966.1| Flp pilus assembly protein CpaB [Roseobacter sp. GAI101]
 gi|214044630|gb|EEB85268.1| Flp pilus assembly protein CpaB [Roseobacter sp. GAI101]
          Length = 198

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 69/138 (50%), Gaps = 9/138 (6%)

Query: 92  ELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPND 150
           E++G +V+V     + I   K+   G + GL+S L +G RA T+ + +SS V G ++P D
Sbjct: 5   EVNGDVVQVVARSFEAILAAKVTAPGEDTGLTSRLARGTRAFTIKVDVSSGVSGFLRPGD 64

Query: 151 HVDVVMV-------RSLSERKPTVTVVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPM 202
            VDV           +L        ++ + +++IAID +   +     +  T T+ + P 
Sbjct: 65  RVDVYWTGRITVGDSNLRNAGDVTKLIEAGVQLIAIDQSAGGEMNEANIAQTVTVAVKPS 124

Query: 203 QAKALVAAQSVAKLSLVL 220
           Q  AL  AQS  KLSL L
Sbjct: 125 QVAALAQAQSTGKLSLSL 142


>gi|86360579|ref|YP_472467.1| putative cpaB pilus assembly protein [Rhizobium etli CFN 42]
 gi|86284681|gb|ABC93740.1| putative cpaB pilus assembly protein [Rhizobium etli CFN 42]
          Length = 304

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 102/220 (46%), Gaps = 44/220 (20%)

Query: 25  RLVSPHHVQTEE---VITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDG-F 80
           RL++ + V+TEE   V+   P +F + + S+             L  + +P      G F
Sbjct: 33  RLLAMNGVKTEERTLVVAATPMRFGDRIRSEN------------LRAIPWPSNETPTGSF 80

Query: 81  I-------DDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAA 132
           +       +D     AM  +D          G+P+   K+   G    LS+ L +G +A 
Sbjct: 81  VSIDLVVGNDAQPRYAMAAID---------PGEPVLSSKITGAGERATLSAALDQGMKAV 131

Query: 133 TMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT------VTVVLSNIRVIAIDHNID-- 184
           ++ ++    V G ++P+D VDV++ R +  R P       V V+L  ++V+A+D   D  
Sbjct: 132 SIRVNDVLGVAGFVRPSDRVDVLLTRVV--RGPAGNDQTFVDVLLQGVKVLAVDQTADER 189

Query: 185 SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
            DE  +V  T T E+T  +A+ L    S+  LSL LR++A
Sbjct: 190 KDEPSVV-KTVTFEVTTDEAQRLTLGSSIGTLSLALRNVA 228


>gi|330811038|ref|YP_004355500.1| hypothetical protein PSEBR_a4092 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379146|gb|AEA70496.1| Hypothetical protein; putative exported protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 271

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 94/184 (51%), Gaps = 10/184 (5%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
           +V+++  ++  G +V    +  V  P + + D   D   Q        G +    IL+GD
Sbjct: 41  SVVVATVEIPFGQMVEAQQVTTVRMPMDTIPDDAFDSSEQAV------GKIATFDILRGD 94

Query: 107 PIRLEKLVDR-GNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP 165
            +R  +L +  G   L+SL+   KRA ++ +     VGG + P + VDV+  ++ +    
Sbjct: 95  IVRGARLSEHLGGSTLASLIAPDKRAISVRVDDVVGVGGFLLPGNRVDVLATKTTNAGSN 154

Query: 166 TVT--VVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRS 222
           + T   +L N+RV+A+D    +D+ + +V    TLE++  +A+ LV AQ+  KL L LR+
Sbjct: 155 SATSRTLLENLRVLAVDQTAGTDKTQPVVVRAVTLEMSATEAELLVTAQTEGKLQLALRN 214

Query: 223 IADL 226
             +L
Sbjct: 215 PLNL 218


>gi|56697918|ref|YP_168289.1| CpaB family protein [Ruegeria pomeroyi DSS-3]
 gi|56679655|gb|AAV96321.1| CpaB family protein [Ruegeria pomeroyi DSS-3]
          Length = 305

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 107/237 (45%), Gaps = 22/237 (9%)

Query: 2   KLTRLMGIVVSGVFALVAG--IIAMRLVSPHHVQTEEVITENPAK-----FINVLISKGD 54
           K+  + G+V+    AL  G  ++A   +S +     E+  E  A+        V ++   
Sbjct: 17  KMRAVFGLVLIVGIALAGGAVMMARNYISAYQ---NELARERQARAQIVPTKTVYVASRP 73

Query: 55  LAVGMVVTPNILEWVAFPEENVFDG-FIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL 113
           L  G  +T   +  V +PE  + +G F+D        QE +  ++R  + K + I   K+
Sbjct: 74  LRYGERLTKEDVRAVNWPENAIPEGTFLDAAMLFPERQEENRYVLRA-MEKDEAIMAIKV 132

Query: 114 VDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE--------RK 164
              G + GL+S L +G RA  + + ++S V G ++P D VDV     LS         + 
Sbjct: 133 TKPGEDAGLTSQLARGMRAFAIKVDVTSGVSGFLRPGDRVDVYWTGGLSGATGPLEGMQG 192

Query: 165 PTVTVVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVL 220
               ++ +NI+++AID     D     +  T T+   P Q  +L  AQ+  +L+L L
Sbjct: 193 EITRLIQTNIQIVAIDQISGGDVTGANIARTVTVAALPQQVASLAQAQTTGRLTLAL 249


>gi|209546484|ref|YP_002278402.1| Flp pilus assembly protein CpaB [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537728|gb|ACI57662.1| Flp pilus assembly protein CpaB [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 305

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 99/220 (45%), Gaps = 44/220 (20%)

Query: 25  RLVSPHHVQTEE---VITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDG-F 80
           RL++ + V+ EE   ++   P +F            G  + P  L  + +P      G F
Sbjct: 33  RLLAMNGVKAEERTLIVAAKPMRF------------GDRIRPENLRAIPWPSNETPAGSF 80

Query: 81  ID-------DVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAA 132
           +        D     AM  +D          G+P+   K+   G    LS+ L +G +A 
Sbjct: 81  VSIETVVGSDAQPRYAMAAID---------PGEPVLSSKITGAGERATLSAALDQGMKAV 131

Query: 133 TMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT------VTVVLSNIRVIAIDHNID-- 184
           ++ ++    V G ++P+D VDV++ R +  R P       V V+L  ++V+A+D   D  
Sbjct: 132 SIRVNDVLGVAGFVRPSDRVDVLLTRVV--RGPAGNDQTFVDVLLQGVKVLAVDQTADER 189

Query: 185 SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
            DE  +V  T T E+T  +A+ L    S+  LSL LR+IA
Sbjct: 190 KDEPSVV-KTVTFEVTTDEAQRLTLGSSIGTLSLALRNIA 228


>gi|319782174|ref|YP_004141650.1| Flp pilus assembly protein CpaB [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168062|gb|ADV11600.1| Flp pilus assembly protein CpaB [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 344

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 116/253 (45%), Gaps = 21/253 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPA-KFINVLISKGDLAVGM 59
           M+   L+ IV++GVF    G++A+ LV+         + +    +   V+++   L  G 
Sbjct: 1   MRANTLIMIVLAGVF----GVLAVVLVNIWLAGQRSAMAQTGVVQGSTVVVAAMPLKFGD 56

Query: 60  VVTPNILEWVAFPEENV----FDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD 115
            ++ + L  VA+P   V    F    D +    A Q L  + V  PIL        K+  
Sbjct: 57  ALSADKLREVAWPAGAVPAGAFKSTKDLLAGDGAKQALQSIGVNEPILA------TKITG 110

Query: 116 RGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL----SERKPTVTVV 170
            G    LS++L +G +A ++ ++    V G + P D VD+++ R+        K  V V+
Sbjct: 111 PGQRATLSAVLGEGMKAVSIRVNDVLGVAGFVFPGDRVDILLTRTARGDDGADKSFVDVL 170

Query: 171 LSNIRVIAIDHNID-SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
           L +++V+AID   D S +   V  + TLE +   A+ L  A    +LSL LR  A     
Sbjct: 171 LQSMKVLAIDQVADESKDSPTVVKSVTLEASTRDAQKLTLAAGAGQLSLALRQAAASKGE 230

Query: 230 SSEDSDVWDVQEE 242
           ++E   + D+  E
Sbjct: 231 TTERVTLSDLTGE 243


>gi|325108089|ref|YP_004269157.1| Flp pilus assembly protein CpaB [Planctomyces brasiliensis DSM
           5305]
 gi|324968357|gb|ADY59135.1| Flp pilus assembly protein CpaB [Planctomyces brasiliensis DSM
           5305]
          Length = 418

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/223 (28%), Positives = 108/223 (48%), Gaps = 24/223 (10%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITENPAKFIN----VLISKGDLAVGMVVTPNILEWV 69
            FA+  G+IAM       V  +++I +   K  N    VL++  D++ G+++      + 
Sbjct: 10  AFAVGCGLIAM-------VGVQQMIAQQSNKDQNQTVEVLVAAQDISPGVLLNQANCAFK 62

Query: 70  AFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGK 129
             P E V     D V       E  G+LV  P++ GD IR  KL  RG    S+ +P G 
Sbjct: 63  KLPVEGVPS---DAVRSKEEYAER-GLLV--PVMAGDIIRKSKLGARGEIAASASIPAGM 116

Query: 130 RAATMDISISSAVGGMIKPNDHVDVVM---VRSLSERKPTVT-VVLSNIRVIAID--HNI 183
           R  ++ ++ +    G+++P D VD+ +   VR+    + T T ++L  I V A D   N+
Sbjct: 117 RTVSIQVNDTKTHSGLLQPGDRVDLQVTYEVRTSEGFRVTKTAILLEYIEVFASDAFRNL 176

Query: 184 DSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           ++ E + +     TL +TP QA  +  A +  +L  ++RS AD
Sbjct: 177 EAGESKEIKAKNITLLVTPDQANFIQLANTKGELVPIMRSRAD 219


>gi|188586926|ref|YP_001918471.1| Flp pilus assembly protein CpaB [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179351613|gb|ACB85883.1| Flp pilus assembly protein CpaB [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 233

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 113/244 (46%), Gaps = 34/244 (13%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTE-----EVITENPAKFINVLISKGDLA 56
           KL +  G++VS + A+V  +I  + +S      E     E+  E+    + V+++  +L 
Sbjct: 3   KLKKYRGLLVSLILAIVTVLIIHQYISSLETAYEGTGPREIDGEDQ---VAVVVATSNLD 59

Query: 57  VGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-- 114
            G ++T + L+    PE+      + D       +E+ G      +LK D +  E L+  
Sbjct: 60  TGTILTQDHLDTRKVPEQTAHPQAVTD------KEEITG-----EVLKQDVVEHEVLMSS 108

Query: 115 ----DRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK------ 164
               +     LS ++P+ KRA ++ +   S V G I+  D+VDVV  +   +R+      
Sbjct: 109 RVLGEEEANKLSEVIPENKRAMSVAVDQVSGVAGFIQAGDYVDVVATKDEEDREGQEPSQ 168

Query: 165 -PTVTVVLSNIRVIAIDHNIDSDERVLVG--STATLELTPMQAKALVAAQSVAKLSLVLR 221
             +  ++L N++V+A+   I    + LV   ST TL +   +A  L  A+    + L+L+
Sbjct: 169 DSSSEIILDNLQVLAVGDRILYSRQELVQEVSTVTLAVNRNEATELTHAEEEHVIRLLLQ 228

Query: 222 SIAD 225
            I +
Sbjct: 229 PITE 232


>gi|260574617|ref|ZP_05842620.1| Flp pilus assembly protein CpaB [Rhodobacter sp. SW2]
 gi|259023034|gb|EEW26327.1| Flp pilus assembly protein CpaB [Rhodobacter sp. SW2]
          Length = 284

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 65/123 (52%), Gaps = 6/123 (4%)

Query: 104 KGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE 162
           K +P+   K+ + G + GL++ L KG RA  + +  +S V G + P D+VDV    + ++
Sbjct: 106 KFEPLLAVKVTEPGQDAGLTARLAKGMRAFAIKVDATSGVSGFLHPGDNVDVYWTGTAND 165

Query: 163 R---KPTVTVVLSNIRVIAIDH--NIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLS 217
                    ++ S I++IA+D   N D     +V +T T+E +P +   L  AQ+  KL+
Sbjct: 166 AGVGGEMTRLIESTIKIIAVDQMANDDRSGSAVVAATVTVEASPEEVARLAQAQATGKLA 225

Query: 218 LVL 220
           L L
Sbjct: 226 LSL 228


>gi|115376401|ref|ZP_01463638.1| Flp pilus assembly CpaB, putative [Stigmatella aurantiaca DW4/3-1]
 gi|310822673|ref|YP_003955031.1| Flp pilus assembly protein CpaB [Stigmatella aurantiaca DW4/3-1]
 gi|115366608|gb|EAU65606.1| Flp pilus assembly CpaB, putative [Stigmatella aurantiaca DW4/3-1]
 gi|309395745|gb|ADO73204.1| Flp pilus assembly protein CpaB [Stigmatella aurantiaca DW4/3-1]
          Length = 270

 Score = 56.6 bits (135), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 93/191 (48%), Gaps = 12/191 (6%)

Query: 45  FINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILK 104
            + V+++  D+  G V++  ++   + PE+ V    +    +P++   +    V VP+  
Sbjct: 39  LVPVVVAAQDIPEGSVISFEMISQRSVPEQFVTSSVV----KPDSANYVVNQKVLVPLQA 94

Query: 105 GDPIRLEKL-VDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVV-MVRSLSE 162
           GDP+   +    +    LS+ + K  RA T++   +++VGG I+PNDHVDV+   R    
Sbjct: 95  GDPLLWSQFETTKAAERLSTKVQKKGRAVTIEAKSTTSVGGWIRPNDHVDVIGTFRDPQT 154

Query: 163 RKPTVTVVLSNIRVIAIDHNIDSDERVLV------GSTATLELTPMQAKALVAAQSVAKL 216
            +     +L N+ V+A      +    L+       S  +L + P +A+ LV A  +  L
Sbjct: 155 DENVAVTLLQNVIVLATGKITGTTNVNLIPENQRDYSNISLLVIPEEAEILVLASELGNL 214

Query: 217 SLVLRSIADLN 227
           +L LR+  D++
Sbjct: 215 TLSLRNEDDVD 225


>gi|254461000|ref|ZP_05074416.1| Flp pilus assembly protein CpaB [Rhodobacterales bacterium
           HTCC2083]
 gi|206677589|gb|EDZ42076.1| Flp pilus assembly protein CpaB [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 286

 Score = 56.6 bits (135), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 63/108 (58%), Gaps = 7/108 (6%)

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM---VRSLSERKPTVTV---VLSN 173
           GL S L  G+ A T+ +  +S V G ++P ++VDV     V++  E++ + TV   + S 
Sbjct: 121 GLQSRLEPGQSAFTIKVDSTSGVSGFLRPGNNVDVYWTGKVQANGEQRKSRTVTRLIESA 180

Query: 174 IRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVL 220
           +R+IAID + + + ++  +  T T+ +T +Q  +L  AQS  +L+L L
Sbjct: 181 VRIIAIDQSANEEVKKASIARTVTVAVTQLQGASLTQAQSTGRLNLSL 228


>gi|153006806|ref|YP_001381131.1| SAF domain-containing protein [Anaeromyxobacter sp. Fw109-5]
 gi|152030379|gb|ABS28147.1| SAF domain protein [Anaeromyxobacter sp. Fw109-5]
          Length = 322

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 69/132 (52%), Gaps = 8/132 (6%)

Query: 102 ILKGDPIRLEKLVDRGNG-GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL 160
           + KG+PI   +L   G   GL+++LP G RA  + ++    V G + P D VDV++  S 
Sbjct: 113 VSKGEPILESRLAAPGTAAGLAAVLPAGMRAVAVRVNDVVGVAGFLHPGDAVDVIVTMSP 172

Query: 161 S---ERKPTVTVVLSNIRVIAIDHNIDSDERVL----VGSTATLELTPMQAKALVAAQSV 213
           S    + P   ++L N+RV+A+   ++  +R        + ATL +   Q++ L  A + 
Sbjct: 173 SGGGGQAPMSKIILQNVRVLAVGKEVERADRAFDKAIPATVATLMVDSEQSEKLALAATK 232

Query: 214 AKLSLVLRSIAD 225
            ++ L LRS AD
Sbjct: 233 GQILLSLRSGAD 244


>gi|126725968|ref|ZP_01741810.1| CpaB family protein [Rhodobacterales bacterium HTCC2150]
 gi|126705172|gb|EBA04263.1| CpaB family protein [Rhodobacterales bacterium HTCC2150]
          Length = 284

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 63/112 (56%), Gaps = 6/112 (5%)

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV----RSLSERKPTVT-VVLSNI 174
           G+++LL  G RA ++ +  ++ V G++  +DHVDV         L  R   VT ++ +N+
Sbjct: 123 GVATLLTPGMRAFSIRVDDTTGVAGLLNADDHVDVYWTGGKADGLGNRDGGVTKLIQANV 182

Query: 175 RVIAIDHNIDSDERVLVGS-TATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           +++AID + D        + T T+E++P Q  +L  AQ+  KLSL L  I+D
Sbjct: 183 KLVAIDDSADKQRSSSRSARTVTVEVSPQQVASLAQAQNSGKLSLSLVGISD 234


>gi|327189766|gb|EGE56910.1| putative cpaB pilus assembly protein [Rhizobium etli CNPAF512]
          Length = 304

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 70/129 (54%), Gaps = 12/129 (9%)

Query: 105 GDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER 163
           G+P+   K+   G    LS+ L +G +A ++ ++    V G ++P+D VDV++ R +  R
Sbjct: 103 GEPVLSSKITGAGERATLSAALDQGMKAVSIRVNDVLGVAGFVRPSDRVDVLLTRVV--R 160

Query: 164 KPT------VTVVLSNIRVIAIDHNID--SDERVLVGSTATLELTPMQAKALVAAQSVAK 215
            P       V V+L  ++V+A+D   D   DE  +V  T T E+T  +A+ L    S+  
Sbjct: 161 GPEGNDQTFVDVLLQGVKVLAVDQTADERKDEPSVV-KTVTFEVTTDEAQRLTLGSSIGT 219

Query: 216 LSLVLRSIA 224
           LSL LR++A
Sbjct: 220 LSLALRNVA 228


>gi|303241713|ref|ZP_07328210.1| Flp pilus assembly protein CpaB [Acetivibrio cellulolyticus CD2]
 gi|302590714|gb|EFL60465.1| Flp pilus assembly protein CpaB [Acetivibrio cellulolyticus CD2]
          Length = 250

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 76/142 (53%), Gaps = 11/142 (7%)

Query: 95  GVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDV 154
           G  ++  +++G+ I   +LV   N  L+  +P+G RA +++++  + V  +I+P D VD+
Sbjct: 83  GKRLKESVIEGEQILRSRLVQEDNFTLAYNVPEGMRAISVNVNEQTEVANLIRPGDFVDI 142

Query: 155 VMVRSLSER---KPTV------TVVLSNIRVIAI--DHNIDSDERVLVGSTATLELTPMQ 203
           +    L ++   + T+        V+ N++V+A+  D  I+ D+++ +  T TL ++P  
Sbjct: 143 IASFPLEKQDIGQNTIINLGISQTVIQNVQVLALGQDLAIEEDKKLELPKTVTLAVSPKD 202

Query: 204 AKALVAAQSVAKLSLVLRSIAD 225
           A+ L        + + LRSI D
Sbjct: 203 AEKLTFVTEFGTMRMTLRSIGD 224


>gi|260462608|ref|ZP_05810814.1| Flp pilus assembly protein CpaB [Mesorhizobium opportunistum
           WSM2075]
 gi|259031514|gb|EEW32784.1| Flp pilus assembly protein CpaB [Mesorhizobium opportunistum
           WSM2075]
          Length = 351

 Score = 55.8 bits (133), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 119/260 (45%), Gaps = 30/260 (11%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHH---VQTEEVITENPAKFINVLISKGDLAV 57
           M+   ++ IV++GVF ++A ++A   ++       QT EV  +       V+++   L  
Sbjct: 1   MRANTIIMIVLAGVFGVLAVVLANIWLANQRGAIAQTNEVQRDT------VVVAAVALKF 54

Query: 58  GMVVTPNILEWVAFPEENVFDGFIDDVHQ---------PNAMQELDGVLVRVPILKGDPI 108
           G +++ + L  VA+P   V  G      +             Q L  + V  P+L     
Sbjct: 55  GDILSADKLREVAWPAGAVPAGAFKTTEELLTKDLPVGGGTKQALQSIGVNEPVLA---- 110

Query: 109 RLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE----R 163
              K+   G    LS++L +G +A ++ ++    V G + P D VD+++ R++ +     
Sbjct: 111 --TKITGPGQRATLSAVLGEGMKAVSIRVNDVLGVAGFVFPGDRVDILLTRTVRDDDGTD 168

Query: 164 KPTVTVVLSNIRVIAIDHNID-SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRS 222
           K  V V+L +++V+A+D   D S +   V  + TLE +   A+ L  A    +LSL LR 
Sbjct: 169 KSFVDVLLQSMKVLAVDQVADESKDSPTVVKSVTLEASTKDAQKLTLAAGAGQLSLALRQ 228

Query: 223 IADLNPSSSEDSDVWDVQEE 242
            A     ++E   + D+  E
Sbjct: 229 AAASKGETTERITLSDLTGE 248


>gi|329900777|ref|ZP_08272581.1| SAF domain protein [Oxalobacteraceae bacterium IMCC9480]
 gi|327549366|gb|EGF33934.1| SAF domain protein [Oxalobacteraceae bacterium IMCC9480]
          Length = 323

 Score = 55.8 bits (133), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 91/194 (46%), Gaps = 8/194 (4%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKG 105
           I V+++KGDL  G V++ + +     P E      +     P+    +DG  +   +  G
Sbjct: 52  IPVVVAKGDLNKGTVLSADNVAVRQIPREFAHSASVF----PDQFARIDGQPIAYGLKSG 107

Query: 106 DPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP 165
           + +    +  +     S+ L  G RA T+ +   +++ G+++P D +D+++      +K 
Sbjct: 108 ESVMWGLMEGKKVPTFSARLEAGHRAMTVPVDEINSISGLLEPGDSIDLIVTVDHGGKKI 167

Query: 166 TVTVVLSNIRVIAIDHNIDSDERV---LVGSTATLELTPMQAKALVAAQSVAKLSLVLRS 222
           T   +L  ++V+A       D R       ST TL  TP QA+ ++ A+   K++ +LR+
Sbjct: 168 TFP-LLQAVQVMATGQRAVDDPRTGERRQFSTVTLNTTPEQAQNVIVAREAGKITALLRN 226

Query: 223 IADLNPSSSEDSDV 236
            AD  P +    D+
Sbjct: 227 PADQAPMAGTRGDL 240


>gi|167836690|ref|ZP_02463573.1| Flp pilus assembly protein CpaB family [Burkholderia thailandensis
           MSMB43]
          Length = 351

 Score = 55.8 bits (133), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 96/212 (45%), Gaps = 30/212 (14%)

Query: 54  DLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL 113
           DL  G+++  + L W + P + V  G   +  +P    +L G L+R  + +G PI    +
Sbjct: 48  DLPEGLLLRDSDLVWKSVPRDQVPPGAWAE-GEPGG-SDLKGNLLRHMVREGTPIGAGDV 105

Query: 114 VD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL-SERKPTVT--- 168
           +     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + L +   P V    
Sbjct: 106 ISPNAPGFLAAALKLGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQLGTSGGPPVPPDH 165

Query: 169 -----VVLSNIRVIAIDHNIDSDE-------------RVLVGSTATLELTPMQAKALVAA 210
                 V S +RV+A+       +                   T TLE+TP  A+A+  A
Sbjct: 166 AIVSETVASRVRVLAVGSVFQRPKDDAAQTNSNSNSNSSARARTVTLEVTPFYAQAITLA 225

Query: 211 QSVAKLSLVLRSIA--DLNPSS---SEDSDVW 237
             +  LSL LRS A  + NP+S      + VW
Sbjct: 226 SHLGSLSLALRSFAVSERNPASLAPEAPAPVW 257


>gi|225872753|ref|YP_002754210.1| putative flp pilus assembly protein CpaB [Acidobacterium capsulatum
           ATCC 51196]
 gi|225791215|gb|ACO31305.1| putative flp pilus assembly protein CpaB [Acidobacterium capsulatum
           ATCC 51196]
          Length = 271

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 65/143 (45%), Gaps = 4/143 (2%)

Query: 101 PILKGDPIRLEKLVDRGNG-GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDV-VMVR 158
           P+  G PI    L   G+  G+++ +P G RA  +      AVGG I P  HVDV V  R
Sbjct: 87  PVTVGQPILSTDLAAPGSSLGITTRIPNGMRAIALHTDDVIAVGGFIFPGSHVDVLVTYR 146

Query: 159 SLSERKPTVTVVLSNIRVIAIDHNIDSDE--RVLVGSTATLELTPMQAKALVAAQSVAKL 216
           +    +P    VL N  V+A  H    D   +    +  TL L+P  A+  V A +   +
Sbjct: 147 NPGSPQPITATVLQNALVLATGHQTQPDPQGKPTTVNIVTLLLSPEDAERAVLASTQGTI 206

Query: 217 SLVLRSIADLNPSSSEDSDVWDV 239
             VLR+ AD        +D+ ++
Sbjct: 207 HFVLRNGADQQKGMPPPADLAEL 229


>gi|85705149|ref|ZP_01036249.1| CpaB family protein [Roseovarius sp. 217]
 gi|85670471|gb|EAQ25332.1| CpaB family protein [Roseovarius sp. 217]
          Length = 289

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 94/193 (48%), Gaps = 15/193 (7%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQ--PNAMQELDGVLVRVPIL 103
           +++ ++   +  G  +T   +  +AFP++++ +G      +  P+    +   L R+   
Sbjct: 48  VDIYVANQLIKYGEPLTTEAVRLIAFPKDSLPEGAFSSTEELFPSGASVVRKALRRME-- 105

Query: 104 KGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL-- 160
           K +PI   K+   G   G++S L +G RA  + + ++S V G ++P D VD+    S+  
Sbjct: 106 KNEPILAVKVTKPGEEAGITSQLERGMRAFAIKVDVTSGVSGFLRPGDTVDIYWTGSIGA 165

Query: 161 ----SERKPT---VTVVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQS 212
               +E   T     ++ + +++IA+D   D D    +V  T  + +TP Q  AL  AQS
Sbjct: 166 GNLRTEEDSTGEVTKLIDTGVKLIAVDQVADMDMTEAVVARTVAVAVTPNQVAALAQAQS 225

Query: 213 VAKLSLVLRSIAD 225
             +LSL L   +D
Sbjct: 226 TGRLSLSLVGASD 238


>gi|257791505|ref|YP_003182111.1| Flp pilus assembly protein CpaB [Eggerthella lenta DSM 2243]
 gi|257475402|gb|ACV55722.1| Flp pilus assembly protein CpaB [Eggerthella lenta DSM 2243]
          Length = 243

 Score = 55.1 bits (131), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 91/198 (45%), Gaps = 22/198 (11%)

Query: 26  LVSPHHVQTE-EVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDV 84
            ++  +VQ+E   + EN +  +   I+   ++ G  ++P++L+ V  P   +    I D 
Sbjct: 56  FLTSSNVQSEIATLRENTSSTV---ITTTAISQGTTISPDMLKVVDIPASFLNSEAIADT 112

Query: 85  HQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVG 143
                 Q+L G +    I     +    L    N   L+S L  G  A ++ +   S + 
Sbjct: 113 ------QDLVGKIALYNIAANSQVTSGMLSAMDNAATLASSLQAGNVAISIAVDSESGLS 166

Query: 144 GMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDERVLVGSTATLELTPMQ 203
           G+IK ND+VD++             V++ N+RV A+D N+     V   +T TLE+ P Q
Sbjct: 167 GLIKQNDYVDIL---------GNGEVIVQNVRVAALDSNLSGS--VSQYATVTLEVAPTQ 215

Query: 204 AKALVAAQSVAKLSLVLR 221
           A A+  AQS   L  VLR
Sbjct: 216 ATAIQEAQSENPLRFVLR 233


>gi|283852072|ref|ZP_06369346.1| Flp pilus assembly protein CpaB [Desulfovibrio sp. FW1012B]
 gi|283572462|gb|EFC20448.1| Flp pilus assembly protein CpaB [Desulfovibrio sp. FW1012B]
          Length = 300

 Score = 55.1 bits (131), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 111/246 (45%), Gaps = 16/246 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK   +  ++++ + ALVAG++ +R +       E        K I VL++   LA G  
Sbjct: 1   MKSKAIPHMILAVILALVAGVLTIRWLGSVRGTGEPGKPAAETKKIEVLVAARPLAKGAR 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG--N 118
           +   ++    +  E    G + D        E+ G +    I + DPI  +KL+ +G   
Sbjct: 61  LDTTMVRLKPYDPEAAPLGAMRDA------SEVVGRVTAREISQDDPITPDKLLPKGAAG 114

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER--KPTVTVVLSNIRV 176
           GGL + +  GKRA T+  +     GG+I P   VDV+   +   +  +    V+L NI V
Sbjct: 115 GGLDASVEPGKRALTVKGTKVMGSGGLITPGCRVDVLSTYNQPGKADEKVTKVILENIPV 174

Query: 177 IAI----DHNIDSDERVLVGST--ATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           +      +  +  D R  + +T   TL +TP +A+ L  A  +  + L LR   D +  +
Sbjct: 175 LTTGTEREVRVGQDGREELANTDFFTLMVTPEEAERLALASDLGNMHLALRKPGDDDVVA 234

Query: 231 SEDSDV 236
           +  +DV
Sbjct: 235 TAGADV 240


>gi|163745847|ref|ZP_02153206.1| CpaB family protein [Oceanibulbus indolifex HEL-45]
 gi|161380592|gb|EDQ05002.1| CpaB family protein [Oceanibulbus indolifex HEL-45]
          Length = 286

 Score = 55.1 bits (131), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 94/184 (51%), Gaps = 12/184 (6%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDG-FIDD-VHQPNAMQELDGVLVRVPILK 104
            V +++  L  G  +T   +  V +PE  + +G FI++ +  P   +  D  +V   I K
Sbjct: 49  TVWVAEKPLKYGQPLTREDVRAVNWPENAIPEGSFIEETLLFPENTK--DHRIVLRNIEK 106

Query: 105 GDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDV-----VMVR 158
            + I   K+ + G + GL+S L +G RA T+ + +SS V G ++P D VDV     V V 
Sbjct: 107 DEAIMAVKVTEPGEDSGLTSRLARGMRAFTIKVDVSSGVSGFLRPGDRVDVYWTGRVNVG 166

Query: 159 SLSERKPTVTVVLSNIRVIAIDHNIDS--DERVLVGSTATLELTPMQAKALVAAQSVAKL 216
           + S       ++ S +++IAID + D+   E   +  T T+ + P Q  AL  AQS  KL
Sbjct: 167 NQSSNGDVTKLIESAVQLIAIDQSADALVMEEASIAKTVTVAVKPQQVAALAQAQSTGKL 226

Query: 217 SLVL 220
           SL L
Sbjct: 227 SLSL 230


>gi|313902402|ref|ZP_07835805.1| Flp pilus assembly protein CpaB [Thermaerobacter subterraneus DSM
           13965]
 gi|313467333|gb|EFR62844.1| Flp pilus assembly protein CpaB [Thermaerobacter subterraneus DSM
           13965]
          Length = 236

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 86/159 (54%), Gaps = 12/159 (7%)

Query: 90  MQELDGVLVRVPILKGDPIRLEKLVDRGNG--GLSSLLPKGKRAATMDISISSAVGGMIK 147
           ++E  G + +VP+ +G+ +   KL  RG+G  GL+  LP+G RA T+      AVGG ++
Sbjct: 79  IEEAVGKVTKVPLAEGEFVLTSKLA-RGDGSDGLAYRLPEGTRALTIAADPVLAVGGFVQ 137

Query: 148 PNDHVDVVMVRSLSERKPTV-----TVVLSNIRVIAIDHNIDSD-ERVLVGST-ATLELT 200
           P D VDV++   L   KP V      +++ N+ V+A+  +  ++ E    G T  TL + 
Sbjct: 138 PGDRVDVLI--GLPGGKPGVEQPEARILVENVLVLAVQQDTAAEGEPAGDGLTHLTLAVA 195

Query: 201 PMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDV 239
           P  A A+V A+   +L L+LR   D  P+ +  + + D+
Sbjct: 196 PAHAAAIVLAEQEGRLRLLLRPAGDGRPAGAVTARLADL 234


>gi|225174960|ref|ZP_03728957.1| Flp pilus assembly protein CpaB [Dethiobacter alkaliphilus AHT 1]
 gi|225169600|gb|EEG78397.1| Flp pilus assembly protein CpaB [Dethiobacter alkaliphilus AHT 1]
          Length = 238

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 97/206 (47%), Gaps = 26/206 (12%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELD---GVLVRVPIL 103
           NV+++   +     +T  +L+ V+ P         D VH P A++ +D   G + R  I+
Sbjct: 41  NVVVASSTIPAHTRITAEMLDVVSIPN--------DAVH-PEALRSVDDAAGGISRTEIV 91

Query: 104 KGDPIRLEKLV--DRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS 161
           +G+ +   ++V  DR    LS  +P+G RA ++ +   + V G I   D++DV++    +
Sbjct: 92  RGEQVIDARVVTEDR-RATLSYRVPEGMRAISIPVGEVTGVAGYISAGDNIDVLITYDDT 150

Query: 162 E--RKPTVTVVLSNIRVIAIDHNI---DSDERVLVGSTATLELTPMQAKALVAAQSVAKL 216
           E         V  N+ V+A   N    D +E+ +VG T TL +T  QA+ L  A      
Sbjct: 151 EIHEGAITYTVFQNVNVLATGPNTREKDDEEQEVVG-TVTLSVTAAQAEVLAYALLKGNY 209

Query: 217 SLVLRSIAD-----LNPSSSEDSDVW 237
            L LRS  D     L   SSE+ + +
Sbjct: 210 HLTLRSPLDEDEVELESYSSENFETF 235


>gi|13475418|ref|NP_106982.1| pilus assembly protein [Mesorhizobium loti MAFF303099]
 gi|14026170|dbj|BAB52768.1| pilus assembly protein [Mesorhizobium loti MAFF303099]
          Length = 354

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 117/257 (45%), Gaps = 24/257 (9%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+   ++ IV++GVF ++A ++A   ++    Q   +   N  +   V+++   L  G  
Sbjct: 1   MRANTVIMIVLAGVFGVLAVVLANIWLAN---QRSAIAQTNDIQRDTVVVAAVALKFGDT 57

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQ-------PNAM--QELDGVLVRVPILKGDPIRLE 111
           ++ + L  VA+P   V  G      +       P A   Q L  + V  P+L        
Sbjct: 58  LSADKLREVAWPAGAVPAGAFKTTEELLTKDVLPGAAPKQALQAIGVNEPVLA------T 111

Query: 112 KLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE----RKPT 166
           K+   G    LS++L +G +A ++ ++    V G + P D VDV++ R++       +  
Sbjct: 112 KITGPGQRATLSAVLGEGMKAVSIRVNDVLGVAGFVFPGDRVDVLLTRTVRSDDGADQSF 171

Query: 167 VTVVLSNIRVIAIDHNID-SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           V V+L  +RV+A+D   D S +   V  + TLE +   A+ L  A    +LSL LR  A 
Sbjct: 172 VDVLLQGMRVLAVDQVADESKDSPTVVKSVTLEASTKDAQKLTLAAGAGQLSLALRQAAA 231

Query: 226 LNPSSSEDSDVWDVQEE 242
               ++E   + D+  E
Sbjct: 232 SKGETTERVTLSDLTGE 248


>gi|116623254|ref|YP_825410.1| SAF domain-containing protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226416|gb|ABJ85125.1| SAF domain [Candidatus Solibacter usitatus Ellin6076]
          Length = 300

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 77/152 (50%), Gaps = 9/152 (5%)

Query: 82  DDVHQPNAMQELDGVLVRVPILKG----DPIRLEKLVDRGNG-GLSSLLPKGKRAATMDI 136
           +DV    A   ++ VL R P++      +P+   +L  +G+G GL  ++P G RA ++ +
Sbjct: 68  EDVFPAGAFSRVEDVLER-PVISAIQPEEPVVEARLAVKGSGAGLGPMIPTGMRAISVRV 126

Query: 137 SISSAVGGMIKPNDHVDVVMVRSLSERKPTVT-VVLSNIRVIAIDHNIDSDERV--LVGS 193
           +    V G + P   VDV++      R  T T  VL NI V++    I +D R   ++  
Sbjct: 127 NDVVGVAGFVLPGMRVDVLVTGKPLNRADTETQTVLQNITVLSAGQTITTDGRSQPIMAP 186

Query: 194 TATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
             TL +TP +A+AL  A +   + LVLR+  D
Sbjct: 187 VVTLLVTPGEAEALTLANTEGHIQLVLRNSTD 218


>gi|108759025|ref|YP_632818.1| putative Flp pilus assembly protein CpaB [Myxococcus xanthus DK
           1622]
 gi|108462905|gb|ABF88090.1| putative Flp pilus assembly protein CpaB [Myxococcus xanthus DK
           1622]
          Length = 271

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 95/193 (49%), Gaps = 16/193 (8%)

Query: 45  FINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILK 104
            + V+++  D+  G V+T  ++   + PE+ V    +    +P++   +    V V +  
Sbjct: 39  LVPVVVAAQDVPEGTVITFEMISQRSVPEQFVTSSVV----RPDSASYIVNQKVLVALQA 94

Query: 105 GDPIRLEKL-VDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVV-MVRSLSE 162
           GDP+   +    +    LSS + K  RA T++   +++VGG I+PNDHVDV+   R    
Sbjct: 95  GDPLLWSQFETTKAAERLSSKVQKKARALTIEAKHTTSVGGWIRPNDHVDVIGTFRDPQT 154

Query: 163 RKPTVTVVLSNIRVIAID--------HNIDSDERVLVGSTATLELTPMQAKALVAAQSVA 214
            +     +L N+ V+A          + I  ++R    +  +L + P +A+ LV A  + 
Sbjct: 155 DENVAVTLLQNVIVVATGKITGTTNVNLIPENQREY--NNISLMVLPEEAEILVLAVELG 212

Query: 215 KLSLVLRSIADLN 227
           +L+L LR+  D++
Sbjct: 213 QLTLSLRNEDDVD 225


>gi|32473552|ref|NP_866546.1| pilus assembly protein CpaB [Rhodopirellula baltica SH 1]
 gi|32398232|emb|CAD78327.1| probable pilus assembly protein CpaB [Rhodopirellula baltica SH 1]
          Length = 403

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 72/152 (47%), Gaps = 7/152 (4%)

Query: 90  MQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPN 149
           +++++G   R    +G+P+   KL+   NG  S  +P G    +M     S+V  +++P 
Sbjct: 106 LEDVEGKFARQRFYEGEPVMPVKLMADANGS-SQTIPVGFSVVSMRADPESSVATLVRPG 164

Query: 150 DHVDVVMVRSLSERKP--TVTVVLSNIRVIAID----HNIDSDERVLVGSTATLELTPMQ 203
           D VDV+     SE  P  T   VL+ +RV A+D      +DS+       + +L +    
Sbjct: 165 DRVDVMAYFVKSELIPETTAKTVLTGVRVFAVDGRTEREVDSEAEAKPARSISLLIHKKD 224

Query: 204 AKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
             A   A  + K+ L L + +D+N +   ++D
Sbjct: 225 TPAWTYASELGKIRLTLGNPSDINETKDGETD 256


>gi|327540753|gb|EGF27320.1| Pilus assembly, Flp-type CpaB [Rhodopirellula baltica WH47]
          Length = 403

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 72/152 (47%), Gaps = 7/152 (4%)

Query: 90  MQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPN 149
           +++++G   R    +G+P+   KL+   NG  S  +P G    +M     S+V  +++P 
Sbjct: 106 LEDVEGKFARQRFYEGEPVMPVKLMADANGS-SQTIPVGFSVVSMRADPESSVATLVRPG 164

Query: 150 DHVDVVMVRSLSERKP--TVTVVLSNIRVIAID----HNIDSDERVLVGSTATLELTPMQ 203
           D VDV+     SE  P  T   VL+ +RV A+D      +DS+       + +L +    
Sbjct: 165 DRVDVMAYFVKSELIPETTAKTVLTGVRVFAVDGRTEREVDSEAEAKPARSISLLIHKKD 224

Query: 204 AKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
             A   A  + K+ L L + +D+N +   ++D
Sbjct: 225 TPAWTYASELGKIRLTLGNPSDINETKDGETD 256


>gi|126461332|ref|YP_001042446.1| putative Flp pilus assembly protein CpaB [Rhodobacter sphaeroides
           ATCC 17029]
 gi|126102996|gb|ABN75674.1| putative Flp pilus assembly protein CpaB [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 274

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 52/98 (53%), Gaps = 3/98 (3%)

Query: 125 LPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNID 184
           L  G RA  + + ++S V G ++P D VDV    S S  + T  ++   I ++A+D   +
Sbjct: 125 LASGMRAFAIKVDVASGVSGFLQPGDRVDVYWTGSASSGE-TTRLIEKTIPIVAVDQTAN 183

Query: 185 SD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVL 220
           +D     ++  T T+E++P Q   L  AQ+  +LSL L
Sbjct: 184 ADLATSAIIARTVTVEVSPQQVARLAQAQATGRLSLSL 221


>gi|283779854|ref|YP_003370609.1| Flp pilus assembly protein CpaB [Pirellula staleyi DSM 6068]
 gi|283438307|gb|ADB16749.1| Flp pilus assembly protein CpaB [Pirellula staleyi DSM 6068]
          Length = 372

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 92/201 (45%), Gaps = 15/201 (7%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
            +L++  D+ +   +    ++   +P+  V +G +       ++ E++    +    KG+
Sbjct: 42  QILVALADIDIDAKLNAENVQLEEWPKSKVPEGAV------RSLDEVEAKFAQQRFFKGE 95

Query: 107 PIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDV-VMVRSLSERKP 165
           PI L K+ D+ N      +P+G R   + +   + +   I P D VDV V +R   E K 
Sbjct: 96  PILLAKISDQ-NVNPMIRIPEGYRVMPVKVDDETVLKA-ISPGDRVDVMVFLRRSEEIKQ 153

Query: 166 TVT-VVLSNIRVIAIDHNIDSDERV----LVGSTATLELTPMQAKALVAAQSVAKLSLVL 220
           T T  +L N+RV A++ N + D       +   T +L + P Q++ L  A  + K+ L +
Sbjct: 154 TATYTILRNVRVFAVNSNTERDLETKGQDVNARTVSLIIKPQQSRELAVASQIGKIILTM 213

Query: 221 RSIADLNPSSSEDSDVWDVQE 241
           R   D    + E  DV  + E
Sbjct: 214 RR-PDETDEAGEGEDVTPITE 233


>gi|284048527|ref|YP_003398866.1| Flp pilus assembly protein CpaB [Acidaminococcus fermentans DSM
           20731]
 gi|283952748|gb|ADB47551.1| Flp pilus assembly protein CpaB [Acidaminococcus fermentans DSM
           20731]
          Length = 339

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 86/195 (44%), Gaps = 34/195 (17%)

Query: 54  DLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL 113
           D+A   V+T  +L+ V  P   V  G + D  Q  A+ +  G+     +  GD +   KL
Sbjct: 76  DIAPQTVLTEEMLKTVEVPANLVPAGALTDKKQ--ALGKKTGI----DLFAGDILTERKL 129

Query: 114 VDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSN 173
              G GG   ++P G RA +  ++  + V G  KP D VD+++V            +L +
Sbjct: 130 TSHG-GGFVGMIPDGMRAVSFGVNDVTGVSGFAKPGDKVDILLVTDKEGNGIVSKTLLKD 188

Query: 174 IRVIAIDHNID----------SDERVLV---------GSTA--------TLELTPMQAKA 206
           + ++A++ + D          SD++ L          GST         T+ LTP  A  
Sbjct: 189 VLILAVNKSSDRPQGTTQTSGSDKKTLTSGSQPAGNSGSTGSMGTPSVVTVALTPYDAAK 248

Query: 207 LVAAQSVAKLSLVLR 221
           L+ +  + +L ++LR
Sbjct: 249 LIGSSRIGQLQMMLR 263


>gi|77462454|ref|YP_351958.1| putative Flp pilus assembly protein CpaB [Rhodobacter sphaeroides
           2.4.1]
 gi|221638317|ref|YP_002524579.1| Flp pilus assembly protein CpaB [Rhodobacter sphaeroides KD131]
 gi|332560338|ref|ZP_08414660.1| Flp pilus assembly protein CpaB [Rhodobacter sphaeroides WS8N]
 gi|77386872|gb|ABA78057.1| Putative Flp pilus assembly protein CpaB [Rhodobacter sphaeroides
           2.4.1]
 gi|221159098|gb|ACM00078.1| Flp pilus assembly protein CpaB precursor [Rhodobacter sphaeroides
           KD131]
 gi|332278050|gb|EGJ23365.1| Flp pilus assembly protein CpaB [Rhodobacter sphaeroides WS8N]
          Length = 274

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 52/98 (53%), Gaps = 3/98 (3%)

Query: 125 LPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNID 184
           L  G RA  + + ++S V G ++P D VDV    S S  + T  ++   I ++A+D   +
Sbjct: 125 LASGMRAFAIKVDVASGVSGFLQPGDRVDVYWTGSASSGE-TTRLIEKTIPIVAVDQTAN 183

Query: 185 SD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVL 220
           +D     ++  T T+E++P Q   L  AQ+  +LSL L
Sbjct: 184 ADLATSAIIARTVTVEVSPQQVARLAQAQATGRLSLSL 221


>gi|113867003|ref|YP_725492.1| flp pilus assembly protein CpaB [Ralstonia eutropha H16]
 gi|113525779|emb|CAJ92124.1| flp pilus assembly protein CpaB [Ralstonia eutropha H16]
          Length = 343

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 95/214 (44%), Gaps = 40/214 (18%)

Query: 41  NPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRV 100
           N  + + V++   + A G V+  N       P + V++    D+   ++  ++  + +  
Sbjct: 52  NEGRRVAVMVPVRNAAPGTVIDGNGFAAREIPADLVYE----DMILASSFDKVANLRLVR 107

Query: 101 PILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL 160
            + +G P+R   +    +   S LL  GKRA T+++ + ++   M+KP +HVD+ ++ S 
Sbjct: 108 QVRQGQPVRRADVEALQSRDFSDLLKPGKRAFTIEVDMVNSTAKMLKPGNHVDLFLISST 167

Query: 161 SER-----KPTVTVVLSNIRVIA------------------------IDHNIDSDERVLV 191
           S       K T  +++S++ V+A                        +D N D D     
Sbjct: 168 SPTAAGTDKQTARLLMSDMLVLATGQDVRPRDYGEAMAAQAAEGAEGVDTNPDYD----- 222

Query: 192 GSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
             + TL ++P QA  L  AQ V  L  VLR+ AD
Sbjct: 223 --SLTLMVSPEQAARLALAQKVGSLRAVLRNAAD 254


>gi|261856885|ref|YP_003264168.1| Flp pilus assembly protein CpaB [Halothiobacillus neapolitanus c2]
 gi|261837354|gb|ACX97121.1| Flp pilus assembly protein CpaB [Halothiobacillus neapolitanus c2]
          Length = 258

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 107/222 (48%), Gaps = 13/222 (5%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNI 65
            + + V+ +   +A ++A++ ++   V T    T  P K   V++   +L VG V++   
Sbjct: 8   FLYVAVAVLLGGLASVLAVKYIN-QQVATR-THTAAPQKMRTVVVPVHNLKVGDVLSAKD 65

Query: 66  LEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLL 125
           L     P   V      D   P+  +   G ++  P+ +G PI    +    N   S ++
Sbjct: 66  LATRDIPVAYV----PADALTPDDYESHLGQMLTTPLAQGAPISAMAMEPIANH-FSDII 120

Query: 126 PKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNI-- 183
              + A T+D+S ++++ G+I P DH+D++++ S    K  +  +LS++ V+A   +   
Sbjct: 121 KPDRVAYTIDVSETNSISGLIVPGDHIDILLLLS-KNSKDDIRPLLSDVLVLATGKHAKG 179

Query: 184 ---DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRS 222
              D  E     S  TLELTP  A+ +  A+ + +L ++LRS
Sbjct: 180 VRSDGTEGNQGYSNLTLELTPKNAQRIGIAKKMGQLLVMLRS 221


>gi|319943381|ref|ZP_08017663.1| SAF domain protein [Lautropia mirabilis ATCC 51599]
 gi|319743196|gb|EFV95601.1| SAF domain protein [Lautropia mirabilis ATCC 51599]
          Length = 339

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 61/267 (22%), Positives = 118/267 (44%), Gaps = 32/267 (11%)

Query: 10  VVSGVFALVAGIIAMRLVSPHHVQTE-EVITENPAKFINVLISKGDLAVGMVVTPNILEW 68
           ++ G  A+ AG    R V+   VQ E E +     + ++V+++   L  G +V+   +  
Sbjct: 22  MLCGGVAIYAG---SRYVN-EQVQAERERLAPVAQQMVDVVVANATLDKGEIVSGETMAI 77

Query: 69  VAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKG 128
            + P E V    +     P     L G  + +P+  G+ +    +        SS +  G
Sbjct: 78  RSVPAEYVSSSVVT----PEQFDALVGQRLLLPMRPGEMLSTAAVSSAEQLVFSSRVKPG 133

Query: 129 KRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT-----------VVLSNIRVI 177
            RA T+ +   +++ GM++P D +D++    L+ R P+ +            +L N+ V+
Sbjct: 134 IRALTISVDEINSISGMLQPGDRIDLL----LTARPPSASGHGEAEHDATVPLLQNLLVM 189

Query: 178 AIDHNI------DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSS 231
           A    +      + D+R    S+ T+E+TP QA+ L+ AQ   +L+ VLR+  D  P  +
Sbjct: 190 ATGRQVRPGANDNGDDRSF--SSVTVEVTPSQAQRLIVAQRAGRLTAVLRNPDDGMPMDA 247

Query: 232 EDSDVWDVQEEGKEIQIIKAGVIVNKD 258
              D+  +  +     +    V+  +D
Sbjct: 248 AAVDLRSLFPQPARPAVAPRKVVARQD 274


>gi|220918103|ref|YP_002493407.1| Flp pilus assembly protein CpaB [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219955957|gb|ACL66341.1| Flp pilus assembly protein CpaB [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 309

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 92/185 (49%), Gaps = 12/185 (6%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
            V++++ D+ V   + P  L  V +P   +  G      +P A   L G +  VPI +G+
Sbjct: 59  GVVVAQVDIPVATPIKPEWLGVVPWPVTALPPG---AASEPAA---LVGQVAIVPITRGE 112

Query: 107 PIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP 165
            +   KL   G   GL++LLP G RA  + +     V G + P D VDV++     E  P
Sbjct: 113 AVLPSKLATAGARSGLATLLPAGMRAVAVRVDDVVGVAGFLHPGDRVDVIVTMQPREGVP 172

Query: 166 -TVTVVLSNIRVIAIDHNID----SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVL 220
            T  +VL N++V+A+  +++      E+    + ATL +T  +++ L  + S  +L L L
Sbjct: 173 YTSKIVLQNVKVLAVGQHLELRGKDAEKPNPVTVATLMVTGDESERLALSASKGQLLLSL 232

Query: 221 RSIAD 225
           R++ D
Sbjct: 233 RALGD 237


>gi|254466356|ref|ZP_05079767.1| Flp pilus assembly protein CpaB [Rhodobacterales bacterium Y4I]
 gi|206687264|gb|EDZ47746.1| Flp pilus assembly protein CpaB [Rhodobacterales bacterium Y4I]
          Length = 285

 Score = 52.0 bits (123), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 94/189 (49%), Gaps = 11/189 (5%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDG---FIDDVHQPNAMQELDGVLVRVPI 102
           ++V ++   L  G  ++ + +  V +PE  + +G    +D +  P +  +L  V++R  +
Sbjct: 48  VDVFVATKPLKYGERLSQDAVRAVRWPENAIPEGAYTTLDALFPPQSGDKLR-VVLRA-M 105

Query: 103 LKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDV----VMV 157
            K + +   K+   G + G++S L +G RA  + + +SS V G ++P D VDV    +M 
Sbjct: 106 EKDEAVMAVKVTAPGEDAGITSRLQRGMRAFAIKVDVSSGVSGFLRPGDKVDVYWTGMMP 165

Query: 158 RSLSERKPTVTVVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKL 216
            +   R     ++ +N+ ++A+D +   D    ++  T T+   P Q  AL  AQ+  +L
Sbjct: 166 GAGGSRGEVTRLIETNVELVAVDQSAGGDINEAIIARTVTVAAKPAQVAALAQAQTTGRL 225

Query: 217 SLVLRSIAD 225
           SL L    D
Sbjct: 226 SLALVGAGD 234


>gi|149915643|ref|ZP_01904169.1| CpaB family protein [Roseobacter sp. AzwK-3b]
 gi|149810535|gb|EDM70378.1| CpaB family protein [Roseobacter sp. AzwK-3b]
          Length = 290

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 93/189 (49%), Gaps = 16/189 (8%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDG-FID-DVHQPNAMQELDGVLVRVPIL 103
           + VL++K  L  G  + P+ +  V FP++ + +G F+  D   P   QE   V  R  + 
Sbjct: 48  VEVLVAKTPLKYGQKLKPDAVRLVKFPKDALPEGVFMTMDALFPKGEQEPRAV--RRAME 105

Query: 104 KGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM------ 156
             + I   K+   G + G+SS L +G RA  + + ++S V G ++P D VDV        
Sbjct: 106 VNEAIMAVKVTAPGEDAGISSQLAQGMRAFAIKVDVASGVSGFLRPGDRVDVYWTGQVRG 165

Query: 157 ---VRSLSERKPTVT-VVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQ 211
              VR+       VT ++ + +++IA+D   D +  + ++  T T+   P Q  AL  AQ
Sbjct: 166 GSDVRTEGNSMGDVTKLIETGVQLIAVDQISDENTTQAIIARTVTVAARPQQVAALAQAQ 225

Query: 212 SVAKLSLVL 220
           +  +LSL L
Sbjct: 226 ATGRLSLSL 234


>gi|319940439|ref|ZP_08014784.1| hypothetical protein HMPREF9464_00003 [Sutterella wadsworthensis
           3_1_45B]
 gi|319806065|gb|EFW02814.1| hypothetical protein HMPREF9464_00003 [Sutterella wadsworthensis
           3_1_45B]
          Length = 321

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 80/166 (48%), Gaps = 35/166 (21%)

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDH 151
           L G  VR  + +G+ I  + ++  GN G L+++L  GKRA ++  S  S+  G++   D 
Sbjct: 102 LMGATVRRSVPQGELITQDDVLYPGNPGFLAAVLSPGKRAVSIPTSAVSSNSGLVSAGDW 161

Query: 152 VDVVMV--RSLSE------------RKPTVTVVLSNIRVIAIDHNIDS------------ 185
           VDV++   R  +E             K     +L+N+RV+A++++ +S            
Sbjct: 162 VDVILTLKRETAEAMADQQDKTSGMTKLAAQTILTNVRVLALNNSTESIAPQPETAPQKT 221

Query: 186 DERVLVGSTA--------TLELTPMQAKALVAAQSVAKLSLVLRSI 223
           D +    + A        TLE+TPM+A+AL  A+    L + +R +
Sbjct: 222 DAKKTASTAARRVDYRTITLEVTPMEAQALAVAKEAGDLQVSIRGL 267


>gi|146276365|ref|YP_001166524.1| Flp pilus assembly protein CpaB-like protein [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145554606|gb|ABP69219.1| Flp pilus assembly protein CpaB-like protein [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 274

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 62/120 (51%), Gaps = 6/120 (5%)

Query: 104 KGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE 162
           K +P+   K+ + G   GL   L  G RA  + + ++S V G ++P D VDV    + + 
Sbjct: 105 KFEPVLAVKVTEPGVEAGLR--LASGMRAFAIKVDVASGVSGFLQPGDRVDVYWTGAGAN 162

Query: 163 RKPTVTVVLSNIRVIAIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVL 220
            + T  ++   I ++A+D   ++D     ++  T T+E++P Q   L  AQ+  +LSL L
Sbjct: 163 GE-TTRLIEKTIPIVAVDQTANADLATSAIIARTVTVEVSPQQVARLAQAQATGRLSLSL 221


>gi|330819175|ref|YP_004348037.1| Flp pilus assembly protein CpaB [Burkholderia gladioli BSR3]
 gi|327371170|gb|AEA62525.1| Flp pilus assembly protein CpaB [Burkholderia gladioli BSR3]
          Length = 354

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/246 (24%), Positives = 105/246 (42%), Gaps = 36/246 (14%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEV-ITENPAKFINVLISKGDLAVGMVVTPN 64
           L+GI V+    +        LVS   ++ E     E P   ++V++ + D+  G  +   
Sbjct: 18  LIGIAVAAAGGITWVTYRYMLVSEARIKAEAAERREGPG--VSVVVPRADVPAGTPLDSA 75

Query: 65  ILEWVAFPEENVFDGFI---DDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGL 121
           +        + V+D  +   D  H  NA      VLV+ P+ +G P+RL+ +        
Sbjct: 76  VFVAREISADLVYDDMLQVDDFTHHRNA------VLVK-PVRRGRPLRLQDVDATRARDF 128

Query: 122 SSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS---------ERKPTVTVVLS 172
           S  L  G RA T+ I   ++   M++P + VD+  V +LS             ++ +++ 
Sbjct: 129 SDTLAAGMRALTLPIDAINSTDSMLRPGNRVDLYWVGTLSFVTRGGDPAGDTKSIRLLMP 188

Query: 173 NIRVIAIDHNI-------------DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLV 219
            +RV+A  H++             D   R   G T TL++   +A  +  AQ +  L LV
Sbjct: 189 GVRVLATGHDVRPRDAGEAARDMADGARRDGYG-TVTLQVPVAEAARIALAQKLGGLRLV 247

Query: 220 LRSIAD 225
           LR+  D
Sbjct: 248 LRNSKD 253


>gi|302343420|ref|YP_003807949.1| Flp pilus assembly protein CpaB [Desulfarculus baarsii DSM 2075]
 gi|301640033|gb|ADK85355.1| Flp pilus assembly protein CpaB [Desulfarculus baarsii DSM 2075]
          Length = 279

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 94/206 (45%), Gaps = 15/206 (7%)

Query: 30  HHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNA 89
           H  Q E    E   +   ++++  DL  G+ ++   L    +P E    G         A
Sbjct: 32  HKAQQE---AERRVRTAPLVVAAVDLPAGLELSAGRLAVAQWPVEARPPGHF------GA 82

Query: 90  MQELDGVLVRVPILKGDPIRLEKLV-DRGNGGLSSLLPKGKRAATMDISISSAVGGMIKP 148
           ++ L G +++ P++KG+P+   KL  +    GL++ +  G RA T+       V G +K 
Sbjct: 83  VKPLLGRVLQQPVVKGEPLLAGKLSPEGAAAGLAAAIKPGWRAVTISADEVVGVAGYLKV 142

Query: 149 NDHVDVV-MVRSLSERKPTVT-VVLSNIRVIAIDHNIDSDER---VLVGSTATLELTPMQ 203
            D VDV+  V+ L + K  V  + L ++ V+A+ H  + D +    L G   TL   P  
Sbjct: 143 GDRVDVIATVKGLDQGKEAVARLALQDLEVLAVSHQAEQDGKKPPKLKGQVLTLLARPAD 202

Query: 204 AKALVAAQSVAKLSLVLRSIADLNPS 229
           A+ L  A    K+ L LR+  D  P+
Sbjct: 203 AERLALAAGEGKILLALRNRQDRQPA 228


>gi|84687278|ref|ZP_01015158.1| CpaB family protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84664711|gb|EAQ11195.1| CpaB family protein [Rhodobacterales bacterium HTCC2654]
          Length = 274

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 87/182 (47%), Gaps = 10/182 (5%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQ--PNAMQELDGVLVRVPILK 104
            + + K  +A G  +T   +    FP + + +G      +  P   +    VL    + K
Sbjct: 39  EIYVVKESVAYGDRITDENIRLTRFPVDAIPEGAFKTEEELFPQGEKRYRTVLR--AMEK 96

Query: 105 GDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV-RSLSE 162
            + +   K+ + G + G+++ L  G RA  + + ++S V G ++P D VD+    R  S+
Sbjct: 97  DEALLAVKVTEAGADAGVAARLASGMRAFAIRVDVASGVSGFLRPGDKVDIYWTGRGSSD 156

Query: 163 ---RKPTVTVVLSNIRVIAIDHNIDSDERV-LVGSTATLELTPMQAKALVAAQSVAKLSL 218
               +    ++ +NIR+IAID   D+D     V  T T+E TP Q  AL  AQ+  +++L
Sbjct: 157 SVTSQEVTKLIQTNIRIIAIDQMADTDRTAPTVARTVTIEATPEQVAALAQAQATGRMAL 216

Query: 219 VL 220
            L
Sbjct: 217 SL 218


>gi|152994346|ref|YP_001339181.1| SAF domain-containing protein [Marinomonas sp. MWYL1]
 gi|150835270|gb|ABR69246.1| SAF domain protein [Marinomonas sp. MWYL1]
          Length = 309

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 92/208 (44%), Gaps = 33/208 (15%)

Query: 45  FINVLISKGDLAVGMVVTPNILEWVAFPEE-NVFDGFIDDVHQPNAMQELDGVLVRVPIL 103
           F  VL +  DL  G  +  + ++W+A  ++      F+  V Q +A+    G  VR P+ 
Sbjct: 47  FTPVLAASKDLVPGDFIDNSAVQWLAVDKQYESHSYFLKGVDQVDAVF---GATVREPVA 103

Query: 104 KGDPIRLEKLVDRGNGGL-SSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM------ 156
           KGD +    +V  G+ G  +S+L  G RA  +     ++  G++   D VDVV+      
Sbjct: 104 KGDVLGSRVVVLPGDAGFIASVLESGMRAVAIPADAVTSNAGLVSAGDRVDVVLGLKRDQ 163

Query: 157 --------VRSLSERKPTVTVVLSNIRVIAIDHNID-------------SDERVLVGSTA 195
                   + S+   K     +L N+RV+A++  ++             + +R     T 
Sbjct: 164 ENGGEADPMASIELPKLASQTLLRNVRVLALNDAVEEMAKEKPTEEKSGAKKRKFY-ETV 222

Query: 196 TLELTPMQAKALVAAQSVAKLSLVLRSI 223
           TLE+ P   + L  A+ +  L L LRS+
Sbjct: 223 TLEVFPKDVERLTVAREIGVLQLALRSV 250


>gi|167581962|ref|ZP_02374836.1| Flp pilus assembly protein CpaB family [Burkholderia thailandensis
           TXDOH]
          Length = 269

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 61/253 (24%), Positives = 104/253 (41%), Gaps = 39/253 (15%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F   A  IA     P            P + + V ++  DL  G++
Sbjct: 5   LKLAGLMLVAVVGAFLFRALYIAASQPRP----------AAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEWVAFPEENVFDGFIDD--------------VHQPNAMQELDGVLVRVPILKGD 106
           +    L W      +V  G + +                   A  +L G L+R P+ +G 
Sbjct: 55  LRDVDLGWKTMARGDVPAGALIEGDARGDGRTAGAAVDASAAAAGDLKGDLLRHPVREGM 114

Query: 107 PI-RLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS---- 161
           P+   + ++    G L++ L  G RA ++ I   S   G+I+P D+VDV++ + L+    
Sbjct: 115 PLGPADVILPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQLAAPGG 174

Query: 162 -----ERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAKALVAAQ 211
                ER      + + +RV+A+         D+ +      T T E++   A+ +    
Sbjct: 175 APADPERAVESETIAARVRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSHDAQVITVGA 234

Query: 212 SVAKLSLVLRSIA 224
            +  LSL LRS A
Sbjct: 235 HLGALSLALRSFA 247


>gi|255658703|ref|ZP_05404112.1| Flp pilus assembly protein CpaB [Mitsuokella multacida DSM 20544]
 gi|260849090|gb|EEX69097.1| Flp pilus assembly protein CpaB [Mitsuokella multacida DSM 20544]
          Length = 358

 Score = 50.1 bits (118), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 66/276 (23%), Positives = 113/276 (40%), Gaps = 49/276 (17%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVV 61
           K+T    +V +GV +++ G++    +S    +  E    N    + V+ +K D+    VV
Sbjct: 17  KITYRQWVVAAGVVSILLGLMVYLAMSGDDQKAAEKPQTN---LVQVVAAKQDIPERTVV 73

Query: 62  TPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL-VDRGNGG 120
             ++L+ V  P E V +G   DV   +A+       ++    +GD +   K+ VD    G
Sbjct: 74  KEDMLKVVEVPSELVPEGAFHDVA--DAIDHPTSTAIQ----QGDIMTSRKVYVDIRMAG 127

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
            + ++P   RA T+ I+  + V G   P D+VD++++    E      ++L ++ ++ I+
Sbjct: 128 FTGIIPPDCRAVTIPINDVTGVSGFAHPGDYVDIMVITGTKENGINGRIILQDVLLLGIN 187

Query: 181 HNID----------------SDER------VLVGS-----------TATLELTPMQAKAL 207
              D                SD++        VGS           TAT+ L P  A  L
Sbjct: 188 RTADLPNTPTGDSSKKDGSQSDKQDASSGTANVGSVNTKASSDTMATATVALKPADALKL 247

Query: 208 VAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEG 243
            A      L LVLR      P    D   +D    G
Sbjct: 248 AAESQEGTLYLVLR------PFKPRDMYTFDTDYAG 277


>gi|294102190|ref|YP_003554048.1| Flp pilus assembly protein CpaB [Aminobacterium colombiense DSM
           12261]
 gi|293617170|gb|ADE57324.1| Flp pilus assembly protein CpaB [Aminobacterium colombiense DSM
           12261]
          Length = 288

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 110/222 (49%), Gaps = 19/222 (8%)

Query: 9   IVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEW 68
           ++VS +  ++AG++  + +  + ++    I     + ++V+++        ++T   ++ 
Sbjct: 8   LIVSLLLGIMAGLLVYQQIRSYKLK----IARAERELVSVVVAARPKDAFSIITAEDVKV 63

Query: 69  VAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL-VDRGNGGLSSLLPK 127
           V  P  ++  G +       ++ E+ G    + + +GDP+   KL +D    G++  LP 
Sbjct: 64  VRMPRSSIPTGEV------LSLDEVVGKASMLALSEGDPVLKGKLSLDPEKLGVAFQLPD 117

Query: 128 GKRAATMDISISSAVGGMIKPNDHVDVVMV-RSLSERKPTVTVVLSNIRVIAIDHNID-- 184
           G+ A  + I    A GG+++P D+VDV  V R      PT  ++LS ++V+A+   +   
Sbjct: 118 GRVAIALPIDEVIAAGGLLRPGDYVDVFHVYREKDAVSPTSRLLLSRVKVLALGGVLTRK 177

Query: 185 -----SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
                + E+ ++  +A +E++P +A     AQS+  + L LR
Sbjct: 178 EEKEGTKEKEMLARSAVVEVSPEEAAVAAWAQSLGSVWLALR 219


>gi|83721444|ref|YP_442981.1| CpaB family Flp pilus assembly protein [Burkholderia thailandensis
           E264]
 gi|257139205|ref|ZP_05587467.1| CpaB family Flp pilus assembly protein [Burkholderia thailandensis
           E264]
 gi|83655269|gb|ABC39332.1| Flp pilus assembly protein CpaB family [Burkholderia thailandensis
           E264]
          Length = 345

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 59/253 (23%), Positives = 104/253 (41%), Gaps = 39/253 (15%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F          L    +V   +     P + + V ++  DL  G++
Sbjct: 5   LKLAGLMLVAVVGAF----------LFRALYVAASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEWVAFPEENVFDGFIDD--------------VHQPNAMQELDGVLVRVPILKGD 106
           +    L W      +V  G + +                   A  +L G L+R P+ +G 
Sbjct: 55  LRDVDLGWKTMARGDVPAGALIEGDARGDGRTAGAAVDASAAAAGDLKGDLLRHPVREGM 114

Query: 107 PI-RLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS---- 161
           P+   + ++    G L++ L  G RA ++ I   S   G+I+P D+VDV++ + L+    
Sbjct: 115 PLGPADVILPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQLAAPGG 174

Query: 162 -----ERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAKALVAAQ 211
                ER      + + +RV+A+         D+ +      T T E++   A+ +    
Sbjct: 175 APADPERAVESETIAARVRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSHDAQVITVGA 234

Query: 212 SVAKLSLVLRSIA 224
            +  LSL LRS A
Sbjct: 235 HLGALSLALRSFA 247


>gi|167902789|ref|ZP_02489994.1| Flp pilus assembly protein CpaB [Burkholderia pseudomallei NCTC
           13177]
          Length = 279

 Score = 49.3 bits (116), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 103/259 (39%), Gaps = 47/259 (18%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F          L    +V   +     P + + V ++  DL  G++
Sbjct: 5   LKLAGLMLVAVVGAF----------LFRALYVAASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEW-----VAFPEENVFDG---------------FIDDVHQPNAMQELDGVLVRV 100
           +    L W      A P   + +G                     +P    +L G L+R 
Sbjct: 55  LRDADLGWKTMARSAAPAGALIEGDARGDGKAAGAANDASAAAAGEPK--TDLKGDLLRH 112

Query: 101 PILKGDPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS 159
           P+  G P+    ++     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + 
Sbjct: 113 PVRAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQ 172

Query: 160 LS---------ERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAK 205
           L+         +R      + + +RV+A+         D+ +      T T E++   A+
Sbjct: 173 LAAPGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSRDAQ 232

Query: 206 ALVAAQSVAKLSLVLRSIA 224
            +     +  LSL LRS A
Sbjct: 233 VITVGAHLGALSLALRSFA 251


>gi|167919050|ref|ZP_02506141.1| Flp pilus assembly protein CpaB [Burkholderia pseudomallei BCC215]
          Length = 275

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 103/259 (39%), Gaps = 47/259 (18%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F          L    +V   +     P + + V ++  DL  G++
Sbjct: 5   LKLAGLMLVAVVGAF----------LFRALYVAASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEW-----VAFPEENVFDG---------------FIDDVHQPNAMQELDGVLVRV 100
           +    L W      A P   + +G                     +P    +L G L+R 
Sbjct: 55  LRDADLGWKTMARSAAPAGALIEGDARGDGKAAGAANDASAAAAGEPK--TDLKGDLLRH 112

Query: 101 PILKGDPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS 159
           P+  G P+    ++     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + 
Sbjct: 113 PVRAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQ 172

Query: 160 LS---------ERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAK 205
           L+         +R      + + +RV+A+         D+ +      T T E++   A+
Sbjct: 173 LAAPGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSRDAQ 232

Query: 206 ALVAAQSVAKLSLVLRSIA 224
            +     +  LSL LRS A
Sbjct: 233 VITVGAHLGALSLALRSFA 251


>gi|254197384|ref|ZP_04903806.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           S13]
 gi|169654125|gb|EDS86818.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           S13]
          Length = 350

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 103/259 (39%), Gaps = 47/259 (18%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F          L    +V   +     P + + V ++  DL  G++
Sbjct: 5   LKLASLMLVAVVGAF----------LFRALYVAASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEW-----VAFPEENVFDG---------------FIDDVHQPNAMQELDGVLVRV 100
           +    L W      A P   + +G                     +P    +L G L+R 
Sbjct: 55  LRDADLGWKTMARSAAPAGALIEGDARGDGKAAGAANDASAAAAGEPK--TDLKGDLLRH 112

Query: 101 PILKGDPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS 159
           P+  G P+    ++     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + 
Sbjct: 113 PVRAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQ 172

Query: 160 LS---------ERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAK 205
           L+         +R      + + +RV+A+         D+ +      T T E++   A+
Sbjct: 173 LAAPGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSRDAQ 232

Query: 206 ALVAAQSVAKLSLVLRSIA 224
            +     +  LSL LRS A
Sbjct: 233 VITVGAHLGALSLALRSFA 251


>gi|242315438|ref|ZP_04814454.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1106b]
 gi|242138677|gb|EES25079.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1106b]
          Length = 366

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 103/259 (39%), Gaps = 47/259 (18%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F          L    +V   +     P + + V ++  DL  G++
Sbjct: 5   LKLAGLMLVAVVGAF----------LFRALYVAASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEW-----VAFPEENVFDG---------------FIDDVHQPNAMQELDGVLVRV 100
           +    L W      A P   + +G                     +P    +L G L+R 
Sbjct: 55  LRDADLGWKTMARSAAPAGALIEGDARGDGKAAGAANDASAAAAGEPK--TDLKGDLLRH 112

Query: 101 PILKGDPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS 159
           P+  G P+    ++     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + 
Sbjct: 113 PVRAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQ 172

Query: 160 LS---------ERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAK 205
           L+         +R      + + +RV+A+         D+ +      T T E++   A+
Sbjct: 173 LAAPGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSRDAQ 232

Query: 206 ALVAAQSVAKLSLVLRSIA 224
            +     +  LSL LRS A
Sbjct: 233 VITVGAHLGALSLALRSFA 251


>gi|217421311|ref|ZP_03452815.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           576]
 gi|237812164|ref|YP_002896615.1| Flp pilus assembly protein CpaB [Burkholderia pseudomallei MSHR346]
 gi|217395053|gb|EEC35071.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           576]
 gi|237502713|gb|ACQ95031.1| Flp pilus assembly protein CpaB [Burkholderia pseudomallei MSHR346]
          Length = 350

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 103/259 (39%), Gaps = 47/259 (18%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F          L    +V   +     P + + V ++  DL  G++
Sbjct: 5   LKLAGLMLVAVVGAF----------LFRALYVAASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEW-----VAFPEENVFDG---------------FIDDVHQPNAMQELDGVLVRV 100
           +    L W      A P   + +G                     +P    +L G L+R 
Sbjct: 55  LRDADLGWKTMARSAAPAGALIEGDARGDGKAAGAANDASAAAAGEPK--TDLKGDLLRH 112

Query: 101 PILKGDPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS 159
           P+  G P+    ++     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + 
Sbjct: 113 PVRAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQ 172

Query: 160 LS---------ERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAK 205
           L+         +R      + + +RV+A+         D+ +      T T E++   A+
Sbjct: 173 LAAPGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSRDAQ 232

Query: 206 ALVAAQSVAKLSLVLRSIA 224
            +     +  LSL LRS A
Sbjct: 233 VITVGAHLGALSLALRSFA 251


>gi|76810999|ref|YP_333434.1| CpaB family Flp pilus assembly protein [Burkholderia pseudomallei
           1710b]
 gi|126438737|ref|YP_001058907.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           668]
 gi|134282270|ref|ZP_01768975.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           305]
 gi|226196386|ref|ZP_03791968.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           Pakistan 9]
 gi|254179873|ref|ZP_04886472.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1655]
 gi|254188721|ref|ZP_04895232.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254258897|ref|ZP_04949951.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1710a]
 gi|76580452|gb|ABA49927.1| Flp pilus assembly protein CpaB family [Burkholderia pseudomallei
           1710b]
 gi|126218230|gb|ABN81736.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           668]
 gi|134246308|gb|EBA46397.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           305]
 gi|157936400|gb|EDO92070.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           Pasteur 52237]
 gi|184210413|gb|EDU07456.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1655]
 gi|225931603|gb|EEH27608.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           Pakistan 9]
 gi|254217586|gb|EET06970.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1710a]
          Length = 350

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 103/259 (39%), Gaps = 47/259 (18%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F          L    +V   +     P + + V ++  DL  G++
Sbjct: 5   LKLAGLMLVAVVGAF----------LFRALYVAASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEW-----VAFPEENVFDG---------------FIDDVHQPNAMQELDGVLVRV 100
           +    L W      A P   + +G                     +P    +L G L+R 
Sbjct: 55  LRDADLGWKTMARSAAPAGALIEGDARGDGKAAGAANDASAAAAGEPK--TDLKGDLLRH 112

Query: 101 PILKGDPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS 159
           P+  G P+    ++     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + 
Sbjct: 113 PVRAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQ 172

Query: 160 LS---------ERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAK 205
           L+         +R      + + +RV+A+         D+ +      T T E++   A+
Sbjct: 173 LAAPGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSRDAQ 232

Query: 206 ALVAAQSVAKLSLVLRSIA 224
            +     +  LSL LRS A
Sbjct: 233 VITVGAHLGALSLALRSFA 251


>gi|121599044|ref|YP_993007.1| Flp pilus assembly protein CpaB [Burkholderia mallei SAVP1]
 gi|124386572|ref|YP_001026339.1| Flp pilus assembly CpaB [Burkholderia mallei NCTC 10229]
 gi|126449623|ref|YP_001080387.1| Flp pilus assembly protein CpaB [Burkholderia mallei NCTC 10247]
 gi|254177864|ref|ZP_04884519.1| Flp pilus assembly protein CpaB family [Burkholderia mallei ATCC
           10399]
 gi|254358541|ref|ZP_04974814.1| Flp pilus assembly protein CpaB family [Burkholderia mallei
           2002721280]
 gi|121227854|gb|ABM50372.1| Flp pilus assembly protein CpaB [Burkholderia mallei SAVP1]
 gi|124294592|gb|ABN03861.1| Flp pilus assembly CpaB [Burkholderia mallei NCTC 10229]
 gi|126242493|gb|ABO05586.1| Flp pilus assembly protein CpaB [Burkholderia mallei NCTC 10247]
 gi|148027668|gb|EDK85689.1| Flp pilus assembly protein CpaB family [Burkholderia mallei
           2002721280]
 gi|160698903|gb|EDP88873.1| Flp pilus assembly protein CpaB family [Burkholderia mallei ATCC
           10399]
          Length = 350

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 103/259 (39%), Gaps = 47/259 (18%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F          L    +V   +     P + + V ++  DL  G++
Sbjct: 5   LKLAGLMLVAVVGAF----------LFRALYVAASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEW-----VAFPEENVFDG---------------FIDDVHQPNAMQELDGVLVRV 100
           +    L W      A P   + +G                     +P    +L G L+R 
Sbjct: 55  LRDADLGWKTMARSAAPAGALIEGDARGDGKAAGAANDASAAAAGEPK--TDLKGDLLRH 112

Query: 101 PILKGDPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS 159
           P+  G P+    ++     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + 
Sbjct: 113 PVRAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQ 172

Query: 160 LS---------ERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAK 205
           L+         +R      + + +RV+A+         D+ +      T T E++   A+
Sbjct: 173 LAAPGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSRDAQ 232

Query: 206 ALVAAQSVAKLSLVLRSIA 224
            +     +  LSL LRS A
Sbjct: 233 VITVGAHLGALSLALRSFA 251


>gi|149178506|ref|ZP_01857094.1| pilus assembly transmembrane protein [Planctomyces maris DSM 8797]
 gi|148842621|gb|EDL56996.1| pilus assembly transmembrane protein [Planctomyces maris DSM 8797]
          Length = 324

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 96/226 (42%), Gaps = 14/226 (6%)

Query: 10  VVSGVFALVAGIIAMRLVSP--HHVQTEEVITENPA---KFINVLISKGDLAVGMVVTPN 64
           + + +FA++ G+ A   V    H      V+ E+P    K I + I+  DL  G  ++ +
Sbjct: 1   MTAAIFAILLGLGAAYTVRQFLHEKPKPFVLAEDPPAGPKKIVLPIASRDLVPGQKLSLD 60

Query: 65  ILEWVAFPEE---NVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-G 120
            +  +    E     +D   +   +    Q + G  ++  I  G P     L   G G G
Sbjct: 61  DISLLQISPELLSKRYDADSEGKQRIMMTQYIAGRTLKTAIKAGQPFHTIDLFANGMGPG 120

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTV-VLSNIRVIAI 179
           +S +L  G RA T+ I     V G  +P   VDV+     ++  P  T+ +L  +RV+A+
Sbjct: 121 ISEILEPGNRAVTVAIHKIGNVAGFSRPGTIVDVLFRSKETDGIPETTITLLEKVRVLAV 180

Query: 180 DHNIDSDERVLVGS----TATLELTPMQAKALVAAQSVAKLSLVLR 221
                   +V  G       TLE++P Q K L   +    LSL LR
Sbjct: 181 GDQAVPGHKVGEGGGMDHPVTLEVSPEQGKVLKVVEDHGILSLALR 226


>gi|126452162|ref|YP_001066149.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1106a]
 gi|126225804|gb|ABN89344.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1106a]
          Length = 350

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 103/259 (39%), Gaps = 47/259 (18%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F          L    +V   +     P + + V ++  DL  G++
Sbjct: 5   LKLAGLMLVAVVGAF----------LFRALYVAASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEW-----VAFPEENVFDG---------------FIDDVHQPNAMQELDGVLVRV 100
           +    L W      A P   + +G                     +P    +L G L+R 
Sbjct: 55  LRDADLGWKTMARSAAPAGALIEGDARGDGKAAGAANDASAAAAGEPK--TDLKGDLLRH 112

Query: 101 PILKGDPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS 159
           P+  G P+    ++     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + 
Sbjct: 113 PVRAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQ 172

Query: 160 LS---------ERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAK 205
           L+         +R      + + +RV+A+         D+ +      T T E++   A+
Sbjct: 173 LAAPGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSRDAQ 232

Query: 206 ALVAAQSVAKLSLVLRSIA 224
            +     +  LSL LRS A
Sbjct: 233 VITVGAHLGALSLALRSFA 251


>gi|258627505|ref|ZP_05722286.1| Flp pilus assembly protein CpaB [Vibrio mimicus VM603]
 gi|258580311|gb|EEW05279.1| Flp pilus assembly protein CpaB [Vibrio mimicus VM603]
          Length = 112

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 48/87 (55%), Gaps = 6/87 (6%)

Query: 148 PNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKA 206
           P + VDV+   S S+       VL +I+V+A+D    S E + ++    TLE+TP QA+ 
Sbjct: 3   PGNRVDVLNTVSYSKGSAVTNTVLKDIKVLAVDQTARSKENKPIIVRAVTLEVTPEQAEK 62

Query: 207 LVAAQSVAKLSLVLRSIADLNPSSSED 233
           L++AQS  ++ L LR     NP   E+
Sbjct: 63  LLSAQSKGEIQLTLR-----NPHEPEE 84


>gi|251789645|ref|YP_003004366.1| Flp pilus assembly protein CpaB [Dickeya zeae Ech1591]
 gi|247538266|gb|ACT06887.1| Flp pilus assembly protein CpaB [Dickeya zeae Ech1591]
          Length = 308

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 63/269 (23%), Positives = 114/269 (42%), Gaps = 52/269 (19%)

Query: 7   MGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNIL 66
           + ++ +GV AL   I+  +L      Q        P +   VL++  DL+ G  +  + +
Sbjct: 11  VALIAAGVMAL---IVRSQLPGTPAAQQTPAPAPIPVEKTAVLVTARDLSPGDFIDGSAV 67

Query: 67  EWVAF--PEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN--GGLS 122
            W     P    F  FI    Q +   +L G  +R  I  G P+    +V R N  G ++
Sbjct: 68  RWQETDQPVSRTFY-FIRGKDQES---QLYGATLRGKIPAGTPLNNNSVV-RPNEPGFIA 122

Query: 123 SLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER---KPT-----------VT 168
           ++L  G RA ++  S+ ++  G++   D+VD+++     +    +PT             
Sbjct: 123 AVLRPGMRAISIPTSVVASNAGLVSAGDYVDIILSLRRDDEVALQPTSQQPVPPPVVGAQ 182

Query: 169 VVLSNIRVIAIDHNIDS----------------------DERVLVGSTATLELTPMQAKA 206
            V  N+RV+A+++  D+                       +R  +  + TLE TP QA+ 
Sbjct: 183 TVARNLRVLALNNQTDAITSMRPRQDINGAEPAQNTPQGRQRTPIYQSITLEATPKQAEV 242

Query: 207 LVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
           L  A+ V  L +  RS  D    +S+D++
Sbjct: 243 LTVAKEVGLLQMAQRSALD----TSDDAE 267


>gi|301165541|emb|CBW25112.1| putative pilus assembly-related protein [Bacteriovorax marinus SJ]
          Length = 271

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 70/142 (49%), Gaps = 7/142 (4%)

Query: 15  FALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEE 74
            AL+  + AM +V  +    +  I +   K  +V+I+K D+    ++  + +   + P  
Sbjct: 8   LALIIAVFAMFMVYTYIDDEKTKIIKKYGKEQSVVIAKVDIKELELIDDSKVTVTSMPSN 67

Query: 75  NVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRGNGGLSSLLPKGKRAAT 133
            V +           ++E+   +  VPILKG+ I   ++       GLS  +  GKRA +
Sbjct: 68  FVHEKAF------KTIKEIQNTVATVPILKGEQITKPRVSWPDERSGLSRQVAVGKRAIS 121

Query: 134 MDISISSAVGGMIKPNDHVDVV 155
           +D+S  ++VG +IKP D VD++
Sbjct: 122 LDVSERASVGKLIKPGDRVDIL 143


>gi|254441777|ref|ZP_05055270.1| Flp pilus assembly protein CpaB [Octadecabacter antarcticus 307]
 gi|198251855|gb|EDY76170.1| Flp pilus assembly protein CpaB [Octadecabacter antarcticus 307]
          Length = 286

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 67/134 (50%), Gaps = 8/134 (5%)

Query: 106 DPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM------VR 158
           +PI   K+   G  GG+++LL +G RA T+++ +SS V G + P D VDV        + 
Sbjct: 108 EPILATKVTAPGEVGGITALLARGMRAFTIEVDVSSGVSGFLNPGDRVDVYWTGRVNGID 167

Query: 159 SLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLS 217
             +       ++ + I ++AID   +S      +  T T+++TP Q  AL  AQ+   LS
Sbjct: 168 GANTNGEFTKLIQAGIELVAIDQTSESGRIGASIARTVTVQVTPDQVAALAQAQATGNLS 227

Query: 218 LVLRSIADLNPSSS 231
           L L    D   +SS
Sbjct: 228 LSLVGREDDTVASS 241


>gi|53719432|ref|YP_108418.1| putative fimbriae-assembly related protein [Burkholderia
           pseudomallei K96243]
 gi|52209846|emb|CAH35818.1| putative fimbriae-assembly related protein [Burkholderia
           pseudomallei K96243]
          Length = 350

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 103/259 (39%), Gaps = 47/259 (18%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F          L    +V   +     P + + V ++  DL  G++
Sbjct: 5   LKLAGLMLVAVVGAF----------LFRVLYVAASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEW-----VAFPEENVFDG---------------FIDDVHQPNAMQELDGVLVRV 100
           +    L W      A P   + +G                     +P    +L G L+R 
Sbjct: 55  LRDADLGWKTMARSAAPAGALIEGDARGDGKAAGAANDASAAAAGEPK--TDLKGDLLRH 112

Query: 101 PILKGDPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS 159
           P+  G P+    ++     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + 
Sbjct: 113 PVRAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQ 172

Query: 160 LS---------ERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAK 205
           L+         +R      + + +RV+A+         D+ +      T T E++   A+
Sbjct: 173 LAAPGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSRDAQ 232

Query: 206 ALVAAQSVAKLSLVLRSIA 224
            +     +  LSL LRS A
Sbjct: 233 VITVGAHLGALSLALRSFA 251


>gi|261820213|ref|YP_003258319.1| Flp pilus assembly protein CpaB [Pectobacterium wasabiae WPP163]
 gi|261604226|gb|ACX86712.1| Flp pilus assembly protein CpaB [Pectobacterium wasabiae WPP163]
          Length = 312

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 113/260 (43%), Gaps = 52/260 (20%)

Query: 9   IVVSGVFALVAGIIAMRLVSPHHVQTEEVIT-----ENPAKFINVLISKGDLAVGMVVTP 63
            V+SG   L AGI+A  LV   H+ +          + P K   VL++  DL  G  +  
Sbjct: 7   YVLSGALVL-AGIVA--LVVRSHLSSAPPPPPPVVVQAPEK-TAVLVAAKDLHPGDFIDS 62

Query: 64  NILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LS 122
             L W    EE V   F + V   ++   L G  +R  + +G  +    LV +   G L+
Sbjct: 63  ASLRW-QVTEEPVSRTF-NFVRGKDSQSLLFGATLRETVTEGSALTNNVLVRQNEPGFLA 120

Query: 123 SLLPKGKRAATMDISISSAVGGMIKPNDHVDVV--MVRS------LSERKPTVTVVLS-- 172
           ++L KGKRA ++  S  ++  G++   D VDV+  M R        S  +P V  +L+  
Sbjct: 121 AVLGKGKRAISVPTSAVASNAGLVAAGDRVDVILSMKRDDQPELPASRNQPVVMPLLASQ 180

Query: 173 ----NIRVIAIDH--------NIDSDE------------------RVLVGSTATLELTPM 202
               ++RV+A++          +D+ E                  R     T TLE+TP 
Sbjct: 181 TIVRDLRVLALNDRTGTPVYPRLDAMEDGATLDAAAKSRESAVRSRPATYQTVTLEVTPQ 240

Query: 203 QAKALVAAQSVAKLSLVLRS 222
           QA+AL  A+ +  L L LRS
Sbjct: 241 QAEALAVAKELGILHLALRS 260


>gi|149200846|ref|ZP_01877821.1| Flp pilus assembly CpaB [Roseovarius sp. TM1035]
 gi|149145179|gb|EDM33205.1| Flp pilus assembly CpaB [Roseovarius sp. TM1035]
          Length = 289

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 89/188 (47%), Gaps = 15/188 (7%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQ--PNAMQELDGVLVRVPIL 103
           +++ ++   L  G  +  + +   AFP+ ++ +G      +  P         L R+ + 
Sbjct: 48  VDIFVATRALQYGEALDKDAVRLTAFPKTSLPEGVFKATEELFPKGETVARRALRRMEM- 106

Query: 104 KGDPIRLEKLVDRGNG-GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM------ 156
             +PI   K+ + G   G++S L +G RA  + + ++S V G ++P D +D+        
Sbjct: 107 -NEPILAVKVTEPGAEVGITSQLERGMRAFAIKVDVTSGVSGFLRPGDTIDIYWTGSVGA 165

Query: 157 --VRSLSERKPTVTVVLSN-IRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQS 212
             +R+       VT ++ N +++IA+D   D D    ++  T T+ + P Q  AL  AQS
Sbjct: 166 GNMRTEGNSMGEVTKLIENGVKLIAVDQVADMDTSETVIARTVTVAVKPQQVAALAQAQS 225

Query: 213 VAKLSLVL 220
             +LSL L
Sbjct: 226 TGRLSLSL 233


>gi|167620126|ref|ZP_02388757.1| Flp pilus assembly protein CpaB family [Burkholderia thailandensis
           Bt4]
          Length = 234

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 70/147 (47%), Gaps = 15/147 (10%)

Query: 93  LDGVLVRVPILKGDPI-RLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDH 151
           L G L+R P+ +G P+   + ++    G L++ L  G RA ++ I   S   G+I+P D+
Sbjct: 65  LKGDLLRHPVREGMPLGPADVILPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDY 124

Query: 152 VDVVMVRSLS---------ERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTATL 197
           VDV++ + L+         ER      + + +RV+A+         D+ +      T T 
Sbjct: 125 VDVLLTQQLAAPGGAPADPERAVESETIAARVRVLAVGSAFQRPKDDAAQPNTRARTVTF 184

Query: 198 ELTPMQAKALVAAQSVAKLSLVLRSIA 224
           E++   A+ +     +  LSL LRS A
Sbjct: 185 EVSSHDAQVITVGAHLGALSLALRSFA 211


>gi|167911034|ref|ZP_02498125.1| putative fimbriae-assembly related protein [Burkholderia
           pseudomallei 112]
          Length = 210

 Score = 46.6 bits (109), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 69/148 (46%), Gaps = 15/148 (10%)

Query: 92  ELDGVLVRVPILKGDPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPND 150
           +L G L+R P+  G P+    ++     G L++ L  G RA ++ I   S   G+I+P D
Sbjct: 32  DLKGDLLRHPVRAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGD 91

Query: 151 HVDVVMVRSLS---------ERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTAT 196
           +VDV++ + L+         +R      + + +RV+A+         D+ +      T T
Sbjct: 92  YVDVLLTQQLAAPGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVT 151

Query: 197 LELTPMQAKALVAAQSVAKLSLVLRSIA 224
            E++   A+ +     +  LSL LRS A
Sbjct: 152 FEVSSRDAQVITVGAHLGALSLALRSFA 179


>gi|186473163|ref|YP_001860505.1| Flp pilus assembly protein CpaB [Burkholderia phymatum STM815]
 gi|184195495|gb|ACC73459.1| Flp pilus assembly protein CpaB [Burkholderia phymatum STM815]
          Length = 339

 Score = 46.6 bits (109), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 89/205 (43%), Gaps = 19/205 (9%)

Query: 31  HVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAM 90
           HV+ E V  +   + I V++ + D+  G  ++ +         E   D   DD+ + +A 
Sbjct: 42  HVRAE-VAGKLALRGIEVVVPRRDVPAGTPLSSDAF----VSREIAADLVYDDMVRVDAF 96

Query: 91  QELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPND 150
                  +   ++ G P+R            S +LP G+RA T +I   ++   M++P +
Sbjct: 97  DAFRKAKLVRAVMHGRPLRTSDFDAPRGRDFSDMLPAGQRALTFEIDAVNSTASMLRPGN 156

Query: 151 HVDVVMV-----RSLSERKPTVTVVLSNIRVIAIDHNI------DSDERVLVGS--TATL 197
            VD+  V      S  ERK  V ++L  + V+A   ++      D DE        T T+
Sbjct: 157 RVDMYWVGTQAYASAGERK-AVRLLLPGVLVLATGRSVNARDAGDVDEPASASRYDTVTM 215

Query: 198 ELTPMQAKALVAAQSVAKLSLVLRS 222
           ++    A  +V AQ +  L L+LR+
Sbjct: 216 QVPAADAPRIVLAQKMGTLRLILRN 240


>gi|304311184|ref|YP_003810782.1| Flp pilus assembly protein [gamma proteobacterium HdN1]
 gi|301796917|emb|CBL45130.1| Flp pilus assembly protein [gamma proteobacterium HdN1]
          Length = 283

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 98/217 (45%), Gaps = 25/217 (11%)

Query: 26  LVSPHHVQTEEVITENPA-----KFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGF 80
            ++ ++++TE V   N A     + I V+++  DL +G VVT         P+  V    
Sbjct: 26  FLTQNYIKTE-VTQRNKAIDQQREAIQVVVASADLNIGDVVTLKNAVVRDIPKTFVPS-- 82

Query: 81  IDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISS 140
            + V   N    L+G  ++  +  G+ I    +      G+ SLL  G+RA T+ +    
Sbjct: 83  -EAVTPANFAATLEGRQLKYKVKYGEVILPMHVSSTKIEGIVSLLEPGERAITIPVGKED 141

Query: 141 AVGGMIKPNDHVDVVMVR---SLSERKPTVTVVLSNIRVIAIDHNID-------SDERVL 190
            + G ++P   VD+ +     ++S   P     L  ++VIA    ++        D + L
Sbjct: 142 TISGFLRPGSRVDLFLTLKDGAVSRTAP----FLQRVKVIATGTELNDGIPRELKDPKKL 197

Query: 191 --VGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
               S  TL +TP+QA  L+ +QSV  +++VLR   D
Sbjct: 198 QKTFSDVTLAVTPVQATKLIHSQSVGDIAMVLRRPED 234


>gi|227326301|ref|ZP_03830325.1| hypothetical protein PcarcW_02899 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 314

 Score = 46.2 bits (108), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 100/224 (44%), Gaps = 44/224 (19%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
            VL++  DL  G  +  + L W    E++V   F + V+  +    L G  +R P+ +G 
Sbjct: 46  KVLVAAKDLHPGDFLDSSSLRWQET-EKSVSRAF-NFVYGQDKQSLLLGATLREPVKEGS 103

Query: 107 PIRLEKLVDRGNGGL-SSLLPKGKRAATMDISISSAVGGMIKPNDHVDVV--MVRS---- 159
            +    +V+    G  +++L KG RA ++  S  ++  G++   D VDV+  M R     
Sbjct: 104 WLSSNVVVNPNEPGFVAAVLRKGMRAISVPTSAIASNAGLVSAGDRVDVILSMKRDDQSE 163

Query: 160 --LSERKPTVTVVLS------NIRVIAIDHN--------IDSDE---------------- 187
              S  +P V  +L+      ++RV+A++           D+ E                
Sbjct: 164 LPASRNQPVVMPLLASQTIVRDLRVLALNDKTGTPVYPRFDTAEDGTVLDATAKSRESAV 223

Query: 188 --RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
             R     T TLE+TP QA+AL  A+ +  L L LRS ADL+ S
Sbjct: 224 RSRPATYQTVTLEVTPQQAEALAVAKELGILHLALRS-ADLDDS 266


>gi|167824271|ref|ZP_02455742.1| putative fimbriae-assembly related protein [Burkholderia
           pseudomallei 9]
          Length = 192

 Score = 46.2 bits (108), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 69/148 (46%), Gaps = 15/148 (10%)

Query: 92  ELDGVLVRVPILKGDPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPND 150
           +L G L+R P+  G P+    ++     G L++ L  G RA ++ I   S   G+I+P D
Sbjct: 32  DLKGDLLRHPVRAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGD 91

Query: 151 HVDVVMVRSLS---------ERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTAT 196
           +VDV++ + L+         +R      + + +RV+A+         D+ +      T T
Sbjct: 92  YVDVLLTQQLAAPGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVT 151

Query: 197 LELTPMQAKALVAAQSVAKLSLVLRSIA 224
            E++   A+ +     +  LSL LRS A
Sbjct: 152 FEVSSRDAQVITVGAHLGALSLALRSFA 179


>gi|167845817|ref|ZP_02471325.1| putative fimbriae-assembly related protein [Burkholderia
           pseudomallei B7210]
          Length = 181

 Score = 45.8 bits (107), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 69/148 (46%), Gaps = 15/148 (10%)

Query: 92  ELDGVLVRVPILKGDPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPND 150
           +L G L+R P+  G P+    ++     G L++ L  G RA ++ I   S   G+I+P D
Sbjct: 22  DLKGDLLRHPVRAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGD 81

Query: 151 HVDVVMVRSLS---------ERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTAT 196
           +VDV++ + L+         +R      + + +RV+A+         D+ +      T T
Sbjct: 82  YVDVLLTQQLAAPGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVT 141

Query: 197 LELTPMQAKALVAAQSVAKLSLVLRSIA 224
            E++   A+ +     +  LSL LRS A
Sbjct: 142 FEVSSRDAQVITVGAHLGALSLALRSFA 169


>gi|167815899|ref|ZP_02447579.1| putative fimbriae-assembly related protein [Burkholderia
           pseudomallei 91]
          Length = 166

 Score = 45.8 bits (107), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 69/148 (46%), Gaps = 15/148 (10%)

Query: 92  ELDGVLVRVPILKGDPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPND 150
           +L G L+R P+  G P+    ++     G L++ L  G RA ++ I   S   G+I+P D
Sbjct: 8   DLKGDLLRHPVRAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGD 67

Query: 151 HVDVVMVRSLS---------ERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTAT 196
           +VDV++ + L+         +R      + + +RV+A+         D+ +      T T
Sbjct: 68  YVDVLLTQQLAAPGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVT 127

Query: 197 LELTPMQAKALVAAQSVAKLSLVLRSIA 224
            E++   A+ +     +  LSL LRS A
Sbjct: 128 FEVSSRDAQVITVGAHLGALSLALRSFA 155


>gi|116620531|ref|YP_822687.1| SAF domain-containing protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223693|gb|ABJ82402.1| SAF domain [Candidatus Solibacter usitatus Ellin6076]
          Length = 299

 Score = 45.8 bits (107), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 68/135 (50%), Gaps = 15/135 (11%)

Query: 102 ILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL 160
           I   +PI   +L  +G  GGL++++P G RA  + ++    V G + P  HVD++    +
Sbjct: 90  IFAKEPIIESRLAPKGAGGGLAAMIPSGMRAVAVRVNEVVGVAGFVVPGMHVDIL----I 145

Query: 161 SERKP-------TVT-VVLSNIRVIAI--DHNIDSDERVLVGSTATLELTPMQAKALVAA 210
           S   P       T+T  +L NI V++   D   D++ + ++     L +TP QA+ L  A
Sbjct: 146 SGNTPGGDGNLGTLTKTLLQNIEVLSAGQDFKKDNEGKPIMVQVVNLLVTPEQAEQLSLA 205

Query: 211 QSVAKLSLVLRSIAD 225
            +   + L+LR+  D
Sbjct: 206 SNQTTIQLILRNPLD 220


>gi|226325180|ref|ZP_03800698.1| hypothetical protein COPCOM_02972 [Coprococcus comes ATCC 27758]
 gi|225206528|gb|EEG88882.1| hypothetical protein COPCOM_02972 [Coprococcus comes ATCC 27758]
          Length = 497

 Score = 45.8 bits (107), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 103/228 (45%), Gaps = 10/228 (4%)

Query: 1   MKLTRLMGIVVS-GVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           +K++RL  +     V A++AG +A  +VS   +     I E  +    V+ +   +  G 
Sbjct: 271 VKVSRLQKVTAGLAVIAVLAGGVA--VVS--EIDANNRIAEAFSGTTEVVAATKTIHAGD 326

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG 119
            ++ + L +V+ P   V DG I      ++ +   G +    I KG  +       + N 
Sbjct: 327 EISASDLAFVSVPNSTVADGAITKKDIDDSSKTPVGRVATQYIAKGSQLTNASTAGKDNP 386

Query: 120 -GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIA 178
             L++ +  G  A T+ +   S +GGM++ ND V V+     S      TV+  ++R+ A
Sbjct: 387 ESLAAAIGDGMEAVTISVDAQSGMGGMLRVNDRVKVIQPNDGSLGGDGFTVIADSVRIAA 446

Query: 179 IDHNI-DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           +D N           ST TLE+TP QA  +   ++   L+L L S AD
Sbjct: 447 LDGNFSSGSGSSDGYSTVTLEVTPEQAGKI---RTAGGLTLTLPSSAD 491


>gi|76663414|emb|CAE47790.1| pilus assembling protein [Bdellovibrio bacteriovorus]
          Length = 302

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 111/253 (43%), Gaps = 42/253 (16%)

Query: 15  FALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEE 74
            ++ AG+ A  L+  +  + +    +       V+++K D+A    V   ++E    P  
Sbjct: 11  LSIAAGVFATFLLYSYSQEKKAEYDKRFGSTKRVVVAKEDIAEMQTVYDTMVETKELPA- 69

Query: 75  NVFDGFIDDVHQPNAM---QELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKR 130
                   D  QP+A+    E+ G +  VPI KG  I    L+  G + G+S  +   KR
Sbjct: 70  --------DFIQPDAITVPDEIIGNVAAVPIRKGQMIVKNNLLTPGPDTGISLQVAPSKR 121

Query: 131 AATMDISISSAVGGMIKPNDHVDVVMV----RSLSERKPTVTV------------VLSNI 174
           A T+ +     V  +I+P D +D+       + +++R+   T+            V++NI
Sbjct: 122 AVTIPVDEVRGVAKLIRPGDRIDIYAAVDSGKGVNQRREVFTMMNDVVVLATGVSVVNNI 181

Query: 175 -RVIAIDHNIDSDERV-LVG----STATLELTPMQAKALVAAQSVAKLSLVL-------R 221
            R+  +D    +  ++ L G    +T T+E TP +A+ L    S A  +L +       R
Sbjct: 182 PRMFELDSTGKNLTQIALTGDTKYTTITVEATPKEAQDLFYILSTAPGNLFMALRNPSDR 241

Query: 222 SIADLNPSSSEDS 234
           +I    PSS+ DS
Sbjct: 242 TIPPRMPSSTSDS 254


>gi|296121061|ref|YP_003628839.1| Flp pilus assembly protein CpaB [Planctomyces limnophilus DSM 3776]
 gi|296013401|gb|ADG66640.1| Flp pilus assembly protein CpaB [Planctomyces limnophilus DSM 3776]
          Length = 390

 Score = 45.4 bits (106), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 67/157 (42%), Gaps = 22/157 (14%)

Query: 88  NAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIK 147
           ++ +E D    RV + +G  +  ++L ++G  G S  +P G R  T+ ++ +    G++ 
Sbjct: 75  SSKEEYDKRAPRVKLYEGQYVLKKQLGNKGEYGASMEIPPGMRVVTVPVTATMTHSGLLS 134

Query: 148 PNDHVDVVMVRSLSERKPTVT----VVLSNIRVIAIDHNIDSDERVLVGSTATLE----- 198
           P D VDV +  S +  K   T     VL  I V A D        V +G+ A  E     
Sbjct: 135 PGDRVDVQVTYSYTRPKYGKTFKTRTVLQYIEVWATDS-------VRMGTEAAKEDSSQS 187

Query: 199 ------LTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
                 + P Q   L  AQ    L L+LR   D  P+
Sbjct: 188 KNVSLLVYPGQGALLQLAQEKGTLHLLLRGRNDKAPA 224


>gi|51245388|ref|YP_065272.1| hypothetical protein DP1536 [Desulfotalea psychrophila LSv54]
 gi|50876425|emb|CAG36265.1| hypothetical protein DP1536 [Desulfotalea psychrophila LSv54]
          Length = 285

 Score = 45.4 bits (106), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 53/231 (22%), Positives = 106/231 (45%), Gaps = 17/231 (7%)

Query: 5   RLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAK-FINVLISKGDLAVGMVVTP 63
           RL  +V++ V A     +  + +S  +V    V+ + P +   ++ ++  D++ G  +  
Sbjct: 6   RLTFLVIAVVIAFSVSFVVYKKMSTPNV----VMEQKPGQATTDIAVAVKDMSRGSKIGS 61

Query: 64  NILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV--DRGNGGL 121
             ++   + +E +  G   D+ Q      + G +V  P+   +PI    L   D   GGL
Sbjct: 62  EDVQMATYLQETLPSGHFTDLEQ------VVGRIVLSPLTTTEPILNSDLAPQDLTKGGL 115

Query: 122 SSLLPKGKRAATMDISISSAVGGMIKPNDHVDV-VMVRSLSERKPTVT-VVLSNIRVIAI 179
           ++++   KRA  + +     V G + P   VDV V +    + +  +T  VL NI V+++
Sbjct: 116 AAVITPTKRAMAIKVDNVIGVAGFLHPGHLVDVLVSIEKPGDTRSQITKTVLQNILVLSV 175

Query: 180 DH--NIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNP 228
                  +D++V   +  TLE+   + + L  A +  ++ L LR  +D+ P
Sbjct: 176 GTLAQESADKKVHKVTVVTLEVDLEEGEKLALAVNEGRIQLALRGYSDVEP 226


>gi|257790321|ref|YP_003180927.1| Flp pilus assembly protein CpaB [Eggerthella lenta DSM 2243]
 gi|325830034|ref|ZP_08163491.1| Flp pilus assembly protein CpaB [Eggerthella sp. HGA1]
 gi|257474218|gb|ACV54538.1| Flp pilus assembly protein CpaB [Eggerthella lenta DSM 2243]
 gi|325487501|gb|EGC89939.1| Flp pilus assembly protein CpaB [Eggerthella sp. HGA1]
          Length = 306

 Score = 45.4 bits (106), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 57/107 (53%), Gaps = 6/107 (5%)

Query: 117 GNGG--LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNI 174
           G GG  LS+ L  G +A T+ + + + + G ++P D V +V     S  +  +  V    
Sbjct: 186 GMGGDRLSAELGAGLQAVTLAVDVETGLAGHVRPYDTVRIVSAEGASAGEAFLETVCERA 245

Query: 175 RVIAIDHNIDSDERVLVGSTA-TLELTPMQAKALVAAQSVAKLSLVL 220
           RV+A+  +  S   V  GS + T+E++P +A A+  AQ   ++SLVL
Sbjct: 246 RVVAVGDDATS---VQSGSASVTVEVSPEEADAVREAQFAGRVSLVL 289


>gi|227114875|ref|ZP_03828531.1| hypothetical protein PcarbP_18020 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 314

 Score = 45.1 bits (105), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 71/264 (26%), Positives = 113/264 (42%), Gaps = 51/264 (19%)

Query: 9   IVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFIN----VLISKGDLAVGMVVTPN 64
            V+SG   L AGI+A+ + S  H+ +E                VL++  DL  G  + P+
Sbjct: 7   YVLSGALVL-AGIVALMVRS--HLSSEPPAPPPVVVKAPEKAAVLVAAKDLHPGDFIDPS 63

Query: 65  ILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGL-SS 123
            L W    +E V   F + V   +    L G  +R  + +G  +    +V     G  ++
Sbjct: 64  SLRWQTT-DEPVSRSF-NFVRGQDNQSLLLGATLRETVTQGSWLSSNVVVKPNEPGFVAA 121

Query: 124 LLPKGKRAATMDISISSAVGGMIKPNDHVDVV--MVRS------LSERKPTVTVVLS--- 172
           +L KG RA ++  S  ++  G++   D VDV+  M R        S  +P V  +L+   
Sbjct: 122 VLHKGMRAISVPTSAIASNAGLVSAGDRVDVILSMRRDDQSELPASRNQPVVMPLLASQT 181

Query: 173 ---NIRVIAIDHN--------IDSDE------------------RVLVGSTATLELTPMQ 203
              ++RV+A++           D+ E                  R     T TLE+TP Q
Sbjct: 182 IVRDLRVLALNDKTGTPIYPRFDAAEDGTVLDATAKSRESAVRSRPATYQTVTLEVTPQQ 241

Query: 204 AKALVAAQSVAKLSLVLRSIADLN 227
           A+AL  A+ +  L L LRS ADL+
Sbjct: 242 AEALAVAKELGILHLALRS-ADLD 264


>gi|253687067|ref|YP_003016257.1| Flp pilus assembly protein CpaB [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251753645|gb|ACT11721.1| Flp pilus assembly protein CpaB [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 314

 Score = 44.7 bits (104), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 112/259 (43%), Gaps = 50/259 (19%)

Query: 9   IVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPA----KFINVLISKGDLAVGMVVTPN 64
            V+SG F L AGI+A  LV   H+ +E            + I VL++  DL  G  +  +
Sbjct: 7   YVLSGAFVL-AGIVA--LVVRSHLSSEPPAPPPVVAKAPEKIAVLVAAKDLHPGDFIDSS 63

Query: 65  ILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGL-SS 123
            + W    +E+V   F + V   ++   L G  +R  + +G  +    +V     G  ++
Sbjct: 64  SVRWQT-TDESVSRSF-NFVRGRDSQFLLFGATLRETVKEGTQLSSNVVVKPNEPGFVAA 121

Query: 124 LLPKGKRAATMDISISSAVGGMIKPNDHVDVV--MVRS------LSERKPTVTVVLS--- 172
           +L KG RA ++  S  ++  G++   D VDV+  M R       +S  +P V  +L+   
Sbjct: 122 VLHKGMRAISVPTSAIASNAGLVSAGDRVDVILSMRRDDQSELPVSRNQPVVMPLLASQT 181

Query: 173 ---NIRVIAIDHNIDS--------------------------DERVLVGSTATLELTPMQ 203
              ++RV+A++  + +                            R     T TLE+TP Q
Sbjct: 182 IVRDLRVLALNDKVGTPVYPRLDAMEDGAALDAAAKSRESAVRSRPATYQTVTLEVTPQQ 241

Query: 204 AKALVAAQSVAKLSLVLRS 222
           A+AL  A+ +  L L LRS
Sbjct: 242 AEALTVAKELGILHLSLRS 260


>gi|50119733|ref|YP_048900.1| hypothetical protein ECA0788 [Pectobacterium atrosepticum SCRI1043]
 gi|49610259|emb|CAG73702.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
          Length = 314

 Score = 44.7 bits (104), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 111/262 (42%), Gaps = 56/262 (21%)

Query: 9   IVVSGVFALVAGIIAMRLVSPHHVQTEE-----VITENPAKFINVLISKGDLAVGMVVTP 63
            V+SG   L AGI+A+ + S  H+ +E      ++ + P K + VL++   L  G  +  
Sbjct: 7   YVLSGALVL-AGIVALMVRS--HLSSEPPAPPPMVVKVPEK-VAVLVAAKALHPGDFIDS 62

Query: 64  NILEW--VAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGL 121
             L W     P    F+ FI      ++   L G  +R  + +G P+    LV     G 
Sbjct: 63  ASLRWDETDKPVSRTFN-FI---RGKDSQSLLLGATLRETVAEGTPLTSNVLVKPNEPGF 118

Query: 122 -SSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL--------SERKPTVTVVLS 172
            +++L KG RA ++  S  ++  G++   D VDV++            S  +P V  +L+
Sbjct: 119 VAAVLRKGMRAISVPTSAIASNAGLVSAGDRVDVILSMKRDDQAELPPSRNQPVVMPLLA 178

Query: 173 ------NIRVIAI---------------------DHNIDSDE-----RVLVGSTATLELT 200
                 ++RV+A+                     D    S E     R     T TLE+T
Sbjct: 179 SQTIVRDLRVLALNDKTGTPIYPRFDVAEDGTVLDATAKSRESAVRSRPTTYQTVTLEVT 238

Query: 201 PMQAKALVAAQSVAKLSLVLRS 222
           P QA+AL  A+ +  L L LRS
Sbjct: 239 PQQAEALAVAKELGMLHLALRS 260


>gi|281356955|ref|ZP_06243445.1| Flp pilus assembly protein CpaB [Victivallis vadensis ATCC BAA-548]
 gi|281316513|gb|EFB00537.1| Flp pilus assembly protein CpaB [Victivallis vadensis ATCC BAA-548]
          Length = 264

 Score = 44.7 bits (104), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 65/137 (47%), Gaps = 10/137 (7%)

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM------VRSLSERKPTVTVVLSN 173
           G + ++  G RA  + +   S+V  +I+PND VDV+       VR  S        +L +
Sbjct: 113 GFNGVIRPGMRAVAIPVDPVSSVNNLIQPNDDVDVIGTFRFPDVRGDSSLDTVTLTILQD 172

Query: 174 IRVIAIDHNIDSDERVLVGS----TATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
           ++V+A+ +   S      G+    T TL L P + + ++ A    KL+L LR+  D+  S
Sbjct: 173 VKVLAVGNRWGSASLDPAGARSYGTVTLLLYPEEVEMIIFASQKGKLNLSLRNFEDVKIS 232

Query: 230 SSEDSDVWDVQEEGKEI 246
              +    + ++  KEI
Sbjct: 233 RETEKRSVNFKQLEKEI 249


>gi|317489770|ref|ZP_07948269.1| flp pilus assembly protein CpaB [Eggerthella sp. 1_3_56FAA]
 gi|316911116|gb|EFV32726.1| flp pilus assembly protein CpaB [Eggerthella sp. 1_3_56FAA]
          Length = 306

 Score = 44.3 bits (103), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 56/107 (52%), Gaps = 6/107 (5%)

Query: 117 GNGG--LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNI 174
           G GG  LS+ L  G +A T+ + + + + G ++P D V +V     S  +  +  V    
Sbjct: 186 GMGGDRLSAELGAGLQAVTLAVDVETGLAGHVRPYDTVRIVSAEGASAGEAFLETVCERA 245

Query: 175 RVIAIDHNIDSDERVLVGSTA-TLELTPMQAKALVAAQSVAKLSLVL 220
           RV+A+    D    V  GS + T+E++P +A A+  AQ   ++SLVL
Sbjct: 246 RVVAVG---DDATGVQSGSASVTVEVSPEEADAVREAQFAGRVSLVL 289


>gi|311105391|ref|YP_003978244.1| Flp pilus assembly protein CpaB 1 [Achromobacter xylosoxidans A8]
 gi|310760080|gb|ADP15529.1| Flp pilus assembly protein CpaB 1 [Achromobacter xylosoxidans A8]
          Length = 284

 Score = 43.9 bits (102), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 96/217 (44%), Gaps = 18/217 (8%)

Query: 12  SGVFA--LVAGIIAMRLVSPH---HVQTEEVITENPAKFINVLISKGDLAVGMVVTPNIL 66
           +GV+A  L+AG+++   V  H    VQ  E     P   ++ L++  DL  G  +    L
Sbjct: 15  TGVYAIALIAGLVSAWAVREHVQQRVQALEAEARTP--MVSRLVAAYDLPAGTQLEELHL 72

Query: 67  EWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLL 125
                PE       ID    P  +  L G  +   +  G+P+    L        L+S L
Sbjct: 73  AVREIPEPWASRASID----PLDLSGLLGATLLADVANGEPLLRGHLTFTAPVPALASRL 128

Query: 126 PKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTV-VLSNIRVIAIDHNID 184
             G+RA T+  +    +  +++  D +D+ +  S + R+  +TV +L  +RV+ +    D
Sbjct: 129 RSGQRALTVAATDLGGLAEVLRVGDAIDIYV--SFAHRQQELTVPLLQGMRVLMVGGEAD 186

Query: 185 SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
            + +   G   TL  TP +A   VAA+    L+ +LR
Sbjct: 187 GENK---GGNITLAATPDEAMRFVAARQSGVLTAMLR 220


>gi|51468905|emb|CAE47778.1| pilus assembling protein [Bdellovibrio bacteriovorus]
          Length = 314

 Score = 43.9 bits (102), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 60/253 (23%), Positives = 111/253 (43%), Gaps = 42/253 (16%)

Query: 15  FALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEE 74
            ++ AG+ A  L+  +  + +    +       V+++K D+A    +   ++E    P  
Sbjct: 24  LSIAAGVFATFLLYSYSQEKKAEYDKRFGSTKRVVVAKEDIAEMQTIYDTMVETKELPA- 82

Query: 75  NVFDGFIDDVHQPNAM---QELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKR 130
                   D  QP+A+    E+ G +  VPI KG  +    L+  G + G+S  +   KR
Sbjct: 83  --------DFIQPDAITIPDEIIGNVAAVPIRKGQMVVKNNLLTPGPDTGISLQVAPSKR 134

Query: 131 AATMDISISSAVGGMIKPNDHVDVVMV----RSLSERKPTVTV------------VLSNI 174
           A T+ +     V  +I+P D +D+       + +++R+   T+            V++NI
Sbjct: 135 AVTIPVDEVRGVAKLIRPGDRIDIYAAVDSGKGVNQRREVFTMMNDVVVLATGVSVVNNI 194

Query: 175 -RVIAIDHNIDSDERV-LVG----STATLELTPMQAKALVAAQSVAKLSLVL-------R 221
            R+  +D    +  ++ L G    +T T+E TP +A+ L    S A  +L +       R
Sbjct: 195 PRMFELDSTGKNLTQIALTGDTKYTTITVEATPKEAQDLFYILSTAPGNLFMALRNPSDR 254

Query: 222 SIADLNPSSSEDS 234
           +I    PSS+ DS
Sbjct: 255 TIPPRMPSSTSDS 267


>gi|121607247|ref|YP_995054.1| SAF domain-containing protein [Verminephrobacter eiseniae EF01-2]
 gi|121551887|gb|ABM56036.1| SAF domain [Verminephrobacter eiseniae EF01-2]
          Length = 306

 Score = 43.5 bits (101), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 72/143 (50%), Gaps = 6/143 (4%)

Query: 87  PNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMI 146
           P   + ++G  +   +  G+ +    +  R     S+ +  G+RA T+ +   +++ G++
Sbjct: 91  PEHFERIEGQGIEHGLKAGEMLLWSLMQTRKAATFSARIEIGRRAITVHVDEINSISGLL 150

Query: 147 KPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSD----ERVLVGSTATLELTPM 202
           +P D +D+++      +K T   +L N++V+A       D    ER    ST TL+ T  
Sbjct: 151 EPGDAIDLMVTLDRGGKKITFP-LLQNVQVMATGQRSADDPKSGERRQY-STVTLDTTQA 208

Query: 203 QAKALVAAQSVAKLSLVLRSIAD 225
           QA++++ A+   K++ +LR+  D
Sbjct: 209 QAQSVIVAREAGKITALLRNPQD 231


>gi|296122068|ref|YP_003629846.1| Flp pilus assembly protein CpaB [Planctomyces limnophilus DSM 3776]
 gi|296014408|gb|ADG67647.1| Flp pilus assembly protein CpaB [Planctomyces limnophilus DSM 3776]
          Length = 334

 Score = 43.5 bits (101), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 72/135 (53%), Gaps = 14/135 (10%)

Query: 95  GVLVRVPILKGDPIRLEKLVDRGNGGLSSL-LPKGKRAATMDISISSAVG---GMIKPND 150
           G + R  I   +PIR  +L   G   L  L +  G RA  + IS++  VG   GMIKP +
Sbjct: 85  GRVARTKIRAAEPIRAGQLYQPGE--LPDLRVADGMRA--VSISVAEMVGIVDGMIKPGN 140

Query: 151 HVDVVMV---RSLSERKPTVTV-VLSNIRVIAIDHNIDSDERVLVG-STATLELTPMQAK 205
           +VDV+     +S ++ +  VT+ +   ++VIAI+ +  +  RV  G +  TLELT  QA 
Sbjct: 141 YVDVLFTVESQSNADLQGGVTMRLFEGVKVIAINRSF-TQSRVERGVNRVTLELTQAQAN 199

Query: 206 ALVAAQSVAKLSLVL 220
            +  A++   L+L+ 
Sbjct: 200 IITLAEAKGALTLIF 214


>gi|42521753|ref|NP_967133.1| putative flp pilus assembly protein CpaB [Bdellovibrio
           bacteriovorus HD100]
 gi|39574283|emb|CAE77787.1| putative flp pilus assembly protein CpaB [Bdellovibrio
           bacteriovorus HD100]
          Length = 301

 Score = 43.5 bits (101), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 60/253 (23%), Positives = 111/253 (43%), Gaps = 42/253 (16%)

Query: 15  FALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEE 74
            ++ AG+ A  L+  +  + +    +       V+++K D+A    +   ++E    P  
Sbjct: 11  LSIAAGVFATFLLYSYSQEKKAEYDKRFGSTKRVVVAKEDIAEMQTIYDTMVETKELPA- 69

Query: 75  NVFDGFIDDVHQPNAMQ---ELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKR 130
                   D  QP+A+    E+ G +  VPI KG  +    L+  G + G+S  +   KR
Sbjct: 70  --------DFIQPDAITIPDEIIGNVAAVPIRKGQMVVKNNLLTPGPDTGISLQVAPSKR 121

Query: 131 AATMDISISSAVGGMIKPNDHVDVVMV----RSLSERKPTVTV------------VLSNI 174
           A T+ +     V  +I+P D +D+       + +++R+   T+            V++NI
Sbjct: 122 AVTIPVDEVRGVAKLIRPGDRIDIYAAVDSGKGVNQRREVFTMMNDVVVLATGVSVVNNI 181

Query: 175 -RVIAIDHNIDSDERV-LVG----STATLELTPMQAKALVAAQSVAKLSLVL-------R 221
            R+  +D    +  ++ L G    +T T+E TP +A+ L    S A  +L +       R
Sbjct: 182 PRMFELDSTGKNLTQIALTGDTKYTTITVEATPKEAQDLFYILSTAPGNLFMALRNPSDR 241

Query: 222 SIADLNPSSSEDS 234
           +I    PSS+ DS
Sbjct: 242 TIPPRMPSSTSDS 254


>gi|91775996|ref|YP_545752.1| Flp pilus assembly CpaB [Methylobacillus flagellatus KT]
 gi|91709983|gb|ABE49911.1| Flp pilus assembly CpaB [Methylobacillus flagellatus KT]
          Length = 299

 Score = 43.5 bits (101), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 65/151 (43%), Gaps = 17/151 (11%)

Query: 42  PAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVP 101
           PA    +++++ D+  G V+ P  L       +N            +A  +L G +V   
Sbjct: 40  PAVLYPLVVARQDIPAGHVLLPEDLALEESESQNPL--------AYSATTDLVGRMVESS 91

Query: 102 ILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS 161
           I K  PI       RG    + LL  G+R   + +     VGG I+P DHVDV++  + S
Sbjct: 92  IEKNAPILSSHFAQRGPA--AQLLKHGERGVAIKVDEVVGVGGFIQPGDHVDVLVYINSS 149

Query: 162 ERKPT---VTVVLSNIRVI----AIDHNIDS 185
               T      +L ++RVI    A+  N+ S
Sbjct: 150 NGMTTDSSAQSILRDVRVISYGDALQQNVSS 180


>gi|110833079|ref|YP_691938.1| hypothetical protein ABO_0218 [Alcanivorax borkumensis SK2]
 gi|110646190|emb|CAL15666.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 298

 Score = 43.5 bits (101), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 2/69 (2%)

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDV-VMVRSLSERKPTVTVVLSNIRVIAI 179
           L+  +P   RA  +DI  +SAVGG+++P D VDV V  R   + +PT  ++L  I V+A+
Sbjct: 120 LAQSVPAQFRAFAIDIDNASAVGGLLEPGDLVDVLVHFRKGQDEQPTSMILLKAIEVLAV 179

Query: 180 DHNI-DSDE 187
              + D+D+
Sbjct: 180 KGQLQDADK 188


>gi|170725114|ref|YP_001759140.1| Flp pilus assembly protein CpaB [Shewanella woodyi ATCC 51908]
 gi|169810461|gb|ACA85045.1| Flp pilus assembly protein CpaB [Shewanella woodyi ATCC 51908]
          Length = 298

 Score = 42.7 bits (99), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 54/103 (52%), Gaps = 8/103 (7%)

Query: 81  IDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISS 140
           +D +H P    ++ G ++  P+  G P+    L        S +L +G+RA T++I   +
Sbjct: 82  LDAIH-PKDFNQIVGQMLLEPMSPGRPLMGTYLPGHKAEQFSDILKEGQRAVTINIDELN 140

Query: 141 AVGGMIKPNDHVDVVMVRSLSE-----RKPTVTVVLSNIRVIA 178
           +  GM+ P+DH+D+++  S  E      +  + ++L N+ V+A
Sbjct: 141 STAGMLVPSDHIDLLL--SFDEESGDIERKKLQLLLENVTVLA 181


>gi|84516632|ref|ZP_01003991.1| CpaB family protein [Loktanella vestfoldensis SKA53]
 gi|84509668|gb|EAQ06126.1| CpaB family protein [Loktanella vestfoldensis SKA53]
          Length = 277

 Score = 42.7 bits (99), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 91/188 (48%), Gaps = 15/188 (7%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQ--PNAMQELDGVLVRVPIL 103
           ++V ++   +  G  +T + +  V +P + + +G         P   Q     +V +P++
Sbjct: 48  VDVYVTTRSVTYGEYLTADDVRLVPYPRDYLPEGTFATEQSLFPQGTQTPR--VVVLPMI 105

Query: 104 KGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE 162
             + +   K+ + G + GL++L+  G RA  ++  +++  G +++P+D +DV     L +
Sbjct: 106 ANELVLTTKVSEPGASRGLTALVEPGFRAFPVEGRVAAGFG-ILRPDDRIDVYWTGRLRD 164

Query: 163 RKPTVTVVLSNIRVIAI---DHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLV 219
            +    ++ S +++IA+     N    + V+V      ++TP +   L  AQ+  +L+L 
Sbjct: 165 GREVTNLIKSGLQIIAVLGDAGNRGGPQSVVV------QVTPEEVALLTQAQNSGQLTLA 218

Query: 220 LRSIADLN 227
           L    DL+
Sbjct: 219 LVGTGDLS 226


>gi|91777218|ref|YP_552426.1| putative Flp pilus assembly CpaB [Burkholderia xenovorans LB400]
 gi|91689878|gb|ABE33076.1| Putative Flp pilus assembly CpaB [Burkholderia xenovorans LB400]
          Length = 363

 Score = 42.7 bits (99), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 102/222 (45%), Gaps = 35/222 (15%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKG 105
           + V++   D+ VG  ++    ++VA   E   D   DD+ + +  ++     +  P+ +G
Sbjct: 56  VTVVVPAQDVPVGTPLSSG--DFVA--REIAGDLVYDDMIRADNFEQYRSSHLVKPVRRG 111

Query: 106 DPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL----- 160
            P+R   +        S +L  G RA T++I   +A   +++P +HVDV  V  +     
Sbjct: 112 LPLRAGDIDALRGRDFSDVLRPGTRALTVEIDTVNATALLLRPGNHVDVYWVGKVFHEDH 171

Query: 161 -SERKPTVTVVLSNIRVIAIDHNI---DSDERV-----------------LVGSTATLEL 199
            S+ K    +V+ N+ V+A   ++   D+ E                   +  +T TLE+
Sbjct: 172 TSDEKKVAQLVMPNVLVLATGEDMRPRDAGEAAQQDQANANSSAMSRQAGMGYTTVTLEI 231

Query: 200 TPMQAKALVA-AQSVAKLSLVLRSIADL---NPSSSEDSDVW 237
            P+   A VA AQ +  L L+LR+  D     PS +++SDV+
Sbjct: 232 -PVDDVARVALAQKIGGLRLILRNSEDKGADGPSLAQESDVF 272


>gi|209546007|ref|YP_002277897.1| Flp pilus assembly protein CpaB [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209538864|gb|ACI58797.1| Flp pilus assembly protein CpaB [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 312

 Score = 42.7 bits (99), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 66/143 (46%), Gaps = 8/143 (5%)

Query: 16  ALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNIL-EWVAFPEE 74
           A++ G+I   L+   +  TE V  E  A     L     +  G  +TP++L E V  PE 
Sbjct: 8   AVIVGLITGVLL---YFWTESVKNEQVAYAFMRLQPDRKVTRGQAITPDMLAEPVMLPES 64

Query: 75  NVFDGFID-DVHQPNAMQE-LDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAA 132
             F       V   +A QE L        I  G  +  +   D   G L++++  GKRA 
Sbjct: 65  --FGALAKLAVPAASAYQEWLKDRTAAADIPAGSVLLFQYFDDNDGGRLTTMIAPGKRAL 122

Query: 133 TMDISISSAVGGMIKPNDHVDVV 155
           T+ ++ +SAVG  ++P  +VD++
Sbjct: 123 TLPVNAASAVGHFVEPGSYVDIL 145


>gi|78486069|ref|YP_391994.1| Flp pilus assembly CpaB [Thiomicrospira crunogena XCL-2]
 gi|78364355|gb|ABB42320.1| Flp (type IV) pilus assembly protein CpaB homolog [Thiomicrospira
           crunogena XCL-2]
          Length = 296

 Score = 42.7 bits (99), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 105/233 (45%), Gaps = 31/233 (13%)

Query: 17  LVAGIIAMRLVSPHHVQTEEVIT--ENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEE 74
           LV G +  R+       + + IT  E P +  +++++  D+  G  +  + ++ +  P E
Sbjct: 24  LVYGYVQNRVAEAEANASTKTITVVEKP-ELHSIVVASRDIYRGEKIEADDVKVLNVPME 82

Query: 75  N-VFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSS---LLPKGKR 130
             V  G I  ++  NA+    G +    I  G+ I  +KL         S   LL K +R
Sbjct: 83  GLVVKGVI--INPQNAV----GHVAHQKIYAGEWILAKKLKLESQSRFQSVEALLEKTRR 136

Query: 131 AATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT-VVLSNIRVIAID-------HN 182
           A  + I   + + G+I P DHVDV+ V   ++ K  V+  +L NI V++I          
Sbjct: 137 AIRLPIEPDTGLLGIISPGDHVDVISVFESADSKRMVSRTILQNITVLSIGIENQMRAST 196

Query: 183 IDSDE---RVLVGSTAT-------LELTPMQAKALVAAQSVAKLSLVLRSIAD 225
            DS+E    +     A+       L++   QA+ L  A +V  + L+LR+ AD
Sbjct: 197 ADSEEDNQNLFANKQASNKKSMVALDVDTTQAEKLALAMNVGAIHLLLRNSAD 249


>gi|149175454|ref|ZP_01854075.1| hypothetical protein PM8797T_18359 [Planctomyces maris DSM 8797]
 gi|148845722|gb|EDL60064.1| hypothetical protein PM8797T_18359 [Planctomyces maris DSM 8797]
          Length = 367

 Score = 42.4 bits (98), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 55/97 (56%), Gaps = 6/97 (6%)

Query: 128 GKRAATMDISIS-SAVGGMIKPNDHVDVVMVRS-LSERK---PTVTVVLSN-IRVIAIDH 181
           G RA ++ +  S   V G+IKP ++VDV M  + ++  K     +T+ L N +RVIAI+ 
Sbjct: 117 GMRAISVSLESSVDLVDGLIKPGEYVDVHMTPTGMNNDKRLNGGMTLTLFNGVRVIAINR 176

Query: 182 NIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSL 218
           +   +     G+  TLELTP QA  ++ A+   ++++
Sbjct: 177 SYTQNSSSRRGTNVTLELTPEQANIMILARDRGEITM 213


>gi|127511580|ref|YP_001092777.1| SAF domain-containing protein [Shewanella loihica PV-4]
 gi|126636875|gb|ABO22518.1| SAF domain protein [Shewanella loihica PV-4]
          Length = 298

 Score = 42.0 bits (97), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 81  IDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISS 140
           +D +H P+   E+ G ++  P+  G P+    L        S +L +G+RA T+DI   +
Sbjct: 82  LDAIH-PSRFGEVAGQMLLQPMAPGRPLIETYLPGMRVAQFSDILKEGQRAVTIDIDEIN 140

Query: 141 AVGGMIKPNDHVDVVM 156
           +  GM+ P+DH+D+++
Sbjct: 141 SSAGMLVPSDHIDLLL 156


>gi|307726634|ref|YP_003909847.1| Flp pilus assembly protein CpaB [Burkholderia sp. CCGE1003]
 gi|307587159|gb|ADN60556.1| Flp pilus assembly protein CpaB [Burkholderia sp. CCGE1003]
          Length = 365

 Score = 42.0 bits (97), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 83/189 (43%), Gaps = 29/189 (15%)

Query: 78  DGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDIS 137
           D   DD+ +P+  ++     +  P+ +G P+R   +        S +LP G+RA T++I 
Sbjct: 84  DLVYDDMIRPDNFEQYRTSHLVKPVRRGLPLRAGDIDALRGRDFSDILPAGQRAVTVEID 143

Query: 138 ISSAVGGMIKPNDHVDVVMV------RSLSERKPTVTVVLSNIRVIAIDHNID------- 184
             ++   +++P + VDV  +         S+ +    +++ N+ V+A   ++        
Sbjct: 144 TVNSTALLVRPGNRVDVYWIGKAFHQDRTSDDQRVAQLIMPNVLVLATGQDLRPRDAGEA 203

Query: 185 -------------SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSI---ADLNP 228
                        S ++ +  +T TL++    A  +  AQ +  L L+LR+    A   P
Sbjct: 204 SEQDQANANSSAMSRQQGMGYTTVTLQVPAEDAGRIALAQKIGGLRLILRNADDKASAGP 263

Query: 229 SSSEDSDVW 237
             +E+ DV+
Sbjct: 264 VLTEEQDVF 272


>gi|114797097|ref|YP_759868.1| putative Flp pilus assembly protein CpaB [Hyphomonas neptunium ATCC
           15444]
 gi|114737271|gb|ABI75396.1| putative Flp pilus assembly protein CpaB [Hyphomonas neptunium ATCC
           15444]
          Length = 295

 Score = 41.6 bits (96), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 84/187 (44%), Gaps = 18/187 (9%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
            + +++  +  G ++  +++E   +PE  V  G +  V          G++V      G+
Sbjct: 47  QIAVARATIEPGKLIDASMVEMRDWPESAVPAGAMRAVTDLGETAYSRGLVV-----AGE 101

Query: 107 PIRLEKLVDRGNG-GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDV---VMVRSL-- 160
           P+  EK+   G+   L++ +  G RA ++ ++  + V G + P D VDV   V  +    
Sbjct: 102 PLLAEKIDTTGSVLTLAANIQPGMRAVSVVVANDTGVAGFVLPGDRVDVNEFVEAKDARG 161

Query: 161 ----SERKPTVTV--VLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSV 213
               S R   V    VL  ++V+A+D   +   E     +T TLE+TP  A  L AA   
Sbjct: 162 APEDSRRSADVFAQPVLKGVKVLAVDQTFEEGLEGAYPSNTVTLEVTPQDALLLGAASRR 221

Query: 214 AKLSLVL 220
           A L L L
Sbjct: 222 AALGLAL 228


>gi|33593510|ref|NP_881154.1| putative secretory protein [Bordetella pertussis Tohama I]
 gi|33572866|emb|CAE42801.1| putative secretory protein [Bordetella pertussis Tohama I]
 gi|332382918|gb|AEE67765.1| putative secretory protein [Bordetella pertussis CS]
          Length = 281

 Score = 41.6 bits (96), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 96/212 (45%), Gaps = 15/212 (7%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITENPAK--FINVLISKGDLAVGMVVTPNILEWVAF 71
            FALVAG +A    +  H+Q      E  A+   +  L++  DL  G  +   ++     
Sbjct: 17  AFALVAGSLAA-WAAREHIQRRVHDIEQQARVPMVASLVAALDLEAGTPLHDELVAVRDM 75

Query: 72  PEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL-VDRGNGGLSSLLPKGKR 130
           P+  +  G +     P+    LDG ++R P+  G+ ++   L        L+  L  G+ 
Sbjct: 76  PQAWLPAGAL----LPDEAARLDGAVLRAPVKAGEALQAALLSYPEQTPALTEQLEAGQG 131

Query: 131 AATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTV-VLSNIRVIAIDHNIDSDERV 189
           A T+ +     +    +P D VD+ +  S + R+  +T+ +L+  +V+A+D   D+    
Sbjct: 132 AITLPLQELPGLSAAARPGDLVDLYV--SFTHRQRQLTMPLLAGSKVLALD-PADAQGGA 188

Query: 190 LVGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
              ST TL  +  +   LVAA+    L+ VLR
Sbjct: 189 ---STITLRASAREVARLVAARQEGTLTAVLR 217


>gi|33601079|ref|NP_888639.1| hypothetical protein BB2096 [Bordetella bronchiseptica RB50]
 gi|33575514|emb|CAE32592.1| putative exported protein [Bordetella bronchiseptica RB50]
          Length = 277

 Score = 41.2 bits (95), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 95/211 (45%), Gaps = 15/211 (7%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITENPAK--FINVLISKGDLAVGMVVTPNILEWVAF 71
            FALVAG +A    +  H+Q      E  A+   +  L++  DL  G  +   ++     
Sbjct: 17  AFALVAGSLAA-WAAREHIQRRVHDIEQQARVPMVASLVAARDLEAGTPLHDELVAVRDM 75

Query: 72  PEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL-VDRGNGGLSSLLPKGKR 130
           P+  +  G +     P+    LDG ++R P+  G+ ++   L        L+  L  G+ 
Sbjct: 76  PQAWLPAGALP----PDEAARLDGAVLRAPVKAGEALQAALLSYPEQTPALTEQLEAGQG 131

Query: 131 AATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTV-VLSNIRVIAIDHNIDSDERV 189
           A T+ +     +    +P D VD+ +  S + R+  +T+ +L+  +V+A+D   D+    
Sbjct: 132 AITLPLQELPGLSAAARPGDLVDLYV--SFTHRQRQLTMPLLAGSKVLALD-PADAQGGA 188

Query: 190 LVGSTATLELTPMQAKALVAAQSVAKLSLVL 220
              ST TL  +  +   LVAA+    L+ VL
Sbjct: 189 ---STITLRASAREVARLVAARQEGTLTAVL 216


>gi|163856387|ref|YP_001630685.1| putative secreted protein [Bordetella petrii DSM 12804]
 gi|163260115|emb|CAP42416.1| putative secreted protein [Bordetella petrii]
          Length = 281

 Score = 40.8 bits (94), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 87/199 (43%), Gaps = 16/199 (8%)

Query: 31  HVQTE--EVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPN 88
           H+Q    E+  E     ++ L+   DL  G  +    L     P   V  G  D    P 
Sbjct: 35  HIQARVREIEREAEVLAVDKLVVATDLPAGTRLQAGHLAVRDIPVPWVASGSFD----PE 90

Query: 89  AMQELDGVLVRVPILKGDPI-RLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIK 147
           A  ++ G ++   + +GD +  +          LS L+P G+RA T+     +A  G+++
Sbjct: 91  AADQVIGAVLAADLRQGDALLDVHLAPAVAAPALSELVPAGRRAVTLPAEEINAAAGLLR 150

Query: 148 PNDHVDVVMVRSLSERKPTVTV-VLSNIRVIAIDHNIDSDERVLVGSTATLELTPMQAKA 206
             D +D+ +  S + R   +T  ++  +RV+A++   D+   +      TL+ +   A  
Sbjct: 151 AGDLIDLYV--SFAHRGQHLTAPLMQGVRVLAMESGADAAPSI------TLDASAQDAIK 202

Query: 207 LVAAQSVAKLSLVLRSIAD 225
           LVAA+    L+ +LR   D
Sbjct: 203 LVAARHGGTLTAMLRHRGD 221


>gi|116255772|ref|YP_771605.1| hypothetical protein pRL110571 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115260420|emb|CAK03524.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 312

 Score = 40.8 bits (94), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 67/145 (46%), Gaps = 8/145 (5%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNIL-EWVAFP 72
           + A++ G+I   L+   +  TE V  E  A     L     +  G  +TP++L E V  P
Sbjct: 6   IAAVIVGLITGVLL---YFWTESVKNEQTAYAFMRLQPDRKVTRGQAITPDMLAEPVMLP 62

Query: 73  EENVFDGFID-DVHQPNAMQE-LDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKR 130
           E   F       V   +A QE L        I  G  +  +   D   G L++++  GKR
Sbjct: 63  ES--FGALAKLAVPAASAYQEWLKDRTAASDIPAGSVLLFQYFDDTDGGRLTTMIAPGKR 120

Query: 131 AATMDISISSAVGGMIKPNDHVDVV 155
           A T+ ++ ++AVG  ++P  +VD++
Sbjct: 121 ALTLPVNAAAAVGHFVEPGSYVDIL 145


>gi|59711119|ref|YP_203895.1| CpaB family Flp pilus assembly protein [Vibrio fischeri ES114]
 gi|59479220|gb|AAW85007.1| Flp pilus assembly protein CpaB family [Vibrio fischeri ES114]
          Length = 270

 Score = 40.4 bits (93), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 112/235 (47%), Gaps = 38/235 (16%)

Query: 9   IVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKF-------INVLISKGDLAVGMVV 61
           I+V  V A+  G+  M   S     TE  ITE   +F       + V I+K DL  G  V
Sbjct: 6   ILVLAVIAISIGLYGMSQTST----TESPITEKVQEFDKRPEATVMVWIAKKDLMFGSPV 61

Query: 62  TPNILE--WVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
               LE   ++  + + F G I DV + N  ++L   LV+  IL+GD +  + L+  G  
Sbjct: 62  QRTDLEVQRISQTQADRF-GIIHDV-KFNFNKKL---LVKKDILQGDIVTSDMLLSPGQE 116

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNI---- 174
           G L+ ++ +GK    +++S  + +GG I   D VD+  + S SE+  +    +SN+    
Sbjct: 117 GYLNLVISEGKVPFNLEVSNDAILGGAISVGDVVDIASISS-SEQNLSNDASISNVQSLK 175

Query: 175 ------RVIAIDHNIDSDERVLVGSTAT-------LELTPMQAKALVAAQSVAKL 216
                 +++ +D  I  ++ V + S +T       LE++  +   LV AQ +A+L
Sbjct: 176 MAPLLTQIMVLDI-IQQEKPVRLNSKSTKTVTNLVLEVSNRELAKLVIAQRIAEL 229


>gi|296134297|ref|YP_003641544.1| Flp pilus assembly protein CpaB [Thermincola sp. JR]
 gi|296032875|gb|ADG83643.1| Flp pilus assembly protein CpaB [Thermincola potens JR]
          Length = 257

 Score = 40.4 bits (93), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 75/153 (49%), Gaps = 26/153 (16%)

Query: 48  VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAM---QELDGVLVRVPILK 104
           V+++  ++    V+T +++     PEE V          PNA+   +++ G +    I  
Sbjct: 40  VVVANVNIPARTVITGDMVSVKDVPEEFV---------HPNAVLDEEQVIGFVSGSDISA 90

Query: 105 GDPIRLEKLVDR-GNG-GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL-- 160
           G+ +  EK++ + GN   LS  +P G RA ++ I+  + VGG+++P D VDV+    L  
Sbjct: 91  GEQVLREKILRKEGNPVSLSYQVPLGSRAMSVPINEVTGVGGLVRPGDRVDVIGTIELET 150

Query: 161 ------SERKPTVT----VVLSNIRVIAIDHNI 183
                  +  PT T    V+L N+ V+A+  N 
Sbjct: 151 SNPASNQQTGPTQTTVAHVLLQNVEVLAVGDNF 183


>gi|86360427|ref|YP_472315.1| hypothetical protein RHE_PE00151 [Rhizobium etli CFN 42]
 gi|86284529|gb|ABC93588.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 309

 Score = 40.0 bits (92), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 67/144 (46%), Gaps = 10/144 (6%)

Query: 16  ALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNIL-EWVAFPEE 74
           A++ G+I   L+   +  TE V  E  A     L     +  G  +TP++L E V  PE 
Sbjct: 8   AVIVGLITGVLL---YFWTESVKNEQVAYAFMRLQPDKKVTRGQAITPDMLAEPVMLPES 64

Query: 75  NVFDGFIDDVHQP--NAMQE-LDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRA 131
               G +  +  P  +A QE L        I  G  +  +   D   G L++++  GKRA
Sbjct: 65  F---GPLAKLAVPAASAYQEWLKDRTAAADIPAGSVLLFQYFDDTDGGRLTTMIAPGKRA 121

Query: 132 ATMDISISSAVGGMIKPNDHVDVV 155
            T+ ++ + AVG  ++P  +VD++
Sbjct: 122 LTLPVNAAEAVGHFVEPGSYVDIL 145


>gi|307295324|ref|ZP_07575163.1| Flp pilus assembly protein CpaB [Sphingobium chlorophenolicum L-1]
 gi|306878827|gb|EFN10046.1| Flp pilus assembly protein CpaB [Sphingobium chlorophenolicum L-1]
          Length = 301

 Score = 40.0 bits (92), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 57/121 (47%), Gaps = 19/121 (15%)

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER--------KPTVTVVLS 172
           L+  +P G RA ++D +   AV G+++P D VDV +V   ++         +     +L 
Sbjct: 117 LAMRVPMGMRAVSIDTTAEIAVAGLVRPGDRVDVQVVYPGADAISGARGAGRSRAQALLQ 176

Query: 173 NIRVIAIDHNIDSDERV-----------LVGSTATLELTPMQAKALVAAQSVAKLSLVLR 221
            ++V+A+   +    +            L   T TL LTP Q  AL  A+++  L+L LR
Sbjct: 177 MVQVLAVGEVVVGARQASGVEGALASPPLPARTVTLALTPEQVSALSLAKNIGALTLSLR 236

Query: 222 S 222
           +
Sbjct: 237 N 237


>gi|320161465|ref|YP_004174689.1| hypothetical protein ANT_20630 [Anaerolinea thermophila UNI-1]
 gi|319995318|dbj|BAJ64089.1| hypothetical protein ANT_20630 [Anaerolinea thermophila UNI-1]
          Length = 376

 Score = 40.0 bits (92), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 69/140 (49%), Gaps = 13/140 (9%)

Query: 24  MRLVSPHHVQTEEVITENPA----KFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDG 79
           +R  +P+ + T    T  P     +  +++IS   ++ G+      +  + +P++++ +G
Sbjct: 30  VRFFAPNQLPTAPGETSAPPTPVEEMTSIVISVQPISRGLEFNETNVTTIPYPKKDLVEG 89

Query: 80  -FIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD--RGNGGLSSLLPKGKRAATMDI 136
            FI D+      QE+ G   +  I    PI +  LVD    N   +  +P G+ A T+ +
Sbjct: 90  AFITDI------QEVLGKRAKFDIEARTPITMTMLVDPTTKNSPAAFQIPPGQVAITIPV 143

Query: 137 SISSAVGGMIKPNDHVDVVM 156
           S  S+V   ++P DHV+V++
Sbjct: 144 SKLSSVAYGLEPGDHVNVIV 163


>gi|241667103|ref|YP_002985187.1| Flp pilus assembly protein CpaB [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240862560|gb|ACS60225.1| Flp pilus assembly protein CpaB [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 318

 Score = 39.7 bits (91), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 67/145 (46%), Gaps = 8/145 (5%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNIL-EWVAFP 72
           + A++ G+I   L+   +  TE V  E  A     L     +  G  +TP++L E V  P
Sbjct: 6   IAAVIVGLITGVLL---YFWTESVKNEQVAYAFMRLQPDRKVTRGQAITPDMLAEPVMLP 62

Query: 73  EENVFDGFID-DVHQPNAMQE-LDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKR 130
           E   F       V   +A QE L        I  G  +  +   D   G L++++  GKR
Sbjct: 63  ES--FGALAKLAVPAASAYQEWLKDRTAASDIPAGSVLLFQYFDDTDGGRLTTMIAPGKR 120

Query: 131 AATMDISISSAVGGMIKPNDHVDVV 155
           A T+ ++ ++AVG  ++P  +VD++
Sbjct: 121 ALTLPVNAAAAVGHFVEPGSYVDIL 145


>gi|54309659|ref|YP_130679.1| hypothetical protein PBPRA2495 [Photobacterium profundum SS9]
 gi|46914097|emb|CAG20877.1| Hypothetical protein PBPRA2495 [Photobacterium profundum SS9]
          Length = 284

 Score = 39.3 bits (90), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 70/176 (39%), Gaps = 20/176 (11%)

Query: 9   IVVSGVFALVAGIIAM--RLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNIL 66
           I V    A++ G+  M   L+S     +  V  E   K+I V  +   LA G  ++P+ L
Sbjct: 6   IFVIAFLAVLTGLYGMADTLLSTTDTASPPVTEEKEIKYITVWRATSALARGQTLSPSSL 65

Query: 67  EWVAFPEENVFD-GFIDDV---HQPNAMQELD---GVLVRVPILKGDPIRLEKLVDRGNG 119
                 EE     G   DV    +P  +  +D   G LV  P L+  P         G  
Sbjct: 66  TREQLTEEAALSLGINSDVTLNFEPTTLMNMDVKQGALV-FPELQTSP---------GQA 115

Query: 120 GLSSLLPKGKRA-ATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNI 174
           G  +L+ +G      + I+  + +   I+P D++D++ V S        T  L N 
Sbjct: 116 GYLNLITRGDMTLYPLTIASKNLIDNYIQPGDYIDIMAVSSPRTNLSNTTSTLENF 171


>gi|37680195|ref|NP_934804.1| Flp pilus assembly protein CpaB [Vibrio vulnificus YJ016]
 gi|37198942|dbj|BAC94775.1| Flp pilus assembly protein CpaB [Vibrio vulnificus YJ016]
          Length = 279

 Score = 39.3 bits (90), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 60/122 (49%), Gaps = 18/122 (14%)

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE-----------RKPTVTV 169
           LS+L+  G RA ++++   +A  G+++P + VDV++  S SE               V  
Sbjct: 119 LSALVKPGMRAISIELDPMAAGLGLLRPGNKVDVLLT-SQSEIDQDANGTPIYNNMAVET 177

Query: 170 VLSNIRVIAIDHNI------DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSI 223
           VL NI ++AI +        +   +    ++ T E++   A+ LV A  + +LSLVLR  
Sbjct: 178 VLQNIHLLAIGNQYSPHQKPEKSAKSYDPTSVTFEVSLQDAEKLVLASKLGELSLVLRGN 237

Query: 224 AD 225
            D
Sbjct: 238 ND 239


>gi|27365650|ref|NP_761178.1| Flp pilus assembly protein CpaB [Vibrio vulnificus CMCP6]
 gi|320156052|ref|YP_004188431.1| flp pilus assembly protein CpaB [Vibrio vulnificus MO6-24/O]
 gi|27361798|gb|AAO10705.1| Flp pilus assembly protein CpaB [Vibrio vulnificus CMCP6]
 gi|319931364|gb|ADV86228.1| flp pilus assembly protein CpaB [Vibrio vulnificus MO6-24/O]
          Length = 279

 Score = 39.3 bits (90), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 60/122 (49%), Gaps = 18/122 (14%)

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE-----------RKPTVTV 169
           LS+L+  G RA ++++   +A  G+++P + VDV++  S SE               V  
Sbjct: 119 LSALVKPGMRAISIELDPMAAGLGLLRPGNKVDVLLT-SQSEIDQDANGTPIYNNMAVET 177

Query: 170 VLSNIRVIAIDHNI------DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSI 223
           VL NI ++AI +        +   +    ++ T E++   A+ LV A  + +LSLVLR  
Sbjct: 178 VLQNIHLLAIGNQYSPHQKPEKSAKSYDPTSVTFEVSLQDAEKLVLASKLGELSLVLRGN 237

Query: 224 AD 225
            D
Sbjct: 238 ND 239


>gi|325111215|ref|YP_004272283.1| Flp pilus assembly protein CpaB [Planctomyces brasiliensis DSM
           5305]
 gi|324971483|gb|ADY62261.1| Flp pilus assembly protein CpaB [Planctomyces brasiliensis DSM
           5305]
          Length = 349

 Score = 38.9 bits (89), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 54/118 (45%), Gaps = 12/118 (10%)

Query: 125 LPKGKRAATMDISIS-SAVGGMIKPNDHVDVVMVRS--LSE---RKPTVTVVLSNIRVIA 178
           L  G +A T+ +  S S V G+I+P D+VDV +  S  LS+   R      V   IRV+A
Sbjct: 115 LEPGMQAVTVSLGDSTSVVDGLIEPGDYVDVHLTVSDDLSDSRYRGGFTMTVFKGIRVLA 174

Query: 179 IDHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDV 236
           ++            +T T ELTP Q+  ++ AQ    +++        NP    D  V
Sbjct: 175 MNRLTQPTNISRGANTVTFELTPSQSNIILEAQRHGTITV------SYNPDGPGDGGV 226


>gi|94312585|ref|YP_585794.1| pilus assembly protein [Cupriavidus metallidurans CH34]
 gi|93356437|gb|ABF10525.1| pilus assembly protein [Cupriavidus metallidurans CH34]
          Length = 319

 Score = 38.9 bits (89), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 56/119 (47%), Gaps = 13/119 (10%)

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDV-VMVRSLSERKP--TVTVVLSNIRV 176
           GL+  +P G RA  + +     VG  ++P D VDV V++R  S+  P     ++LS +RV
Sbjct: 106 GLARQIPDGARAMAVAVDEVIGVGNQVQPGDFVDVFVVLRRDSQEIPQSQTRMLLSRLRV 165

Query: 177 IAI------DHNIDSDERVLV----GSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           +A       +      E+++       TA L +   Q   LV AQ   +L L LR+  D
Sbjct: 166 LAYGTGAVNEAPKQQGEQMMARREGAKTAVLSVPLEQVGTLVMAQQAGRLMLALRNPTD 224


>gi|255020087|ref|ZP_05292158.1| Flp pilus assembly protein CpaB [Acidithiobacillus caldus ATCC
           51756]
 gi|254970449|gb|EET27940.1| Flp pilus assembly protein CpaB [Acidithiobacillus caldus ATCC
           51756]
          Length = 419

 Score = 38.9 bits (89), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 52/110 (47%), Gaps = 6/110 (5%)

Query: 46  INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKG 105
           I  ++   D+A G ++  +++   + P     D    DV  P    +  G  V VP+L+G
Sbjct: 66  IKAVVPVQDIAPGTILDLSMVAARSIPA----DTAPSDVITPETFDQYAGHRVNVPLLQG 121

Query: 106 DPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVV 155
            PI    L  R    L+ ++   K A T  +   S + G+++P DHVDV+
Sbjct: 122 RPILASYLSGRRT--LADIVDPDKLAMTFTVDNVSTLDGLLQPGDHVDVL 169


>gi|254429646|ref|ZP_05043353.1| Flp pilus assembly protein CpaB [Alcanivorax sp. DG881]
 gi|196195815|gb|EDX90774.1| Flp pilus assembly protein CpaB [Alcanivorax sp. DG881]
          Length = 278

 Score = 38.5 bits (88), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV-RSLSERKPTVTVVLSNIRVI 177
           G L   LP G RA  + +      GG+++P D VDVV+  R +    P   V+L NI+V+
Sbjct: 109 GTLPGALPTGFRAVGVAVDDVVMAGGLLQPGDLVDVVVAFRKVERDNPAALVLLRNIQVL 168

Query: 178 AI 179
           A+
Sbjct: 169 AV 170


>gi|328952515|ref|YP_004369849.1| hypothetical protein Desac_0789 [Desulfobacca acetoxidans DSM
           11109]
 gi|328452839|gb|AEB08668.1| hypothetical protein Desac_0789 [Desulfobacca acetoxidans DSM
           11109]
          Length = 357

 Score = 38.5 bits (88), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 54/119 (45%), Gaps = 6/119 (5%)

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL--SERKPTVTVVLSNIRVIA 178
           L+  +P G RA ++ +   + V   +   D VDV+    L  S       +VL  ++V  
Sbjct: 53  LTENIPVGMRAVSIKVDEVTGVSRKVIKGDWVDVLATTPLPGSPHTSVARLVLDRVQVFD 112

Query: 179 I----DHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
           +    D    S ++     T TL +TP Q   L+AA S AK+SL+ R   D  P +  D
Sbjct: 113 VTLEADTKGQSKQKGEKDWTVTLLVTPDQGATLLAAASQAKISLLARQANDARPHNFRD 171


>gi|119773844|ref|YP_926584.1| Flp pilus assembly protein CpaB-like protein [Shewanella
           amazonensis SB2B]
 gi|119766344|gb|ABL98914.1| Flp pilus assembly protein CpaB-like protein [Shewanella
           amazonensis SB2B]
          Length = 298

 Score = 38.5 bits (88), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 39/74 (52%)

Query: 83  DVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAV 142
           D  +P+   E+ G ++   +  G P+    L        S LL +G+RA T+DI+  ++ 
Sbjct: 83  DAIRPSQFNEVAGQMLLSEMSPGRPLISAYLPGFKTRQFSDLLQEGQRAVTIDINEENST 142

Query: 143 GGMIKPNDHVDVVM 156
            GM+ P+D VD+ +
Sbjct: 143 AGMLVPSDLVDLFL 156


>gi|296158513|ref|ZP_06841343.1| Flp pilus assembly protein CpaB [Burkholderia sp. Ch1-1]
 gi|295891081|gb|EFG70869.1| Flp pilus assembly protein CpaB [Burkholderia sp. Ch1-1]
          Length = 365

 Score = 38.5 bits (88), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 83/187 (44%), Gaps = 31/187 (16%)

Query: 81  IDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISS 140
            DD+ + +  ++     +  P+ +G P+R   +        S +L  G RA T++I   +
Sbjct: 87  YDDMIRADGFEQYRSSHLVKPVRRGLPLRAGDIDALRGRDFSDILRPGTRALTVEIDTVN 146

Query: 141 AVGGMIKPNDHVDVVMV------RSLSERKPTVTVVLSNIRVIAIDHNID---------- 184
           +   +++P + VDV  V         S+ K    +V+ N+ V+A   ++           
Sbjct: 147 STALLLRPGNRVDVYWVGKVFHENRTSDEKKVAQLVMPNVLVLATGEDMRPRDAGEAAQQ 206

Query: 185 ----------SDERVLVGSTATLELTPMQAKALVA-AQSVAKLSLVLRSIADL---NPSS 230
                     S +  +  +T TLE+ P+   A +A AQ +  L L+LR+  D     PS 
Sbjct: 207 DQANANSSAMSRQTGMGYTTVTLEV-PVDDVARIALAQKIGGLRLILRNSEDKGADGPSL 265

Query: 231 SEDSDVW 237
           +++SDV+
Sbjct: 266 AQESDVF 272


>gi|83589202|ref|YP_429211.1| Flp pilus assembly CpaB [Moorella thermoacetica ATCC 39073]
 gi|83572116|gb|ABC18668.1| Flp pilus assembly CpaB [Moorella thermoacetica ATCC 39073]
          Length = 229

 Score = 38.1 bits (87), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 75/174 (43%), Gaps = 29/174 (16%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNI 65
           ++ I+     A+ +GI   R +S H   T+ ++   PA  IN             + P  
Sbjct: 21  ILAIIFGLAVAVASGIYYQRYISTHQAMTQVIV---PAHNINAYTQ---------IKPGD 68

Query: 66  LEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLL 125
           L W   P   V  G      +P+   +L G +    + +G+ +RLE++     G +S+  
Sbjct: 69  LTWRQVPVGAVEPG---TARKPD---DLVGKVALAELYQGEQVRLERV-----GEVST-- 115

Query: 126 PKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAI 179
              K+   ++I ++ + GG   P D VDV      +E  P   ++ SN R++ +
Sbjct: 116 -DDKQVVAVNIDLARSGGGYFSPGDLVDVYFAE--TENVPG-AILASNARLLQL 165


>gi|188592031|ref|YP_001796629.1| flp pilus assembly cpab [Cupriavidus taiwanensis LMG 19424]
 gi|170938405|emb|CAP63392.1| putative Flp pilus assembly CpaB [Cupriavidus taiwanensis LMG
           19424]
          Length = 316

 Score = 37.7 bits (86), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 56/119 (47%), Gaps = 13/119 (10%)

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV-RSLSERKP--TVTVVLSNIRV 176
           GL++ +P+G+RA  + +     VG  ++P D+VDV +V R   +  P     ++LS +RV
Sbjct: 106 GLAAQVPEGERAVAVSVDEVIGVGNQVQPGDYVDVFLVLRRDQQEIPDSQARMLLSRLRV 165

Query: 177 IAI-------DHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           +A           +  ++   R     TA L +   Q   L  AQ   +L L LR+  D
Sbjct: 166 LAYGVASVNRPQAVKPEQMMARQEGAKTAVLSVPLEQVSRLAMAQHSGRLMLALRNPQD 224


>gi|194745344|ref|XP_001955148.1| GF16392 [Drosophila ananassae]
 gi|190628185|gb|EDV43709.1| GF16392 [Drosophila ananassae]
          Length = 268

 Score = 37.7 bits (86), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 8/108 (7%)

Query: 145 MIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDERVLVGSTATLELTPMQA 204
           M K +  V  + VRS  ++ P +    S  R  + D  ID+ E  + G   ++ L    A
Sbjct: 63  MSKDSYQVSNLEVRSNGQKTPAI----SEARASSADGFIDAIENYIRGHDVSMNLPLADA 118

Query: 205 KALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAG 252
           K  V+A+++A   L L    +L  +  E  D  DV+  GK+  I K G
Sbjct: 119 KVTVSARNLANNQLSL----NLQLNGDESDDATDVEARGKKGNIFKKG 162


>gi|197335888|ref|YP_002155268.1| Flp pilus assembly protein CpaB [Vibrio fischeri MJ11]
 gi|197317378|gb|ACH66825.1| Flp pilus assembly protein CpaB [Vibrio fischeri MJ11]
          Length = 270

 Score = 37.7 bits (86), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 112/235 (47%), Gaps = 38/235 (16%)

Query: 9   IVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKF-------INVLISKGDLAVGMVV 61
           I+V  V A+  G+  M   S     TE  ITE   +F       + V I+K DL  G +V
Sbjct: 6   ILVLAVIAISIGLYGMSQTST----TESPITEKVQEFDKLPEPTVMVWIAKKDLMFGSLV 61

Query: 62  TPNILE--WVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
               LE   ++  + + F G   DV + N  ++L   L++  IL+GD +  + ++  G  
Sbjct: 62  QRTDLEVQRISQTQADRF-GIAHDV-KFNFNKKL---LIKKDILQGDIVTSDMVLSPGQE 116

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNI---- 174
           G L+ ++ +GK    +++S  + +GG I   D VD+  + S SE+  +    +SN+    
Sbjct: 117 GYLNLVISEGKVPFNLEVSNDAILGGAISVGDVVDIASISS-SEQNLSNDASISNVQSLK 175

Query: 175 ------RVIAIDHNIDSDERVLVGSTAT-------LELTPMQAKALVAAQSVAKL 216
                 +++ +D  I  ++ V + S +T       LE++  +   LV AQ +A+L
Sbjct: 176 MAPLLTQIMVLDI-IQQEKPVRLNSKSTKTVTTLVLEVSNRELAKLVIAQRIAEL 229


>gi|269926136|ref|YP_003322759.1| Flp pilus assembly protein CpaB [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269789796|gb|ACZ41937.1| Flp pilus assembly protein CpaB [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 258

 Score = 37.4 bits (85), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 87/214 (40%), Gaps = 28/214 (13%)

Query: 44  KFINVLISKGDLAVGMVVTPNILEWVAFPEE----NVFDGFIDDVHQPNAMQELDGVLVR 99
           K + V+++  D+A G  +T ++LE   FP +           D V++ +A   + G ++ 
Sbjct: 39  KQVQVVVAAQDIAQGSPITASMLETKPFPADFAPSEAVSSINDAVNRYSATNIVKGQIIT 98

Query: 100 VPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV-- 157
            P+L            +  G L+  +PKGK A  +  S   +  G I+P D VDV++   
Sbjct: 99  RPLLSDT---------KQVGKLALSIPKGKVAFALPASDLLSGNGQIQPGDRVDVLVTFF 149

Query: 158 ----------RSLSERKPTVTVVLSNIRVI-AIDHNIDSDERVLVGSTATLELTPMQAKA 206
                     ++  E + T    L ++ V+  +     SD          L + P QA  
Sbjct: 150 VKMTSIGPDGQTSDEERATTQTTLQDLEVLDVLGTGAGSDGGNAKSPAVVLLVDPQQAVT 209

Query: 207 LVAAQSVAK--LSLVLRSIADLNPSSSEDSDVWD 238
           L  A+   K  + L LR  +D +     D +  D
Sbjct: 210 LKLAKDSDKAVIDLALRGSSDDHKQHETDGETED 243


>gi|198284414|ref|YP_002220735.1| Flp pilus assembly protein CpaB [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218667886|ref|YP_002427082.1| hypothetical protein AFE_2705 [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198248935|gb|ACH84528.1| Flp pilus assembly protein CpaB [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218520099|gb|ACK80685.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 323

 Score = 37.4 bits (85), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 85/178 (47%), Gaps = 27/178 (15%)

Query: 14  VFALVAGIIAMRLVSPHHV---QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVA 70
           + A+  G+ A  +  P  V   +T     + P   + V+++   L+ G  + P+ ++ + 
Sbjct: 14  LLAIALGVSAYLVSQPSPVVQSKTSAAAPQQPTAGVAVVVAAKTLSAGFPIPPDGVKVLH 73

Query: 71  FPEENVFDGFIDDVHQPNAMQELDGVLVRVP---ILKGDPIRLEKLVDRGNGGLSSLLPK 127
           +PE   F           A  E   V+ +VP   I  G P+    L+     GL++ +P+
Sbjct: 74  YPE---FPA--------GAFHETAHVVGKVPQVNIGMGAPVMSSNLLS----GLATQVPE 118

Query: 128 GKRAATMDISISSAVGGMIKPNDHVDVVMV-----RSLSERKPTVT-VVLSNIRVIAI 179
           G  A  +D++ + AVG  ++P D+VDV         ++    PT + ++L+++RV+A+
Sbjct: 119 GDVAMAIDVNKAIAVGDHLQPGDYVDVFTTLAGDQMTMHGGWPTQSRLLLADLRVLAV 176


>gi|258515698|ref|YP_003191920.1| Flp pilus assembly protein CpaB [Desulfotomaculum acetoxidans DSM
           771]
 gi|257779403|gb|ACV63297.1| Flp pilus assembly protein CpaB [Desulfotomaculum acetoxidans DSM
           771]
          Length = 247

 Score = 37.4 bits (85), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 79/193 (40%), Gaps = 25/193 (12%)

Query: 74  ENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGL-----SSLLPKG 128
           EN+    I     PN+ Q L G + R  I  G P+  + L   G G L     S      
Sbjct: 65  ENIPKAAIKQGMFPNS-QNLIGKVTRTVIPAGYPVSKDFLAIEGPGSLLTTQISQFKDPK 123

Query: 129 KRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE---RKPTVTVVLSNIRVIAIDHNIDS 185
            RA  + +   +A+ G I P D VDVV    L     ++P    +   + VIA+    + 
Sbjct: 124 LRATPVTVQGVNALDGKIMPGDRVDVVGNMKLPMGGLQQPVSQTIGVQVPVIAVTGEPNK 183

Query: 186 DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSI------ADLNPSSSEDSDVWDV 239
              V++G      LTP QA+ +  A++   + L L         A   P++S+      +
Sbjct: 184 PTGVILG------LTPQQAQDVGFAETAGTIKLSLNPYQPDTNAARTTPTTSQSFIEKYI 237

Query: 240 QEEGKEIQIIKAG 252
           Q++    Q I AG
Sbjct: 238 QQQ----QQINAG 246


>gi|33600810|ref|NP_888370.1| hypothetical protein BB1825 [Bordetella bronchiseptica RB50]
 gi|33568410|emb|CAE32322.1| putative membrane protein [Bordetella bronchiseptica RB50]
          Length = 313

 Score = 37.4 bits (85), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 76/189 (40%), Gaps = 30/189 (15%)

Query: 91  QELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPND 150
           + L G +VR  I  G+P+    L      GL+  L  G+RA T+ +   S     I P D
Sbjct: 86  EALLGQMVRQDIPAGEPVTAPMLAR----GLARHLAPGERAVTIAVDELSGAQNRILPGD 141

Query: 151 HVD--VVMVRSLSERKPTVTVVLSNIRVIA-----IDHNIDSDERVLVGSTATLELTPMQ 203
            VD  VVM R +        ++ S I+V+A     +D     +E+  V         P  
Sbjct: 142 LVDVFVVMDRGIEVPGTQTRLLQSRIKVLAYGQRSVDGPPQGEEKPSVAQRGQPPAAPRN 201

Query: 204 A---------KALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQ--EEGKEIQIIKAG 252
           A           L+ A    +L LVLR        S ED DV D+    E   +  ++AG
Sbjct: 202 AMLAVPVERVNELLLAAKAGRLQLVLR--------SPEDVDVPDLALFPERAPVLALRAG 253

Query: 253 VIVNKDGEG 261
           +   +  +G
Sbjct: 254 LTAEQQRDG 262


>gi|87308905|ref|ZP_01091043.1| pilus assembly protein CpaB [Blastopirellula marina DSM 3645]
 gi|87288248|gb|EAQ80144.1| pilus assembly protein CpaB [Blastopirellula marina DSM 3645]
          Length = 299

 Score = 37.4 bits (85), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 96/224 (42%), Gaps = 17/224 (7%)

Query: 13  GVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKG--DLAVGMVVTPNILEWVA 70
           GV A++ G+++  +V  + ++    + E  A     ++ K   +L  G  +T   +    
Sbjct: 3   GVVAVMFGLLSAYVVRKNMMKETPPVVETTAPPKTFVVPKAAVNLPAGRTLTLGDVVIYQ 62

Query: 71  FPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-GLSSLLPKGK 129
           + E+ + +  +   +  NA Q + G  +R  + +      +     G G G+   L  G+
Sbjct: 63  YTEKQLEEQPLPTGYMVNATQ-IIGRTLRQELTEKSVFTPDMFYPEGTGPGIVQNLGAGQ 121

Query: 130 RAATMDISISSAVGGMIKPNDHVDVVMVRSL---SERKPTVTVVLSNIRVIAID------ 180
           RA T+ I    AV G  +P   VDV+        +E   T   +L +++V+A D      
Sbjct: 122 RAFTVRIEYDEAVEGFARPGTKVDVLFRAEADPENELAETTVTLLQDVKVLAFDSSPSAL 181

Query: 181 HNIDSDE----RVLVGSTATLELTPMQAKALVAAQSVAKLSLVL 220
           H I +++    R+   +T TL + P +A  L  A      +L L
Sbjct: 182 HPIVNEQSQRLRMREYATVTLAVLPHEATKLQVADDHGTFALAL 225


>gi|56460013|ref|YP_155294.1| Flp pilus assembly protein CpaB [Idiomarina loihiensis L2TR]
 gi|56179023|gb|AAV81745.1| Flp pilus assembly protein CpaB [Idiomarina loihiensis L2TR]
          Length = 235

 Score = 37.4 bits (85), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 67/145 (46%), Gaps = 5/145 (3%)

Query: 14  VFALVAGIIAMRLVSPHHVQ-TEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFP 72
           +F+ +  ++ + L++ +  Q T   + E      +V++   DL VG ++  + L    +P
Sbjct: 12  IFSSIISMVTIFLINQYLQQETSRRLQEASGNADSVVVFSKDLNVGDILEVSDLLVRKYP 71

Query: 73  EENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAA 132
            E + + +    +  +A   + G  +R  +  G+P+    L +  N GLS +LP G  A 
Sbjct: 72  HELINEHW----YLESAANLIIGRKLRSSVKSGEPVSERVLSNNQNNGLSEVLPNGYYAI 127

Query: 133 TMDISISSAVGGMIKPNDHVDVVMV 157
           T+          ++K  D VD+V V
Sbjct: 128 TVTTDNLGHHNALLKVGDLVDIVFV 152


>gi|304315801|ref|YP_003850946.1| SAF domain protein [Thermoanaerobacterium thermosaccharolyticum DSM
           571]
 gi|302777303|gb|ADL67862.1| SAF domain protein [Thermoanaerobacterium thermosaccharolyticum DSM
           571]
          Length = 213

 Score = 37.0 bits (84), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 11/107 (10%)

Query: 124 LLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAI---- 179
           +L +G R  T+ +++ S++ G IKP D VDV       E+     V+ + + +  I    
Sbjct: 105 VLKEGMRRVTISVNLESSLAGKIKPGDLVDVGWAPKSDEKGENGAVIANKVEIYDIVNKS 164

Query: 180 -------DHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLV 219
                  D N   D   L+ +  TL +TP QA A+   ++   L L+
Sbjct: 165 GGDIKKADKNNQYDTDSLLPAAVTLIVTPEQAIAIKEYEAKGSLFLM 211


>gi|33596968|ref|NP_884611.1| hypothetical protein BPP2375 [Bordetella parapertussis 12822]
 gi|33566419|emb|CAE37672.1| putative membrane protein [Bordetella parapertussis]
          Length = 313

 Score = 37.0 bits (84), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 76/189 (40%), Gaps = 30/189 (15%)

Query: 91  QELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPND 150
           + L G +VR  I  G+P+    L      GL+  L  G+RA T+ +   S     I P D
Sbjct: 86  EALLGQMVRQDIPAGEPVTAPMLAR----GLARHLAPGERAVTIAVDELSGAQNRILPGD 141

Query: 151 HVD--VVMVRSLSERKPTVTVVLSNIRVIA-----IDHNIDSDERVLVGSTATLELTPMQ 203
            VD  VVM R +        ++ S I+V+A     +D     +E+  V         P  
Sbjct: 142 LVDVFVVMDRGIEVPGTQTRLLQSRIKVLAYGQRSVDGPPQGEEKPSVAQRGQPPAAPRN 201

Query: 204 A---------KALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQ--EEGKEIQIIKAG 252
           A           L+ A    +L LVLR        S ED DV D+    E   +  ++AG
Sbjct: 202 AMLAVPVERVNELLLAAKAGRLQLVLR--------SPEDVDVPDLALFPERAPVLALRAG 253

Query: 253 VIVNKDGEG 261
           +   +  +G
Sbjct: 254 LTAEQQRDG 262


>gi|33593024|ref|NP_880668.1| hypothetical protein BP1995 [Bordetella pertussis Tohama I]
 gi|33563399|emb|CAE42275.1| putative membrane protein [Bordetella pertussis Tohama I]
 gi|332382436|gb|AEE67283.1| hypothetical protein BPTD_1965 [Bordetella pertussis CS]
          Length = 313

 Score = 37.0 bits (84), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 76/189 (40%), Gaps = 30/189 (15%)

Query: 91  QELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPND 150
           + L G +VR  I  G+P+    L      GL+  L  G+RA T+ +   S     I P D
Sbjct: 86  EALLGQMVRQDIPAGEPVTAPMLAR----GLARHLAPGERAVTIAVDELSGAQNRILPGD 141

Query: 151 HVD--VVMVRSLSERKPTVTVVLSNIRVIA-----IDHNIDSDERVLVGSTATLELTPMQ 203
            VD  VVM R +        ++ S I+V+A     +D     +E+  V         P  
Sbjct: 142 LVDVFVVMDRGIEVPGTQTRLLQSRIKVLAYGQRSVDGPPQGEEKPSVAQRGQPPAAPRN 201

Query: 204 A---------KALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQ--EEGKEIQIIKAG 252
           A           L+ A    +L LVLR        S ED DV D+    E   +  ++AG
Sbjct: 202 AMLAVPVERVNELLLAAKAGRLQLVLR--------SPEDIDVPDLALFPERAPVLALRAG 253

Query: 253 VIVNKDGEG 261
           +   +  +G
Sbjct: 254 LTAEQQRDG 262


>gi|104779899|ref|YP_606397.1| Flp pilus assembly protein CpaB [Pseudomonas entomophila L48]
 gi|95108886|emb|CAK13582.1| putative Flp pilus assembly protein CpaB [Pseudomonas entomophila
           L48]
          Length = 316

 Score = 37.0 bits (84), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 7/99 (7%)

Query: 89  AMQELDGVLVRV---PILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGM 145
           A Q+LD VL R    P+  G    L+    +  G L+ ++   +RA  + +       G 
Sbjct: 94  AFQQLDQVLGRSSSRPLAAGS--WLDDSSFQAGGPLARMIRANERAVAVAVDDVIGAAGQ 151

Query: 146 IKPNDHVDVVMVRSLSERKP--TVTVVLSNIRVIAIDHN 182
           ++P D VDV++        P  +  VVL  +RV+++DH 
Sbjct: 152 LRPGDFVDVLLFLREENNNPQSSAQVVLPALRVLSVDHQ 190


>gi|330816714|ref|YP_004360419.1| Flp pilus assembly CpaB [Burkholderia gladioli BSR3]
 gi|327369107|gb|AEA60463.1| Flp pilus assembly CpaB [Burkholderia gladioli BSR3]
          Length = 305

 Score = 36.6 bits (83), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 101/244 (41%), Gaps = 37/244 (15%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
           LT+++ + +  + AL+ GI A  L               PAK   V+++   L  G  + 
Sbjct: 5   LTKILAVALIAI-ALLLGIFAWVLGRKPAPVVNNAQQATPAKLFPVVVAARPLKGGQPIP 63

Query: 63  PNIL---EWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG 119
            + L   +  A PE      F D V           ++ RVPI    P +   L    + 
Sbjct: 64  ADGLKVQQAAALPE----GAFADPVQ----------IVGRVPIAD-VPEQAAVLESSLSS 108

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-VRSLSERKPTVT---------- 168
           G++  +  G+RA  + +  ++AVG  ++P + VDV + ++  S    T+           
Sbjct: 109 GVADQIAPGERAIAVKVDETNAVGNKVRPGNFVDVFLNLKKDSAAGTTLAGNGGSEVPKT 168

Query: 169 ---VVLSNIRVIAIDHNI---DSDERVLVG-STATLELTPMQAKALVAAQSVAKLSLVLR 221
              ++LS IRVIA        DS    L G  TA L +   Q  AL   ++   L+L LR
Sbjct: 169 QAKLLLSRIRVIAFGDATTARDSSGGALNGVRTAVLAVPAAQVDALTLGEASGSLTLALR 228

Query: 222 SIAD 225
           +  D
Sbjct: 229 NPRD 232


>gi|107022593|ref|YP_620920.1| Flp pilus assembly CpaB [Burkholderia cenocepacia AU 1054]
 gi|116689542|ref|YP_835165.1| Flp pilus assembly CpaB [Burkholderia cenocepacia HI2424]
 gi|170732846|ref|YP_001764793.1| Flp pilus assembly protein CpaB [Burkholderia cenocepacia MC0-3]
 gi|105892782|gb|ABF75947.1| Flp pilus assembly CpaB [Burkholderia cenocepacia AU 1054]
 gi|116647631|gb|ABK08272.1| Flp pilus assembly CpaB [Burkholderia cenocepacia HI2424]
 gi|169816088|gb|ACA90671.1| Flp pilus assembly protein CpaB [Burkholderia cenocepacia MC0-3]
          Length = 301

 Score = 36.6 bits (83), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 59/123 (47%), Gaps = 17/123 (13%)

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDV----------VMVRSLSERKPTVT- 168
           GL+  L  G+RA  + +  ++AVG  ++P ++VDV          V +   S  +   T 
Sbjct: 108 GLAEQLAPGERAVAIKVDETNAVGNRVRPGNYVDVFLNLKRDGTGVAIGGTSTAEIVNTQ 167

Query: 169 --VVLSNIRVIAIDHNI---DSDERVLVGS-TATLELTPMQAKALVAAQSVAKLSLVLRS 222
             +++S +RV++        DS    +VG+ TA L +   Q  AL  A+   +L L LRS
Sbjct: 168 ARLLMSKVRVLSFGDATTERDSSNGSVVGTRTAVLAVPTAQVDALTLAEQSGRLVLALRS 227

Query: 223 IAD 225
             D
Sbjct: 228 PRD 230


>gi|114321312|ref|YP_742995.1| Flp pilus assembly protein CpaB-like protein [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|114227706|gb|ABI57505.1| Flp pilus assembly protein CpaB-like protein [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 316

 Score = 36.6 bits (83), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 66/164 (40%), Gaps = 29/164 (17%)

Query: 91  QELDGVLVRVPILKGDPIRLEKL-----VDRGNGGLSSLLPKGKRAATMDISISSAVGGM 145
           +E+ G+ V  PI +G+ +   +      V RG      LLP G+RA  + +     VGG 
Sbjct: 93  EEVIGLRVEAPIQEGELLTAPRFSVASQVSRG------LLP-GERAVAISVDDVIGVGGY 145

Query: 146 IKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNI-------------DSDERVLVG 192
           + P D VDV++  S         ++  NIRV+A   ++             +  +R    
Sbjct: 146 LSPGDRVDVMLYLSQRGVGEIGRLLHPNIRVLAYGEDLAIPPDGVVDRRDEEGTQRQRGA 205

Query: 193 STATLELTPMQAKALVAAQSVAKLSLVLRSI----ADLNPSSSE 232
            TA L L       L+ A S   L L  R       D +P + E
Sbjct: 206 RTAVLALPEEDVATLLLADSAGTLRLAARPAIERRPDFDPEAFE 249


>gi|317403506|gb|EFV84009.1| flp pilus assembly protein CpaB [Achromobacter xylosoxidans C54]
          Length = 226

 Score = 36.6 bits (83), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 63/146 (43%), Gaps = 19/146 (13%)

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGG--MIKPND 150
           L G   RV I  GDP+    L      GL   L  G+RA    I++   VGG   I P D
Sbjct: 73  LQGAYARVDIAAGDPLLPSMLAQ----GLGRQLKPGERAVA--IAVDEVVGGGNRIAPGD 126

Query: 151 HVDVVMV--RSLSERKPTVTVVLSNIRVIAID-HNIDS--DERVLVGS------TATLEL 199
            VDV  +  + +  +     ++ S +RV+A    ++D   D+  L G       TA L +
Sbjct: 127 LVDVFFLLEKGVEIQAGQARLLQSRVRVLAYGTASVDGPEDKGTLPGPPGQPARTAVLAV 186

Query: 200 TPMQAKALVAAQSVAKLSLVLRSIAD 225
              Q   L+ A    +L L LR + D
Sbjct: 187 PVEQVSELLLAGRSGRLQLALRPVGD 212


>gi|294146465|ref|YP_003559131.1| Flp pilus assembly protein CpaB [Sphingobium japonicum UT26S]
 gi|292676882|dbj|BAI98399.1| Flp pilus assembly protein CpaB [Sphingobium japonicum UT26S]
          Length = 302

 Score = 36.6 bits (83), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 61/141 (43%), Gaps = 27/141 (19%)

Query: 108 IRLEKLVDRGNGGLSSLL----PKGKRAATMDISISSAVGGMIKPNDHVDVVMVR----- 158
           I L  L+ R   G+ S L    P G RA ++D +   AV G+I+P D VDV +V      
Sbjct: 98  IGLHALIARDAVGMESKLAIRVPMGMRAISIDTTAEIAVAGLIRPGDRVDVQVVYPGADA 157

Query: 159 ---SLSERKPTVTVVLSNIRVIAIDHNIDSDERVLVGS---------------TATLELT 200
              +    +     +L  ++V+A+   +   ++    +               T TL LT
Sbjct: 158 ISGARGSGRSRAQALLQMVQVLAVGEVVVGTQQASGANGGVEGALSSPPPPARTVTLALT 217

Query: 201 PMQAKALVAAQSVAKLSLVLR 221
           P Q   L  A+++  L+L LR
Sbjct: 218 PEQVSILSLAKNIGALTLSLR 238


>gi|187921505|ref|YP_001890537.1| Flp pilus assembly protein CpaB [Burkholderia phytofirmans PsJN]
 gi|187719943|gb|ACD21166.1| Flp pilus assembly protein CpaB [Burkholderia phytofirmans PsJN]
          Length = 366

 Score = 36.6 bits (83), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 74/166 (44%), Gaps = 29/166 (17%)

Query: 101 PILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL 160
           P+ +G P+R   +        S +L  G RA T+DI   ++   M++P + VDV  +  +
Sbjct: 107 PVRRGLPLRAADIDALHGRDFSDVLRSGTRAVTVDIDTVNSTALMLRPGNRVDVYWIGKV 166

Query: 161 SER------KPTVTVVLSNIRVIAIDHNI---DSDERVL----------------VG-ST 194
             +      K    ++L+N  ++A   ++   D+ E +                 VG +T
Sbjct: 167 YHQDNSNDDKKVAQLMLANTLILATGQDMRPRDAGEAMQEDPANANSSAMSRQPGVGYTT 226

Query: 195 ATLELTPMQAKALVAAQSVAKLSLVLRSIADL---NPSSSEDSDVW 237
            TLE+    A  +  AQ +  L L+LR+  D     PS  +++DV+
Sbjct: 227 VTLEVPVADAGRIALAQKIGGLRLILRNSDDKGTNGPSLVQENDVF 272


>gi|323529160|ref|YP_004231312.1| Flp pilus assembly protein CpaB [Burkholderia sp. CCGE1001]
 gi|323386162|gb|ADX58252.1| Flp pilus assembly protein CpaB [Burkholderia sp. CCGE1001]
          Length = 363

 Score = 36.6 bits (83), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 39/80 (48%)

Query: 78  DGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDIS 137
           D   DD+ +P    +     +  P+ +G P+R   +        S +LP G+RA T++I 
Sbjct: 84  DLVYDDMVRPENFDQYRASHLVKPVRRGLPLRAADIDALHGRDFSDVLPAGQRAVTVEID 143

Query: 138 ISSAVGGMIKPNDHVDVVMV 157
             ++   +++P + VDV  +
Sbjct: 144 TVNSTALLLRPGNRVDVYWI 163


>gi|312621079|ref|YP_003993807.1| flp pilus assembly protein rcpc/cpab [Photobacterium damselae
           subsp. damselae]
 gi|311872800|emb|CBX86891.1| Flp pilus assembly protein RcpC/CpaB [Photobacterium damselae
           subsp. damselae]
          Length = 267

 Score = 36.6 bits (83), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 53/231 (22%), Positives = 100/231 (43%), Gaps = 38/231 (16%)

Query: 9   IVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEW 68
           +++ G++ L     A  L +P      E I E P   I V     D+  G  +  N+L  
Sbjct: 13  VILFGLYGL-----ATNLSNPTSPANHEPIKEEPK--IRVWKLNKDVHPGEFIERNMLSV 65

Query: 69  VAFPEENVFD-GFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD-RGNGGLSSLLP 126
              PE      GF+DDV+    +      + +  +  G  + ++ LV    +G +  ++ 
Sbjct: 66  ENIPESEANGLGFVDDVN----LDWKAKTVFKSHLSAGSLLTIDDLVQPDQDGYIDFIID 121

Query: 127 KGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL-------------SERKPTVTVVLSN 173
           + K    + ++ SS +GG+I     VD++ +  L             S+   ++T ++S 
Sbjct: 122 ENKIPFPIIVTPSSVIGGVIANGSLVDILALTGLTGTASNFGNNSGSSKNTVSITPIISA 181

Query: 174 IRVIAIDHNI--------DSDERVLVGSTATLELTPMQAKALVAAQSVAKL 216
           ++V+ + H +         SDE+V    T  +ELT  QA  L  AQ ++++
Sbjct: 182 VKVLLVKHQLIDTNRQSDTSDEQV----TLVVELTRKQAVVLTVAQRISEI 228


>gi|187251613|ref|YP_001876095.1| pilus assembly protein [Elusimicrobium minutum Pei191]
 gi|186971773|gb|ACC98758.1| Pilus assembly protein [Elusimicrobium minutum Pei191]
          Length = 253

 Score = 36.2 bits (82), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 56/257 (21%), Positives = 113/257 (43%), Gaps = 62/257 (24%)

Query: 8   GIVVSGVFALVAGIIAMRLVSPHHVQTEE---------VITENPAKFINVLISKGDLAVG 58
           G+ +  V A++A ++   ++  +  + EE          I + P + +   I+KGDL  G
Sbjct: 4   GVFLPLVIAILAAVVYFIILFSNQSKFEENSKLERVVIAIRDLPERKV---ITKGDL--G 58

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLV-RVPILKGDPIRLEKLVDRG 117
           ++  PN      F +++ F      V + + + +L+  LV R+ I KG+ +         
Sbjct: 59  VIEMPN-----KFLQKDAFT-----VTRDSDITKLENNLVTRIAIPKGNQV--------S 100

Query: 118 NGGLSSLLPKGKRAATMD--------ISISSAVGGMIKPNDHVDVVM-----VRSLSERK 164
              L+SL P+   +A +           + S+V  +IKP+D VDV++     +++  +++
Sbjct: 101 KAALTSLSPEAGLSARVSPLWRGFVLTDVPSSVANLIKPDDWVDVLLTFDAYMKNTGQKE 160

Query: 165 PTVTVVLSNIRVIAIDHNID----------SDERVLVGSTA------TLELTPMQAKALV 208
                +L  I+V+ + +++           + ER    S        +L L P  A+ L 
Sbjct: 161 KITATILQRIKVLGVGNDLGQGMDANQLRATREREASASAFNDSSAISLALHPRDAQYLA 220

Query: 209 AAQSVAKLSLVLRSIAD 225
            A+    ++LV+R   D
Sbjct: 221 LAKEEGIITLVVRRRED 237


>gi|269105131|ref|ZP_06157825.1| flp pilus assembly protein RcpC/CpaB [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268160581|gb|EEZ39080.1| flp pilus assembly protein RcpC/CpaB [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 267

 Score = 36.2 bits (82), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 53/231 (22%), Positives = 100/231 (43%), Gaps = 38/231 (16%)

Query: 9   IVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEW 68
           +++ G++ L     A  L +P      E I E P   I V     D+  G  +  N+L  
Sbjct: 13  VILFGLYGL-----ATNLSNPTSPANHEPIKEEPK--IRVWKLNKDVHPGEFIERNMLSV 65

Query: 69  VAFPEENVFD-GFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD-RGNGGLSSLLP 126
              PE      GF+DDV+    +      + +  +  G  + ++ LV    +G +  ++ 
Sbjct: 66  ENIPESEANGLGFVDDVN----LDWKAKTVFKSHLSAGSLLTIDDLVQPDQDGYIDFIID 121

Query: 127 KGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL-------------SERKPTVTVVLSN 173
           + K    + ++ SS +GG+I     VD++ +  L             S+   ++T ++S 
Sbjct: 122 ENKIPFPIIVTPSSVIGGVIANGSLVDILALTGLNGTASNFGNNSGSSKNTVSITPIISA 181

Query: 174 IRVIAIDHNI--------DSDERVLVGSTATLELTPMQAKALVAAQSVAKL 216
           ++V+ + H +         SDE+V    T  +ELT  QA  L  AQ ++++
Sbjct: 182 VKVLLVKHQLIDTNRQSDTSDEQV----TLVVELTRKQAVVLTVAQRISEI 228


>gi|224539927|ref|ZP_03680466.1| hypothetical protein BACCELL_04839 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224518481|gb|EEF87586.1| hypothetical protein BACCELL_04839 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 382

 Score = 36.2 bits (82), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 8/87 (9%)

Query: 173 NIRVIAIDHNIDSDERVLVGSTATLELTPMQA--KALVAAQSVAKLSLVLRS-----IAD 225
           ++R +A + + D D  V+V  T  +ELT  +      + A  V +L LV+R+     + D
Sbjct: 225 SVRAVAGNTSADLDLEVVVTGTYQMELTTPRGLLSTEITAGDVKRLELVVRNTGSSLLKD 284

Query: 226 LNPSSSEDSDVWDVQEEGKEIQIIKAG 252
           +  SS +  D W+V  E  +I+I+KAG
Sbjct: 285 IQLSSGKPKD-WEVSFEPAKIEILKAG 310


>gi|72162670|ref|YP_290327.1| hypothetical protein Tfu_2271 [Thermobifida fusca YX]
 gi|71916402|gb|AAZ56304.1| hypothetical protein Tfu_2271 [Thermobifida fusca YX]
          Length = 258

 Score = 36.2 bits (82), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 48/104 (46%), Gaps = 10/104 (9%)

Query: 125 LPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTV-VLSNIRVIAIDHNI 183
           L  G+R   + I+  + V G +     VDV      +E+ P   + VL+N+ V+ +  +I
Sbjct: 117 LENGEREIAIMINAETGVAGKVSRQSRVDVYASFQANEQSPACAIRVLTNVEVLDV-GDI 175

Query: 184 DSDERVLVGST-----ATLELTPMQAKALVAAQSVA---KLSLV 219
            S      G T      T  LTP QA  L  A+S A   +L+LV
Sbjct: 176 GSQIDAQTGGTNTVVPVTFRLTPQQALQLTYAESFASKVRLALV 219


>gi|187935275|ref|YP_001885712.1| PTS system, beta-glucoside-specific IIABC component [Clostridium
           botulinum B str. Eklund 17B]
 gi|187723428|gb|ACD24649.1| PTS system, beta-glucoside-specific IIABC component [Clostridium
           botulinum B str. Eklund 17B]
          Length = 626

 Score = 35.8 bits (81), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 63/133 (47%), Gaps = 16/133 (12%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
           +  ++G   +G++A ++G++    VSP        I ENP   I+ LI+    A+  VVT
Sbjct: 384 IAAMIGGGCAGIYAGLSGLVRYAFVSPGLAALPAFIGENPMNIIHALIT---CAIAFVVT 440

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQ-------ELDGVLVRVPILKGDPIRLEKLVD 115
              L W+   E+ + D   ++V + N+ +       E++G +  V  L G  I L K+ D
Sbjct: 441 -FALTWIIGFEDPIDD---EEVKENNSTEIKSEEKVEINGSMEIVSPLSGKLIPLSKVND 496

Query: 116 RGNGGLSSLLPKG 128
               G   LL KG
Sbjct: 497 DVFSG--ELLGKG 507


>gi|158337969|ref|YP_001519145.1| bifunctional protein FolD [Acaryochloris marina MBIC11017]
 gi|190359419|sp|B0C3J3|FOLD_ACAM1 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|158308210|gb|ABW29827.1| bifunctional protein FolD [Acaryochloris marina MBIC11017]
          Length = 295

 Score = 35.8 bits (81), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 59/137 (43%), Gaps = 32/137 (23%)

Query: 71  FPEENVFDGFIDDVHQPNAMQELDGVLVRVPI------------------LKG-DPIRLE 111
           FP E  F+     +H  NA  ++DG+LV++P+                  + G  P+ L 
Sbjct: 73  FPAEVTFEEVKQTIHDLNANPQVDGILVQLPLPAHLDSTALLYEIDPDKDVDGLHPLNLG 132

Query: 112 KLVDRGNGGLSSLLPKG--KRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTV 169
           +LV RG  GL S  P G  +  A  D+ +S           H  VV+ RS+   KP   +
Sbjct: 133 RLV-RGEAGLRSCTPAGVMRLLAAYDVELSGL---------HA-VVIGRSILVGKPVSLM 181

Query: 170 VLSNIRVIAIDHNIDSD 186
           +L+    + + H+   D
Sbjct: 182 LLAANATVTMAHSRTPD 198


>gi|170701751|ref|ZP_02892687.1| Flp pilus assembly protein CpaB [Burkholderia ambifaria IOP40-10]
 gi|170133334|gb|EDT01726.1| Flp pilus assembly protein CpaB [Burkholderia ambifaria IOP40-10]
          Length = 301

 Score = 35.8 bits (81), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 66/153 (43%), Gaps = 34/153 (22%)

Query: 119 GGLSSLLPK----GKRAATMDISISSAVGGMIKPNDHVDVVM---------VRSLSERKP 165
           GGL+S L      G+RA  + +  S+AVG  ++P + VDV +          ++ SE   
Sbjct: 104 GGLTSGLADQVALGERAVAVKVDESNAVGNRLRPGNFVDVFLNLRRDGSGGAQATSEIPA 163

Query: 166 T-VTVVLSNIRVIAI-DHNIDSDERVLVGS---TATLELTPMQAKALVAAQSVAKLSLVL 220
           T   ++LS +RV++  D   D D          TA L +   Q  AL  A++  +L+L L
Sbjct: 164 TQARLLLSKVRVLSFGDATSDRDGGGGPSGAVRTAVLAVPTAQVDALTLAEASGRLTLAL 223

Query: 221 RSIADL----------------NPSSSEDSDVW 237
           R+  D                  PS+   S VW
Sbjct: 224 RNPRDTEIATQTVAVRTGGGEATPSAQAASGVW 256


>gi|317403406|gb|EFV83919.1| flp pilus assembly protein CpaB [Achromobacter xylosoxidans C54]
          Length = 279

 Score = 35.8 bits (81), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 84/191 (43%), Gaps = 16/191 (8%)

Query: 40  ENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVR 99
           E+    ++ L++  DL  G  +TP  L     P +      I    +P     + G  + 
Sbjct: 45  EHREAMVSRLVAARDLPAGTELTPAHLAIRDIPAQWAPAASI----EPRDGDSVLGTRLG 100

Query: 100 VPILKGDPIRLEKLVDRGNGG----LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVV 155
           + + +GDP+ L   + R +      L++ L  G+RA  + ++    V  +++  D VD+ 
Sbjct: 101 LALAQGDPV-LSGCLARADSASPPALAARLDPGQRALQVPVADLGTVADLLRVGDLVDIY 159

Query: 156 MVRSLSERKPTVTV-VLSNIRVIAIDHNIDSDERVLVGSTATLELTPMQAKALVAAQSVA 214
           +  S   R   VT  +L  +RV+A+           V    TL  TP QA   +AA+   
Sbjct: 160 V--SFPHRGREVTTPLLQGVRVLAVPDAGGGTGPAQV----TLAATPNQAMRYLAARRAG 213

Query: 215 KLSLVLRSIAD 225
            L+ ++R+ AD
Sbjct: 214 TLTGLVRNRAD 224


>gi|257064753|ref|YP_003144425.1| Flp pilus assembly protein CpaB [Slackia heliotrinireducens DSM
           20476]
 gi|256792406|gb|ACV23076.1| Flp pilus assembly protein CpaB [Slackia heliotrinireducens DSM
           20476]
          Length = 273

 Score = 35.8 bits (81), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 93/220 (42%), Gaps = 20/220 (9%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNI 65
           + GI+     AL   + A +L +    Q  E +     +   V ++  D+A G  V    
Sbjct: 8   VFGILCGIACALCVAMYAQQLQADADAQRAEALARYGGEQTEVWVATRDIAPGETVDETN 67

Query: 66  LEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRV---PILKGDPIRLEKLVDRGNGGLS 122
            E         +  ++ ++   +A+ +L G+  RV   PI++G+ I  ++ V   +  L 
Sbjct: 68  AE---------YRMWLVELLPHDAVSDLAGLESRVATSPIVQGEVISAQRFV-ADDEALG 117

Query: 123 SLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHN 182
           + +P+G  A ++     + VGG I+    VDV +         T T +L++  ++     
Sbjct: 118 TPVPEGLCAVSVPAEDVATVGGSIRAGSRVDVYV------SSGTTTDLLAHDVLVLFTSA 171

Query: 183 IDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRS 222
             +D    + S ATL + P   + L++A     L   L S
Sbjct: 172 SSADGSEAI-SWATLAVEPEMVQELISAAERTSLYFSLPS 210


>gi|73539230|ref|YP_299597.1| Flp pilus assembly CpaB [Ralstonia eutropha JMP134]
 gi|72122567|gb|AAZ64753.1| Flp pilus assembly CpaB [Ralstonia eutropha JMP134]
          Length = 318

 Score = 35.8 bits (81), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 56/119 (47%), Gaps = 13/119 (10%)

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV-RSLSER--KPTVTVVLSNIRV 176
           GL++ +P+G+RA  + +     VG  ++P D+VDV +V R  S+        ++L  +RV
Sbjct: 107 GLAAQIPEGERAVAIAVDEVIGVGNQVQPGDYVDVFLVLRRDSQEIGASQARMLLPRLRV 166

Query: 177 IAI------DHNIDSDERVLV----GSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           +A       +      E+++       TA L +   Q   L  AQ   +L + LR+  D
Sbjct: 167 LAYGSGAVNEPQKQQPEQMMTRREGAKTAVLSVPLEQVSKLAMAQHSGRLLMALRNPHD 225


>gi|189465679|ref|ZP_03014464.1| hypothetical protein BACINT_02039 [Bacteroides intestinalis DSM
           17393]
 gi|189433943|gb|EDV02928.1| hypothetical protein BACINT_02039 [Bacteroides intestinalis DSM
           17393]
          Length = 382

 Score = 35.4 bits (80), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 8/87 (9%)

Query: 173 NIRVIAIDHNIDSDERVLVGSTATLELTPMQA--KALVAAQSVAKLSLVLRS-----IAD 225
           ++R +A + + D D  V+V  T  +ELT  +      + A  V +L LV+R+     + D
Sbjct: 225 SVRAVAGNTSADLDLEVVVTGTYQMELTTPRGLLSTEITAGDVKRLELVVRNTGSSLLKD 284

Query: 226 LNPSSSEDSDVWDVQEEGKEIQIIKAG 252
           +  SS + +D W+V  E  +I+++KAG
Sbjct: 285 IQLSSGKPTD-WEVSFEPAKIEMLKAG 310


>gi|326390773|ref|ZP_08212326.1| SAF domain protein [Thermoanaerobacter ethanolicus JW 200]
 gi|325993167|gb|EGD51606.1| SAF domain protein [Thermoanaerobacter ethanolicus JW 200]
          Length = 212

 Score = 35.4 bits (80), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 48/102 (47%), Gaps = 13/102 (12%)

Query: 130 RAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAI---------- 179
           R  T+ ++++S++ G IKP D VD+  V     +     +V   +++  +          
Sbjct: 110 RRVTIGVNLTSSLAGKIKPGDFVDIGWVPKDEAKDGASKIVAEKVQIYDVVNKSGEDVRK 169

Query: 180 -DHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVL 220
            D N   D+  L+ +  TL +TP Q  A++  +  AK SL L
Sbjct: 170 ADKNNQYDKESLIPAAVTLIVTPEQ--AVIIKEYEAKGSLFL 209


>gi|167562916|ref|ZP_02355832.1| Flp pilus assembly protein CpaB family [Burkholderia oklahomensis
           EO147]
          Length = 226

 Score = 35.4 bits (80), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 57/117 (48%), Gaps = 14/117 (11%)

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-VRSLSERKPT--------VTVV 170
           GL+  +  G+RA  + +  ++AVG  ++P + VDV M ++  S    T          ++
Sbjct: 109 GLADQIAPGERAVAIKVDDTNAVGNRLRPGNFVDVFMNMKRESSFGTTGSEISQSQARLL 168

Query: 171 LSNIRVIAI-DHNIDSDER---VLVGS-TATLELTPMQAKALVAAQSVAKLSLVLRS 222
           LS +RV++  D   D D        G+ TA L +   Q  AL  A++  +L L LRS
Sbjct: 169 LSRVRVLSFGDATADRDGTPGPTGAGARTAVLAVPTAQVDALTLAEASGRLVLALRS 225


>gi|116694139|ref|YP_728350.1| flp pilus assembly protein CpaB [Ralstonia eutropha H16]
 gi|113528638|emb|CAJ94985.1| flp pilus assembly protein CpaB [Ralstonia eutropha H16]
          Length = 317

 Score = 35.4 bits (80), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 55/120 (45%), Gaps = 13/120 (10%)

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV-RSLSERKP--TVTVVLSNIR 175
            GL++ + +G+RA  + +     VG  ++P D+VDV +V R   +  P     ++LS +R
Sbjct: 106 AGLATQVREGERAVAVSVDEVIGVGNQVQPGDYVDVFLVLRRDQQEIPESQARMLLSRLR 165

Query: 176 VIAI-------DHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           V+A          N   ++   R     TA L +   Q   L  AQ   +L L LR+  D
Sbjct: 166 VLAYGVASVNRPQNAKPEQMMARQEGAKTAVLSVPLEQVSRLAMAQQSGRLLLALRNPQD 225


>gi|29345660|ref|NP_809163.1| dihydroorotase [Bacteroides thetaiotaomicron VPI-5482]
 gi|253567647|ref|ZP_04845058.1| dihydroorotase [Bacteroides sp. 1_1_6]
 gi|29337552|gb|AAO75357.1| dihydroorotase (DHOase) [Bacteroides thetaiotaomicron VPI-5482]
 gi|251841720|gb|EES69800.1| dihydroorotase [Bacteroides sp. 1_1_6]
          Length = 445

 Score = 35.0 bits (79), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 51/110 (46%), Gaps = 9/110 (8%)

Query: 73  EENVFDGFIDDV---HQPNAMQELDGVLVRV----PILKGDPIRLEKLVDRGNGGLSSLL 125
           +E V  G ID +   H P+++ E +G  ++V    P ++   + + +L D+G   +  ++
Sbjct: 297 QEAVNSGLIDAIATDHAPHSLSEKEGGALKVMSGMPTIQFSLVSMLELADKGAFSIEKVV 356

Query: 126 PKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIR 175
            K   A      I +   G I+     D+V+VR  SE   T   +LS  +
Sbjct: 357 EKMSHAPAQMYEIRNR--GFIRKGYQADLVLVRPDSEWTVTTDCILSKCK 404


>gi|115351455|ref|YP_773294.1| CpaB family Flp pilus assembly protein [Burkholderia ambifaria
           AMMD]
 gi|115281443|gb|ABI86960.1| Flp pilus assembly protein CpaB family [Burkholderia ambifaria
           AMMD]
          Length = 301

 Score = 35.0 bits (79), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 64/148 (43%), Gaps = 30/148 (20%)

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM---------VRSLSERKPT-VTV 169
           GL+  +  G+RA  + +  S+AVG  ++P + VDV +          +  SE   T   +
Sbjct: 109 GLADQVALGERAVAVKVDESNAVGNRLRPGNFVDVFLNLRRDGSGGAQVNSEIPATQARL 168

Query: 170 VLSNIRVIAI-DHNIDSDERVLVGS---TATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           +LS +RV++  D   D D     G    TA L +   Q  AL  A++  +L+L LR+  D
Sbjct: 169 LLSRVRVLSFGDATSDRDGGGGPGGAVRTAVLAVPTAQVDALTLAEASGRLTLALRNPRD 228

Query: 226 L----------------NPSSSEDSDVW 237
                             PS+   S VW
Sbjct: 229 TEIATQTVAVRTGGGGATPSAQAASGVW 256


Searching..................................................done


Results from round 2




>gi|254780728|ref|YP_003065141.1| pilus assembly protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040405|gb|ACT57201.1| pilus assembly protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 263

 Score =  319 bits (818), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 263/263 (100%), Positives = 263/263 (100%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV
Sbjct: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG
Sbjct: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
           LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID
Sbjct: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180

Query: 181 HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQ 240
           HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQ
Sbjct: 181 HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQ 240

Query: 241 EEGKEIQIIKAGVIVNKDGEGIS 263
           EEGKEIQIIKAGVIVNKDGEGIS
Sbjct: 241 EEGKEIQIIKAGVIVNKDGEGIS 263


>gi|315121892|ref|YP_004062381.1| pilus assembly protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495294|gb|ADR51893.1| pilus assembly protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 267

 Score =  280 bits (716), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 164/266 (61%), Positives = 213/266 (80%), Gaps = 3/266 (1%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK TRLMG+VVSG+FAL+AGIIAMRLVS HH+Q EE++ +   +  NVL++K +L VGMV
Sbjct: 1   MKFTRLMGLVVSGLFALLAGIIAMRLVSHHHLQKEEIVAQPSIRLSNVLMAKSNLKVGMV 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +TP++LEWVAFP ENV  GF+DDV +PNA++EL G +VR+PILKGDPIR EKLVD G  G
Sbjct: 61  ITPDVLEWVAFPAENVVVGFVDDVSRPNAIEELKGSIVRIPILKGDPIRFEKLVDHGQHG 120

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
           +SSLL KGKRA  +DIS+S+AVGG++KPNDHVDV+MVR + ERK    VVLSN+RV+AID
Sbjct: 121 VSSLLSKGKRAVALDISVSNAVGGLVKPNDHVDVLMVRLIGERKTKTDVVLSNVRVLAID 180

Query: 181 HNIDSDERV--LVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSDVW 237
             +D++     L+G+TATLELTPMQAK L+AAQ +A KL+LVLRSI+D + +  E +D  
Sbjct: 181 QTLDAEGEPNGLIGNTATLELTPMQAKTLLAAQQIASKLTLVLRSISDFHSTDLEIADFN 240

Query: 238 DVQEEGKEIQIIKAGVIVNKDGEGIS 263
             ++ G+ IQ+IK+G+I NKDGE +S
Sbjct: 241 LGEDGGRGIQVIKSGIISNKDGEEMS 266


>gi|227823970|ref|YP_002827943.1| pilus assembly protein CpaB [Sinorhizobium fredii NGR234]
 gi|227342972|gb|ACP27190.1| pilus assembly protein CpaB [Sinorhizobium fredii NGR234]
          Length = 271

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 104/264 (39%), Positives = 165/264 (62%), Gaps = 7/264 (2%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLV-SPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK  R++ + V+   A +AG++AM+L  SP     E ++ + P+  INVL++   L VG 
Sbjct: 1   MKPVRIIILAVAVGSAAMAGLLAMKLTRSPAQRMAEPLVEQAPS--INVLVASKSLPVGS 58

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG 119
            +  + + W+A+P++ V +G I + ++P A+ +L G +VR+P+  G+P+R EK+ D  N 
Sbjct: 59  RLGADSIHWLAWPKDGVAEGMITEENRPAAIDDLAGAVVRLPLFDGEPVRQEKIADPSNR 118

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAI 179
            +SSLLP GKRA   +I++++  GG I PND VDV+MVR           VLSN+RV+AI
Sbjct: 119 IMSSLLPAGKRAVATEITVATGAGGFILPNDRVDVIMVRKSDGDVYLTETVLSNVRVLAI 178

Query: 180 DHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSD 235
           D  ++  +   + ++G+TATLELTP Q+K +  AQ +A ++SL LRS+AD   + +E +D
Sbjct: 179 DQQVEEKDDGSKSVIGTTATLELTPDQSKVMTVAQQMAERISLALRSVADAQEADTEAAD 238

Query: 236 VWDVQEEGKEIQIIKAGVIVNKDG 259
                +    IQ+IK+G IV  DG
Sbjct: 239 YLLSGDGQPSIQVIKSGSIVKNDG 262


>gi|15963893|ref|NP_384246.1| putative pilus assembly signal peptide protein [Sinorhizobium
           meliloti 1021]
 gi|307315790|ref|ZP_07595304.1| Flp pilus assembly protein CpaB [Sinorhizobium meliloti BL225C]
 gi|307320425|ref|ZP_07599842.1| Flp pilus assembly protein CpaB [Sinorhizobium meliloti AK83]
 gi|15073068|emb|CAC41527.1| Putative pilus assembly signal peptide protein [Sinorhizobium
           meliloti 1021]
 gi|306893991|gb|EFN24760.1| Flp pilus assembly protein CpaB [Sinorhizobium meliloti AK83]
 gi|306898558|gb|EFN29231.1| Flp pilus assembly protein CpaB [Sinorhizobium meliloti BL225C]
          Length = 269

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 107/263 (40%), Positives = 161/263 (61%), Gaps = 5/263 (1%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+  R++ + V+   A +AG++AM+L      QT E + E  A  INVL++   L VG  
Sbjct: 1   MRPVRIIILAVAIGSAAMAGLLAMKLTRAPAPQTAEPVIEQ-APTINVLVAGKSLPVGSR 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +  + + W A+P++ V +G I + ++P A+++L G +VR+PI  G+P+R EK+ D  N  
Sbjct: 60  LGADSIHWKAWPKDGVAEGMITEENRPAAVEDLAGAVVRLPIFTGEPVRQEKIADASNRI 119

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
           +SSLLP GKRA   +I++++  GG I PND VDV+MVR           VLSN+RV+AID
Sbjct: 120 MSSLLPAGKRAVATEITVATGAGGFILPNDRVDVIMVRKSDGDLYLTETVLSNVRVLAID 179

Query: 181 HNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSDV 236
             I+  E   + +VG+TATLELTP Q+K +  AQ +A ++SL LRS+AD     +  +D 
Sbjct: 180 QQIEEKEDGSKAVVGTTATLELTPDQSKVMTVAQQMADRISLALRSVADAQEPDTTAADY 239

Query: 237 WDVQEEGKEIQIIKAGVIVNKDG 259
               +    IQ+IK+G IV  DG
Sbjct: 240 LLNGDGRPSIQVIKSGSIVKGDG 262


>gi|150398540|ref|YP_001329007.1| SAF domain-containing protein [Sinorhizobium medicae WSM419]
 gi|150030055|gb|ABR62172.1| SAF domain protein [Sinorhizobium medicae WSM419]
          Length = 269

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 104/263 (39%), Positives = 158/263 (60%), Gaps = 5/263 (1%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  R++ + V+   A +AG++AM+L      +  E + E  A  INVL++   L VG  
Sbjct: 1   MKPVRIIILAVAVGSAAMAGLLAMKLTRAPAARMAEPVIEQ-APTINVLVAGKSLPVGSR 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +  + + W A+P++ + +G I +  +P+A+ +L G +VR+PI  G+P+R EK+ D  N  
Sbjct: 60  LGADSIHWKAWPKDGIAEGMITEETRPSAVDDLAGAVVRLPIFTGEPVRQEKIADASNRI 119

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
           +SSLLP GKRA   +I++++  GG I PND VDV+MVR           VLSN+RV+AID
Sbjct: 120 MSSLLPAGKRAVATEITVATGAGGFILPNDRVDVIMVRKSDGDLYLTETVLSNVRVLAID 179

Query: 181 HNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSDV 236
             I+  E   + +VG+TATLELTP Q+K +   Q +A ++SL LRS+AD     +  +D 
Sbjct: 180 QQIEEKEDGTKAVVGTTATLELTPDQSKVMTVTQQMADRISLALRSVADAQEPDTTAADH 239

Query: 237 WDVQEEGKEIQIIKAGVIVNKDG 259
               +    IQ+IK+G IV  DG
Sbjct: 240 LLNGDGQPSIQVIKSGSIVKGDG 262


>gi|239833238|ref|ZP_04681567.1| Flp pilus assembly protein CpaB [Ochrobactrum intermedium LMG 3301]
 gi|239825505|gb|EEQ97073.1| Flp pilus assembly protein CpaB [Ochrobactrum intermedium LMG 3301]
          Length = 279

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 95/266 (35%), Positives = 142/266 (53%), Gaps = 12/266 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  RL+ + V+ + A  AG IAM L +P              K  +VL++  +L VG  
Sbjct: 9   MKSARLLILGVAVLAAGGAGYIAMNLATPPPAPVVAAPEAPQIKLEDVLVATENLGVGAE 68

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +T + + W  +P E + +G+I    +P+A+ +L G  VR+    G+PIR  KL+  G   
Sbjct: 69  LT-SQMRWQPWPAEAISEGYITRASEPDAINQLSGATVRLQFFTGEPIRKAKLIGPGQSF 127

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP------TVTVVLSNI 174
           +SS+LP G RA    I+  S+ GG I PND VDV+M R   +         T   VL N+
Sbjct: 128 MSSILPPGMRAVATQINAESSAGGFILPNDFVDVIMTRRKPDNGDKSLTPFTTETVLQNV 187

Query: 175 RVIAIDHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSS 230
           RV+AID  I  DE   +V+VG TATLE+TP QA+ +  AQ +A +L+L LRS  D+    
Sbjct: 188 RVLAIDQAIQEDEQGRKVMVGQTATLEVTPEQAEIITVAQQMADRLTLALRSTQDVEDRD 247

Query: 231 SEDSDVWDVQE-EGKEIQIIKAGVIV 255
            + +D           +++IK+G + 
Sbjct: 248 IKQADYLVSSPTRSGTVKVIKSGSVT 273


>gi|153008058|ref|YP_001369273.1| SAF domain-containing protein [Ochrobactrum anthropi ATCC 49188]
 gi|151559946|gb|ABS13444.1| SAF domain protein [Ochrobactrum anthropi ATCC 49188]
          Length = 271

 Score =  241 bits (615), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 97/266 (36%), Positives = 142/266 (53%), Gaps = 12/266 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  RL+ + V+ + A  AG IAM L +P              K  +VL++  +L VG  
Sbjct: 1   MKSARLLILGVAVLAAGGAGYIAMNLAAPPPAPVVVAPETPQMKLEDVLVATENLGVGAE 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +T + + W  +P E V DG+I    +P+A+ +L G  VR+    G+PIR  KL+  G   
Sbjct: 61  LT-SQMRWQPWPAEAVSDGYITRASEPDAINQLSGATVRLQFFTGEPIRKTKLIGPGQSF 119

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP------TVTVVLSNI 174
           +SS+LP G RA    I+  S+ GG I PND VDV+M R   +         T   VL N+
Sbjct: 120 MSSILPPGMRAVATQINAESSAGGFILPNDFVDVIMTRRKPDNGDKSLTPFTTETVLQNV 179

Query: 175 RVIAIDHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSS 230
           RV+AID  I  DE   +V+VG TATLE+TP QA+ +  AQ +A +L+L LRS  D+    
Sbjct: 180 RVLAIDQAIQEDEQGRKVMVGQTATLEVTPEQAEIITVAQQMADRLTLALRSTQDVEDKD 239

Query: 231 SEDSDVWDVQEEGK-EIQIIKAGVIV 255
            + +D           +++IK+G + 
Sbjct: 240 IKQADYLVSSPTRSGTVKVIKSGSVT 265


>gi|325291660|ref|YP_004277524.1| components of type IV pilus [Agrobacterium sp. H13-3]
 gi|325059513|gb|ADY63204.1| components of type IV pilus [Agrobacterium sp. H13-3]
          Length = 268

 Score =  237 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 111/268 (41%), Positives = 159/268 (59%), Gaps = 6/268 (2%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK +R++ + V+ V A +AGI+AM++     V  +          +NVL+S  +L VG  
Sbjct: 1   MKPSRIVILSVALVAAGLAGIVAMQISGAKQVIEKAETIIEKEPTVNVLVSSVNLPVGSR 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +  + + W  +P  NV D FI +   PNA+ EL G +VR+P+ +G+P+R EK+VD     
Sbjct: 61  LNDSSVHWTPWPTGNVIDSFITEAKNPNAITELSGAVVRLPLFQGEPVRPEKVVDSSTRI 120

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
           +SSLLP GKRA   +IS+S+  GG + PND VDV+MVR           VL+N+RV+AID
Sbjct: 121 MSSLLPAGKRAVATEISVSTGAGGFVLPNDRVDVIMVRKGDSGHFLTENVLNNVRVLAID 180

Query: 181 HNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSDV 236
             I   E     +VG+TATLELTP QAK +  AQ +A +L+L LRS+AD   + +  +  
Sbjct: 181 QQIKEGEDGTSAVVGATATLELTPEQAKIITVAQQMADRLTLALRSVADAQENDTLSAGY 240

Query: 237 WDVQEEG-KEIQIIKAGVIVNKDGEGIS 263
                 G  EIQ+IK+G IV K G+G S
Sbjct: 241 LLNGGSGQPEIQVIKSGSIV-KAGQGAS 267


>gi|15887574|ref|NP_353255.1| components of type IV pilus [Agrobacterium tumefaciens str. C58]
 gi|15155111|gb|AAK86040.1| components of type IV pilus [Agrobacterium tumefaciens str. C58]
          Length = 268

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 111/268 (41%), Positives = 160/268 (59%), Gaps = 6/268 (2%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK +R++ + V+ V A +AG++AM++     V  +          +NVLIS  +L VG  
Sbjct: 1   MKPSRIVILSVALVAAGLAGLVAMQISGAKQVIEKAETIIQKEPTVNVLISSVNLPVGSR 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +  + + W  +P+ NV D FI    +P+A+ EL G +VR+P+ +G+PIR EK+VD     
Sbjct: 61  LNDSSMRWTPWPQGNVVDSFITQAKRPDAITELAGTVVRLPLFEGEPIRPEKVVDSSTRI 120

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
           +SSLLP GKRA   +IS+S+  GG + PND VDV+MVR           VL+N+RV+AID
Sbjct: 121 MSSLLPAGKRAVATEISVSTGAGGFVLPNDRVDVIMVRKGENGNFLTENVLNNVRVLAID 180

Query: 181 HNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSDV 236
             I   E     +VG+TATLELTP QAK +  AQ +A +L+L LRS+AD   + +  +  
Sbjct: 181 QQIKEGEDGIAAVVGATATLELTPEQAKIITVAQQMADRLTLALRSVADAQENDTLSAGH 240

Query: 237 WDVQEEG-KEIQIIKAGVIVNKDGEGIS 263
                 G  EIQ+IK+G IV K G+G S
Sbjct: 241 LLSGSSGQPEIQVIKSGSIV-KSGQGAS 267


>gi|92116014|ref|YP_575743.1| Flp pilus assembly CpaB [Nitrobacter hamburgensis X14]
 gi|91798908|gb|ABE61283.1| Flp pilus assembly CpaB [Nitrobacter hamburgensis X14]
          Length = 260

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 90/262 (34%), Positives = 139/262 (53%), Gaps = 19/262 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   R+    V    A+ AG +A  L S    + +   T    + ++VL++K D+ +G  
Sbjct: 1   MNTARI----VVLTIAVGAGGLAAYLASGSDKKPQPAQTAQ-LQTVDVLVAKSDIPLGQA 55

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRGNG 119
           VT N + W A+P  +    FI    +P+A  +L G + R P + G+PIR  KLV  +G+G
Sbjct: 56  VTANDVAWQAWPANSASSSFIRRDQRPDATTQLAGSIARSPFIAGEPIRELKLVSAKGSG 115

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE------RKPTVTVVLSN 173
            ++++LP G RA + +IS  +  GG I PND VDV++ +                 +LSN
Sbjct: 116 FMAAILPTGMRAISTEISPETGAGGFILPNDRVDVILSQRDKNPDHPNANSVNSETILSN 175

Query: 174 IRVIAIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSS 231
           +RV+A+D  I+    ++V+VG TATLEL P QA+ L  ++ +  LSL LRS+AD N   S
Sbjct: 176 VRVLAVDQTIEEKNGQKVVVGKTATLELKPEQAEMLARSRQMGTLSLALRSLADANAPES 235

Query: 232 EDSDVWDVQEEGKEIQIIKAGV 253
              D     +    I I++ GV
Sbjct: 236 STDD-----QRRDSINIVRYGV 252


>gi|75674500|ref|YP_316921.1| Flp pilus assembly CpaB [Nitrobacter winogradskyi Nb-255]
 gi|74419370|gb|ABA03569.1| Flp pilus assembly CpaB [Nitrobacter winogradskyi Nb-255]
          Length = 275

 Score =  234 bits (598), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 93/262 (35%), Positives = 146/262 (55%), Gaps = 19/262 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   R+    V    A+ AG +A  L S    +T+ V TE   + ++VL++K D+ +G  
Sbjct: 16  MNTARI----VVLTIAVGAGGLAAYLASGSDKETQPVQTEQ-LRTVDVLVAKSDIPLGQA 70

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRGNG 119
           VT N + W  +P ++    FI    +P+A  +L G + R P + G+PIR  KLV  +G+G
Sbjct: 71  VTANDVAWQTWPADSASHSFIRRDQRPDATTQLAGSIARSPFIAGEPIRELKLVSAKGSG 130

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL------SERKPTVTVVLSN 173
            ++++LP G RA + +IS  +  GG I PND VDV++ +        S        VL N
Sbjct: 131 FMAAILPTGMRAISTEISPETGAGGFILPNDRVDVILSKREKNADHASGDSVNSETVLGN 190

Query: 174 IRVIAIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSS 231
           +RV+AID  I+    ++V+VG TATLEL P QA+ L  ++ +  LSL LRS+AD N   +
Sbjct: 191 VRVLAIDQTIEEKNGQKVVVGRTATLELKPEQAETLARSRQMGTLSLALRSLADAN---A 247

Query: 232 EDSDVWDVQEEGKEIQIIKAGV 253
            + D+ D + +   I +++ GV
Sbjct: 248 PEGDINDRRRD--SINVVRYGV 267


>gi|316933040|ref|YP_004108022.1| Flp pilus assembly protein CpaB [Rhodopseudomonas palustris DX-1]
 gi|315600754|gb|ADU43289.1| Flp pilus assembly protein CpaB [Rhodopseudomonas palustris DX-1]
          Length = 266

 Score =  234 bits (598), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 90/266 (33%), Positives = 139/266 (52%), Gaps = 19/266 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITE-NPAKFINVLISKGDLAVGM 59
           M   R+    V    A+ AG +A  L S    Q +         + + VL++K D+ +G 
Sbjct: 7   MNTARI----VVLTIAVGAGGVAAYLASTAGPQPQAPAEPVARMQTVEVLVAKNDIPLGQ 62

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRGN 118
            V P  L+W  +P       FI    QPNA  +L G + R P + G+PIR +KLV   G+
Sbjct: 63  AVAPGDLQWQTWPSATASSHFIRRNDQPNATTDLAGSIARSPFIAGEPIREQKLVKANGS 122

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL------SERKPTVTVVLS 172
           G ++++LP G RA + +IS  +  GG I PND VDV++ +        S  +    ++LS
Sbjct: 123 GFMAAILPSGMRAISTEISPETGAGGFILPNDRVDVILSKREKNSDRPSGEQIVSEIILS 182

Query: 173 NIRVIAIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           N+RV+A+D  I+    ++V+VG TATLEL P QA+ L  A+    L+L LRS+AD    S
Sbjct: 183 NVRVLAVDQTIEEKNGQKVVVGKTATLELKPEQAEYLARARQSGTLALALRSLADAGQPS 242

Query: 231 SEDSDVWDVQEEGKEIQIIKAGVIVN 256
           + ++D      +   + I++ GV   
Sbjct: 243 TTENDA-----KRDSVNIVRYGVTTQ 263


>gi|222084468|ref|YP_002542997.1| pilus assembly protein [Agrobacterium radiobacter K84]
 gi|221721916|gb|ACM25072.1| pilus assembly protein [Agrobacterium radiobacter K84]
          Length = 270

 Score =  234 bits (598), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 102/262 (38%), Positives = 158/262 (60%), Gaps = 5/262 (1%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  R+M + V+ V A +AG++AM L    ++  +          +NVL++  +L VG  
Sbjct: 1   MKPARIMILAVAVVTAGLAGLLAMHLAGSRNIVQQVETVVEKEATVNVLVADANLPVGSR 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +    + W+A+P+  V  G I    +P+A+++L+G +VR+PI +G+PIR EK+ D  +  
Sbjct: 61  LNEKSIHWMAWPQSGVVKGLITQAERPDALKDLNGAVVRLPIFEGEPIREEKVADASSRI 120

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
           LSSLLP GKRA   +IS+++  GG I PND VDV+MVR    +K     VLSN+R++A+D
Sbjct: 121 LSSLLPSGKRAVATEISVATGAGGFILPNDRVDVIMVRKGDTQKFVTETVLSNVRILAVD 180

Query: 181 HNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSDV 236
             I+  +   + +VG+TATLELTP Q K L  AQ +A +L+L LRS+AD     +  +D 
Sbjct: 181 QQIEEKQDGSKAVVGTTATLELTPDQTKVLAVAQQMADRLTLALRSVADAQQPDTTAADY 240

Query: 237 WDVQEE-GKEIQIIKAGVIVNK 257
               +  G  +Q+IK+G I+  
Sbjct: 241 LLSGDNGGAVVQVIKSGAIIAN 262


>gi|85713504|ref|ZP_01044494.1| Flp pilus assembly CpaB [Nitrobacter sp. Nb-311A]
 gi|85699408|gb|EAQ37275.1| Flp pilus assembly CpaB [Nitrobacter sp. Nb-311A]
          Length = 260

 Score =  230 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 89/262 (33%), Positives = 139/262 (53%), Gaps = 19/262 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   R+    V    A+ AG +A  L S    +  ++        ++VL++K D+ +G  
Sbjct: 1   MNTARI----VVLTIAVGAGGLAAYLASGSD-KKPQIAQTVQLPTVDVLVAKSDIQLGQT 55

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRGNG 119
           VT N + W  +P ++  + FI    +P+A  +L G + R P + G+PIR  KLV  +G+G
Sbjct: 56  VTANDVAWQTWPADSASNSFIRRDRRPDATTQLAGSIARSPFIAGEPIREPKLVSAKGSG 115

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS------LSERKPTVTVVLSN 173
            ++++LP G RA + +IS  +  GG I PND VDV++ R        S        +LSN
Sbjct: 116 FMAAILPTGMRAISTEISPETGAGGFILPNDRVDVILSRRDRNADHPSGDSVNSETILSN 175

Query: 174 IRVIAIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSS 231
           +RV+A+D  I+    ++V+VG TATLEL P QA+ L  ++ +  LSL LRS+AD N   S
Sbjct: 176 VRVLAVDQTIEEKNGQKVVVGRTATLELKPEQAETLARSRQMGTLSLALRSLADANAPES 235

Query: 232 EDSDVWDVQEEGKEIQIIKAGV 253
              D          I +++ GV
Sbjct: 236 NIDD-----RRRDSISVVRYGV 252


>gi|222147183|ref|YP_002548140.1| component of type IV pilus [Agrobacterium vitis S4]
 gi|221734173|gb|ACM35136.1| component of type IV pilus [Agrobacterium vitis S4]
          Length = 269

 Score =  229 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 110/267 (41%), Positives = 163/267 (61%), Gaps = 10/267 (3%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHV---QTEEVITENPAKFINVLISKGDLAV 57
           MK  R++ + V+   A +AG++AM L     V   Q+E V+T+ P     VLI+   L V
Sbjct: 1   MKPARILILFVAVAAAGLAGLLAMGLSGQKRVVVQQSEPVVTKEP--TTKVLIAAASLPV 58

Query: 58  GMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG 117
           G  +T   + W+ +P+ ++ DGF+ + ++P A+ +L G++VR+PI +G+PIR+EK+ D  
Sbjct: 59  GARLTDKAMRWMDWPKTDLVDGFVTEENRPQALSDLAGLVVRLPIFEGEPIRIEKIADAS 118

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVI 177
           +  LS+LLP GKRA + +IS+++  GG I PND VDV+MVR           VLSN+RV+
Sbjct: 119 SRTLSALLPAGKRAISTEISVATGAGGFILPNDRVDVIMVRKGDNDNHLTETVLSNVRVL 178

Query: 178 AIDHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSS-SE 232
           AID  I+      R ++G+TATLELTP Q K L  AQ +A +LSL LRS+AD      S 
Sbjct: 179 AIDQQIEEKNDGTRSVIGTTATLELTPEQTKVLTVAQQMAERLSLALRSVADAQEQDNSS 238

Query: 233 DSDVWDVQEEGKEIQIIKAGVIVNKDG 259
            S +      G ++Q+IK+G IV   G
Sbjct: 239 ASYLLSGDSGGPQVQVIKSGQIVKSAG 265


>gi|90425196|ref|YP_533566.1| Flp pilus assembly CpaB [Rhodopseudomonas palustris BisB18]
 gi|90107210|gb|ABD89247.1| Flp pilus assembly CpaB [Rhodopseudomonas palustris BisB18]
          Length = 265

 Score =  229 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 88/266 (33%), Positives = 138/266 (51%), Gaps = 16/266 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   R+    V    A+ AG +A  L S    Q            ++VL++K D+ +G  
Sbjct: 1   MNTARI----VVLTIAVGAGGVAAYLASGADQQPPPAAPVAQLPTVDVLVAKSDIPLGQA 56

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRGNG 119
           +TP  ++W  +P     + FI    +P+A  ++ G + R   + G+PIR  KLV   G+G
Sbjct: 57  LTPGDVQWQVWPAATASEMFIRRNVRPDATTQIVGSIARSAFIAGEPIRDLKLVKANGSG 116

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL-------SERKPTVTVVLS 172
            ++++LP G RA + +IS  +  GG I PND VDV++ +         S       ++LS
Sbjct: 117 FMAAILPSGMRAVSTEISPETGAGGFILPNDRVDVILSKREKNPDARASGDGVNSEIILS 176

Query: 173 NIRVIAIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           NIRV+AID  I+    ++V+VG TATLEL P Q++ L  A+    LSL LRS+AD N + 
Sbjct: 177 NIRVLAIDQTIEEKNGQKVVVGKTATLELKPEQSEGLARARQSGTLSLALRSLADANSAV 236

Query: 231 SEDSDVWDVQEEGKEIQIIKAGVIVN 256
           ++  D  D   +   I +++ GV   
Sbjct: 237 ADTPD--DRSAKRDSINVVRFGVSTP 260


>gi|299132282|ref|ZP_07025477.1| Flp pilus assembly protein CpaB [Afipia sp. 1NLS2]
 gi|298592419|gb|EFI52619.1| Flp pilus assembly protein CpaB [Afipia sp. 1NLS2]
          Length = 273

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 85/262 (32%), Positives = 143/262 (54%), Gaps = 19/262 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAK--FINVLISKGDLAVG 58
           M   R++ + +    A+ AG +A  L S    +    +     +    +VL++K D+ +G
Sbjct: 1   MNTARVVVLAI----AVSAGGVAAFLASGSDQKPAPRVAAPVPQLETTDVLVAKSDIPLG 56

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRG 117
             +T + ++W ++P       F+    + +A++++ G +VR P L G+PIR  KLV   G
Sbjct: 57  QTITADDMKWQSWPAATASSSFVKKSERADAIKDMTGSIVRSPFLAGEPIRETKLVKANG 116

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT-----VTVVLS 172
           +G ++++LP G RA + +IS  +  GG I PNDHVDV++ R    R+         ++LS
Sbjct: 117 SGFMAAILPSGMRAISTEISPETGAGGFILPNDHVDVLLSRRQKSREGNGESVSSEIILS 176

Query: 173 NIRVIAIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           ++RV+AID  ++    ++V+VG TATLEL P QA+ L  ++    LSL LRS+ D N   
Sbjct: 177 DVRVLAIDQTVEEKNGQKVVVGKTATLELKPAQAETLARSRQSGTLSLALRSLVDAN--- 233

Query: 231 SEDSDVWDVQEEGKEIQIIKAG 252
            +   V D  +E K I + + G
Sbjct: 234 -KPGKVEDASDE-KLITVYRGG 253


>gi|115526291|ref|YP_783202.1| Flp pilus assembly CpaB [Rhodopseudomonas palustris BisA53]
 gi|115520238|gb|ABJ08222.1| putative pilus assembly protein cpaB [Rhodopseudomonas palustris
           BisA53]
          Length = 268

 Score =  228 bits (582), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 83/255 (32%), Positives = 130/255 (50%), Gaps = 10/255 (3%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   R++ + ++      A  +A    SP        +     K ++VL++K +LA+G +
Sbjct: 1   MNKARIVVLAIAVSAGGAAAYLASGADSPKPPPQVAQVPTAQLKTVDVLVAKTNLALGQL 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR-GNG 119
           V P+ ++W  +P ++    FI     PN    + G + R P + G+PIR  KLV   G+G
Sbjct: 61  VGPSDVQWQNWPADSANSNFIRRDQHPNFDTTVAGSIARSPFVAGEPIREVKLVRPNGSG 120

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL-------SERKPTVTVVLS 172
            ++++LP G RA + +IS  +  GG I PND VDV++ +         S+   T   +L+
Sbjct: 121 FMAAILPSGMRAISTEISPETGAGGFILPNDRVDVILSKRERNSDSESSKENVTSVTILT 180

Query: 173 NIRVIAIDH--NIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           N+RV+AID        + V VG TATLEL P QA+ L  A+    LSL LRS+ D N  +
Sbjct: 181 NVRVLAIDQLPKEREGQNVAVGKTATLELLPEQAEQLARARQSGTLSLALRSMVDSNVVA 240

Query: 231 SEDSDVWDVQEEGKE 245
           +   D      +G E
Sbjct: 241 TVTDDKQVTIYKGSE 255


>gi|27375778|ref|NP_767307.1| CtpC protein [Bradyrhizobium japonicum USDA 110]
 gi|27348916|dbj|BAC45932.1| CtpC protein [Bradyrhizobium japonicum USDA 110]
          Length = 270

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 90/271 (33%), Positives = 137/271 (50%), Gaps = 20/271 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPA-KFINVLISKGDLAVGM 59
           M   R+    V  V AL AG +A  L S +  +    +        + VL++K D+ +G 
Sbjct: 1   MNTARI----VVLVIALGAGGVAAYLASGYDNKPAPALPVAEKLPTVEVLVAKNDIQLGQ 56

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRGN 118
            V P  L+W ++P       FI    +P A  ++ G + RVP+++G+PIR +KLV   G+
Sbjct: 57  AVKPEDLQWQSWPAATASGAFIRRDSRPEAQTQIAGSIARVPLMQGEPIREQKLVRAEGS 116

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT----------VT 168
           G ++++LP G RA + D++  ++ GG I PND VD+V+ R L                  
Sbjct: 117 GFMAAILPSGMRAVSTDVTAETSAGGFILPNDRVDIVLTRRLKNPDVNGPTAGNDLILSE 176

Query: 169 VVLSNIRVIAIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADL 226
           V+L+NIRV+AID        +  +VG T TLEL P Q   L AA+    L L LRSI D 
Sbjct: 177 VILTNIRVLAIDQAPKEKDGQNAVVGKTVTLELKPDQVATLTAARQGGTLQLALRSIVDA 236

Query: 227 NPSSSEDSDVWDVQEEGKEIQIIKAGVIVNK 257
           N +     D+   +  G  + +I+ GV V +
Sbjct: 237 NATELTAEDLAIKRSGG--VNVIRYGVQVRQ 265


>gi|148256956|ref|YP_001241541.1| putative pilus assembly protein CpaB [Bradyrhizobium sp. BTAi1]
 gi|146409129|gb|ABQ37635.1| Putative pilus assembly protein cpaB [Bradyrhizobium sp. BTAi1]
          Length = 266

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 88/257 (34%), Positives = 133/257 (51%), Gaps = 13/257 (5%)

Query: 10  VVSGVFALVAGIIAMRLVSPHHVQTEEVITE-NPAKFINVLISKGDLAVGMVVTPNILEW 68
           +V    AL AG +A  LVS    Q    +        + VL++K D+ +G  + P  L W
Sbjct: 6   IVVLTIALGAGGVAAYLVSTSESQQPVAVAPVAQLPTVEVLVAKNDIGLGQAIKPGDLVW 65

Query: 69  VAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR-GNGGLSSLLPK 127
             +P E   + FI    +P A  +L G + R P + G+PIR +KLV   G+G ++++LP 
Sbjct: 66  QTWP-EAASNIFIRRGDRPEAANQLVGTIARAPFVIGEPIREQKLVKSDGSGFMAAILPA 124

Query: 128 GKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP-------TVTVVLSNIRVIAID 180
           G RA + +IS  +  GG I PND VDV++ +              +  ++LSN+RV+AID
Sbjct: 125 GMRAISTEISPETGAGGFILPNDRVDVILSKRDKNPDKPGGPDYVSSEIILSNVRVLAID 184

Query: 181 HNIDSDE--RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWD 238
                 E    +VG T TLEL P QA+ L  A+    L+L LRSIAD+N +    ++   
Sbjct: 185 QAPKEKEGQNTVVGKTVTLELKPEQAETLARARQSGSLALALRSIADVNAADGNKNET-Q 243

Query: 239 VQEEGKEIQIIKAGVIV 255
           +   G  I+II+ G+  
Sbjct: 244 MARRGNAIEIIRYGITS 260


>gi|328545280|ref|YP_004305389.1| Flp pilus assembly CpaB [polymorphum gilvum SL003B-26A1]
 gi|326415022|gb|ADZ72085.1| Flp pilus assembly CpaB [Polymorphum gilvum SL003B-26A1]
          Length = 258

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 85/263 (32%), Positives = 135/263 (51%), Gaps = 12/263 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  RLM + V+    L+A  + M   +P   QT E + E   + + VL++  D+ +G  
Sbjct: 1   MKYARLMILGVAMGAGLLAARMVMTTKAPEVPQTVERV-EPEKQTVAVLVATRDIRLGDH 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +  + + W  +PE  V  G I   +QP+A + + G + + PI  G+PIR ++L+    G 
Sbjct: 60  LAASDISWAEWPENVVPQGAITRQNQPDAEELMVGQIAKAPIYSGEPIRGQRLIRTDRGF 119

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT--VTVVLSNIRVIA 178
           ++++LPKGKRA  + +   +  GG I P D VDV++ RS    +       +L N+RV+A
Sbjct: 120 MAAILPKGKRAIAVGVEAETTAGGFILPGDKVDVILTRSSDSNRSNARSETILENVRVLA 179

Query: 179 IDHNI--DSDERVL-VGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
           ID     + DE+ L    TATLEL+  QA+ +  AQ +  +SL LRS  D     S D  
Sbjct: 180 IDTTTAGEQDEKSLSPDRTATLELSLEQAEVVAQAQQIGTISLALRSAQD-----SGDEM 234

Query: 236 VWDVQEEGKEIQIIKAGVIVNKD 258
              +  +G  +  +K GV     
Sbjct: 235 DGPISRKG-GVSFVKYGVSSQGS 256


>gi|170740622|ref|YP_001769277.1| Flp pilus assembly protein CpaB [Methylobacterium sp. 4-46]
 gi|168194896|gb|ACA16843.1| Flp pilus assembly protein CpaB [Methylobacterium sp. 4-46]
          Length = 268

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 93/268 (34%), Positives = 135/268 (50%), Gaps = 16/268 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+ +R + I V+ V  L A  +      P       V        ++VL++  DL +G  
Sbjct: 1   MRSSRALLIGVAAVTGLAAFYMMSGSPPPPPPPPVVVQAPAVPDTVDVLVAAADLPMGQT 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRGNG 119
           + P  L W A+P+ +V DGFI     P A+++  G  VR P L G+PIR EKL+   G+G
Sbjct: 61  LKPADLRWQAWPKGSVNDGFIQRGQNPRALEDTVGSFVRGPFLGGEPIRREKLIRANGSG 120

Query: 120 GLSSLLPKGKRAATMDISI--SSAVGGMIKPNDHVDVVMVRSLSERK-------PTVTVV 170
            LS++LP G RA  + I    S+  GG I PND VDV+      E              +
Sbjct: 121 FLSAILPSGMRAVAISIDARGSNTAGGFILPNDRVDVLRTYRDDEASRATTSDVQVSETI 180

Query: 171 LSNIRVIAIDHNIDS--DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNP 228
           L N+RV+A+   +     ERV+ G TATLELTP Q + +  AQ V +LSL LRSIAD   
Sbjct: 181 LQNVRVLAVGQTVQERNGERVVTGDTATLELTPAQTEQITLAQKVGQLSLALRSIADAGI 240

Query: 229 SSSEDSDVWDVQEEGKEIQIIKAGVIVN 256
           S  E+ +     ++   + +++ GV   
Sbjct: 241 SQPENPE----PQKESALTVVRYGVSRQ 264


>gi|209551758|ref|YP_002283675.1| Flp pilus assembly protein CpaB [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537514|gb|ACI57449.1| Flp pilus assembly protein CpaB [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 271

 Score =  222 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 109/264 (41%), Positives = 158/264 (59%), Gaps = 6/264 (2%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  RL+ + V+ V A +AG +AM++     V T+          +N+L+S  +LAVG  
Sbjct: 1   MKPARLIILAVAVVAAGLAGFLAMQMAGNGGVVTQVQSVIEKEPTVNILVSSANLAVGER 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +    + W+ +P+  V  G I +  +P+A+++L G +VR+PI +G+PIR EK+ D  +  
Sbjct: 61  LDDKSVHWMPWPQGGVVPGLITEADKPDAIKDLQGAVVRLPIFEGEPIRPEKVADSNSRI 120

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE-RKPTVTVVLSNIRVIAI 179
           LSSLLP GKRA   +IS+++  GG I PND VDV+MVR  +E  K     VLSN+RV+AI
Sbjct: 121 LSSLLPAGKRAVATEISVATGAGGFILPNDRVDVIMVRKGTEANKLITETVLSNVRVLAI 180

Query: 180 DHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSD 235
           D  I   +   + +VG+TATLELTP Q K L  AQ +A +LSL LRS+AD     +  +D
Sbjct: 181 DQQIQEKDDGSKAVVGTTATLELTPDQTKVLAVAQQMADRLSLALRSVADAQEQDTSAAD 240

Query: 236 VWDVQEEGKE-IQIIKAGVIVNKD 258
                + G   IQ+IK+G IV   
Sbjct: 241 YLLSGDNGSAIIQVIKSGAIVTDA 264


>gi|86748908|ref|YP_485404.1| Flp pilus assembly CpaB [Rhodopseudomonas palustris HaA2]
 gi|86571936|gb|ABD06493.1| Flp pilus assembly CpaB [Rhodopseudomonas palustris HaA2]
          Length = 265

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 83/266 (31%), Positives = 137/266 (51%), Gaps = 16/266 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   R++ +V++     VA  +A  +           + +     + VL++K D+ +G  
Sbjct: 1   MNTARIVVLVIAVGAGAVAAYLASGIGGQETAGPTAPVAQ--LATVEVLVAKSDIPLGQP 58

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD-RGNG 119
           V P+ ++W  +P       FI    +P+A  +L G + R P + G+PIR +KLV   G+G
Sbjct: 59  VGPSDVQWQTWPAATASSNFILRSERPDASVQLAGSIARSPFIAGEPIREQKLVKSNGSG 118

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT-------VTVVLS 172
            ++++LP G RA + +IS  +  GG I PND VDV++ +                 ++LS
Sbjct: 119 FMAAILPTGMRAISTEISPETGAGGFILPNDRVDVILSKRDQNPDRVKGGDVVNSEIILS 178

Query: 173 NIRVIAIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           NIR++AID  ++    ++V+VG TATLEL P QA+ L  A+    LSL LRS+AD N   
Sbjct: 179 NIRILAIDQTVEEKNGQKVVVGKTATLELKPDQAEFLARARQSGTLSLALRSLADAN--- 235

Query: 231 SEDSDVWDVQEEGKEIQIIKAGVIVN 256
              +   ++  +   I +I+ GV   
Sbjct: 236 -APARTEEIGGKRDSINVIRFGVSTQ 260


>gi|146342077|ref|YP_001207125.1| putative pilus assembly protein CpaB [Bradyrhizobium sp. ORS278]
 gi|146194883|emb|CAL78908.1| Putative pilus assembly protein cpaB [Bradyrhizobium sp. ORS278]
          Length = 269

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 90/259 (34%), Positives = 133/259 (51%), Gaps = 14/259 (5%)

Query: 10  VVSGVFALVAGIIAMRLVSPHHVQTEEVITE-NPAKFINVLISKGDLAVGMVVTPNILEW 68
           +V    AL AG +A  LVS    Q    +        + VL++K D+ +G  + P  L W
Sbjct: 6   IVVLTIALGAGGVAAYLVSSSESQQPAPVAPVAQLPTVEVLVAKADIGLGQAIKPGDLIW 65

Query: 69  VAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR-GNGGLSSLLPK 127
             +PE    + FI    +P A  +L G + R P + G+PIR +KLV   G+G ++++LP 
Sbjct: 66  QTWPE-AASNIFIRRGDRPEAATQLVGSIARAPFVIGEPIREQKLVKSDGSGFMAAILPA 124

Query: 128 GKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP-------TVTVVLSNIRVIAID 180
           G RA + +IS  +  GG I PND VDV++ R                 ++LSN+RV+AID
Sbjct: 125 GMRAISTEISPETGAGGFILPNDRVDVILSRREKNPDKPAAADSIVSEIILSNVRVLAID 184

Query: 181 HNIDSDE--RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSS--EDSDV 236
                 E    +VG T TLEL P QA+ L  A+    L+L LRSIAD+N   +   +++ 
Sbjct: 185 QAPKEKEGQNTVVGKTVTLELKPEQAETLSRARQAGTLALALRSIADINAPDTGKTETEQ 244

Query: 237 WDVQEEGKEIQIIKAGVIV 255
             +   G  I+II+ GV  
Sbjct: 245 QQMARRGNAIEIIRYGVTS 263


>gi|110636320|ref|YP_676528.1| pilus assembly protein cpaB [Mesorhizobium sp. BNC1]
 gi|110287304|gb|ABG65363.1| pilus assembly protein cpaB [Chelativorans sp. BNC1]
          Length = 270

 Score =  221 bits (564), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 96/265 (36%), Positives = 145/265 (54%), Gaps = 11/265 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPA-KFINVLISKGDLAVGM 59
           M  +R++ + V+   A+ AG +A  L SP  V       E P     +VL+   D+ VG 
Sbjct: 1   MNKSRIVILGVAVAAAIGAGYLAKNLASPQKVAAVAPTPEKPPVSLTDVLVLTQDVPVGE 60

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG 119
            +    + W A+P E+V D FI    +P+A++ +   + R+P+  G+P+R  KLV  G+ 
Sbjct: 61  PINGAAM-WQAWPAESVMDAFITREREPDALETIRNAVARLPLFAGEPVRRSKLVGEGDS 119

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP----TVTVVLSNIR 175
            L+++LP GKRA    I+  ++ GG I PND VDV+M R   E           VL NIR
Sbjct: 120 FLAAILPPGKRAVATRIAADTSAGGFILPNDRVDVIMTRRADEGSSPNGFITETVLENIR 179

Query: 176 VIAIDHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSS 231
           V+AID  I  DE   RV +G TATLELTP +A+ +  AQ +A +L+L LRS+AD N  ++
Sbjct: 180 VLAIDQTIHEDEEGRRVKLGETATLELTPEEAEVITVAQQLADRLTLSLRSVADSNEEAT 239

Query: 232 EDSD-VWDVQEEGKEIQIIKAGVIV 255
           +    +      G  +++IK+G   
Sbjct: 240 DRGLHLVTGTGRGDSVRLIKSGETS 264


>gi|304392385|ref|ZP_07374326.1| Flp pilus assembly protein CpaB [Ahrensia sp. R2A130]
 gi|303295489|gb|EFL89848.1| Flp pilus assembly protein CpaB [Ahrensia sp. R2A130]
          Length = 286

 Score =  220 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 88/264 (33%), Positives = 136/264 (51%), Gaps = 12/264 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHH---VQTEEVITENPAKFINVLISKGDLAV 57
           MK  +L+ I V+ V +L AG + M +  P     VQT+            VL++  D+  
Sbjct: 14  MKPVQLVLIAVALVASLGAGYLVMNMSEPPAQVVVQTDNGPAIPTIPTRLVLVAVADVPQ 73

Query: 58  GMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG 117
           G  ++ N + +  +PE  V   F+     P A+++  G + R     G+PIR  K+V   
Sbjct: 74  GTTLSENNMRFEEWPETGVRPSFVTQKDAPEAIKDFSGAIARSSFFAGEPIRDAKIVRSD 133

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT--VTVVLSNIR 175
           +G LS++LP GKRA  ++I+ SS+ GG I PNDHVDV+M R     +       +L NIR
Sbjct: 134 SGYLSAILPAGKRAVAIEITASSSAGGFILPNDHVDVIMARQQDGEQNVIITDTILQNIR 193

Query: 176 VIAIDHNIDSDE--RVLVGSTATLELTPMQAKALVAAQSVAK--LSLVLRSIADLNPSSS 231
           V+A+D  I+ +E  +  VG T TLELT  Q + + AAQ + +  L+L LRS+ D     +
Sbjct: 194 VLALDQLIEEEEGKKSTVGETVTLELTAEQVEIVAAAQQINRRGLTLALRSVEDAEIEGT 253

Query: 232 EDSDVWDVQEEGKE---IQIIKAG 252
                     + K    ++II+ G
Sbjct: 254 SAGRKLLSSGDRKSRGTVRIIRYG 277


>gi|91977984|ref|YP_570643.1| Flp pilus assembly CpaB [Rhodopseudomonas palustris BisB5]
 gi|91684440|gb|ABE40742.1| Flp pilus assembly CpaB [Rhodopseudomonas palustris BisB5]
          Length = 266

 Score =  220 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 79/267 (29%), Positives = 131/267 (49%), Gaps = 17/267 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   R++ + ++     VA  +A      +               + VL++K D+ +G  
Sbjct: 1   MNTARIVVLTIAIGAGAVAAYLASG--GGNQEAAGPAAPVAELPTVEVLVAKSDIPLGQP 58

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRGNG 119
           V P  ++W  +P       FI    +P A  +L G + R   + G+PIR +KLV   G+G
Sbjct: 59  VGPGDMQWQTWPAATASANFIRRNERPEATTQLAGSIARSQFIAGEPIREQKLVKANGSG 118

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP--------TVTVVL 171
            ++++LP G RA + +IS  +  GG I PND VDV++ +                   +L
Sbjct: 119 FMAAILPTGMRAVSTEISPETGAGGFILPNDRVDVILSKRDKNPDRAGSGGDVVNSETIL 178

Query: 172 SNIRVIAIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
           SN+RV+AID  I+    ++V+VG TATLEL P QA+ L  A+    LSL LRS+ D N  
Sbjct: 179 SNVRVLAIDQAIEEKNGQKVVVGKTATLELKPEQAEFLARARQSGTLSLALRSLVDANAP 238

Query: 230 SSEDSDVWDVQEEGKEIQIIKAGVIVN 256
           ++ +    ++  +   + +++ GV   
Sbjct: 239 TATE----EIGGKRDSVNVVRYGVSTP 261


>gi|146338124|ref|YP_001203172.1| putative pilus assembly protein CpaB [Bradyrhizobium sp. ORS278]
 gi|146190930|emb|CAL74935.1| Putative pilus assembly protein, cpaB [Bradyrhizobium sp. ORS278]
          Length = 248

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 79/243 (32%), Positives = 127/243 (52%), Gaps = 14/243 (5%)

Query: 22  IAMRLVSPHHVQTEEVITENP-AKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGF 80
           +A  L S    +  +V    P    ++VL++K D+ +G  + P +L+W ++P       F
Sbjct: 1   MAAYLASGSDDRQAQVAAPAPQVPTVDVLVAKADIGLGQSIKPELLQWQSWPASTASSSF 60

Query: 81  IDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR-GNGGLSSLLPKGKRAATMDISIS 139
           I    +P    E+ G + R P + G+PIR +KLV   G+G ++++LP G RA + +IS  
Sbjct: 61  IRRNERPEGQNEVTGTIARAPFIAGEPIREQKLVKSDGSGFMAAILPAGMRAVSTEISPE 120

Query: 140 SAVGGMIKPNDHVDVVMVRSLSERKP-------TVTVVLSNIRVIAIDHNIDSD--ERVL 190
           +  GG I PND VDV++ +              +  ++L+NIRV+AID        +  +
Sbjct: 121 TGAGGFILPNDRVDVILSKRERNPDQPNAGDVVSSEIILANIRVLAIDQAPKEKDGQTTV 180

Query: 191 VGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIK 250
           VG T TLEL P QA+ L  A+    LSL LRSIAD+N     +    D +  G  + +++
Sbjct: 181 VGKTVTLELKPEQAETLARARQTGTLSLALRSIADVN---MAEQRSDDNRRRGDSVAVVR 237

Query: 251 AGV 253
            G+
Sbjct: 238 FGI 240


>gi|220922778|ref|YP_002498080.1| Flp pilus assembly protein CpaB [Methylobacterium nodulans ORS
           2060]
 gi|219947385|gb|ACL57777.1| Flp pilus assembly protein CpaB [Methylobacterium nodulans ORS
           2060]
          Length = 267

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 91/268 (33%), Positives = 136/268 (50%), Gaps = 17/268 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK +R + I ++ V  L A    M    P             A  ++VL++  DL +G +
Sbjct: 1   MKSSRALLIGIAAVTGLAA-FYMMSGSPPPPPPVVAPPPPMVADTVDVLVAAADLPMGQI 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRGNG 119
           + P  L W A+P+ ++ DGF+      NA+++  G  VR P L G+PIR EKL+   G+G
Sbjct: 60  LKPGDLRWQAWPKTSLNDGFLQREQNANALEDTLGSFVRSPFLGGEPIRREKLIKANGSG 119

Query: 120 GLSSLLPKGKRAATMDISI--SSAVGGMIKPNDHVDVVMV-------RSLSERKPTVTVV 170
            LS++LP G RA  + I    S+  GG I PND VDV+         R+          +
Sbjct: 120 FLSAILPSGMRAVAISIDARGSNTAGGFILPNDRVDVLRTHRDEEAARATKSDVQVTETI 179

Query: 171 LSNIRVIAIDHNIDS--DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNP 228
           L N+RV+A+   +     ERV+ G TATLELTP QA+ +  AQ V +LSL LRS++D   
Sbjct: 180 LKNVRVLAVGQTVQERNGERVVTGDTATLELTPAQAEQITLAQKVGQLSLALRSLSDAGQ 239

Query: 229 SSSEDSDVWDVQEEGKEIQIIKAGVIVN 256
              E  +     E+   + +++ GV   
Sbjct: 240 VQPESPE----TEKEPALTVVRYGVSQQ 263


>gi|148258234|ref|YP_001242819.1| putative pilus assembly protein CpaB [Bradyrhizobium sp. BTAi1]
 gi|146410407|gb|ABQ38913.1| Putative pilus assembly protein, cpaB [Bradyrhizobium sp. BTAi1]
          Length = 249

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 79/243 (32%), Positives = 128/243 (52%), Gaps = 13/243 (5%)

Query: 22  IAMRLVSPHHVQTEEVITENPA-KFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGF 80
           +A  L S    +   V    P  + + VL++K D+ +G  + P  L+W ++P       F
Sbjct: 1   MAAYLASGSDDRPAPVAAVAPTVETVEVLVAKSDINLGQSLKPEHLQWQSWPAATTSSSF 60

Query: 81  IDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR-GNGGLSSLLPKGKRAATMDISIS 139
           I    +     E+ G++ R P + G+PIR +KLV   G+G ++++LP G RA + +IS  
Sbjct: 61  IQRKDRSKGDAEVTGMIARAPFIAGEPIREQKLVKADGSGFMAAILPAGMRAVSTEISPE 120

Query: 140 SAVGGMIKPNDHVDVVMVRSLSERKP-------TVTVVLSNIRVIAIDHNIDSD--ERVL 190
           +  GG I PND VDV++ +     +        +  ++LSNIRV+AID        +  +
Sbjct: 121 TGAGGFILPNDRVDVLLSKRERNPEQPNAGDVISSEIILSNIRVLAIDQAPKEKDGQTTV 180

Query: 191 VGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIK 250
           VG T TLEL P QA+ L  A+    LSL LRSIAD+N + +   +  + +  G  + +I+
Sbjct: 181 VGKTVTLELKPEQAETLARARQSGTLSLALRSIADINVAENRSDE--NSRRRGDSVAVIR 238

Query: 251 AGV 253
            G+
Sbjct: 239 FGI 241


>gi|188581659|ref|YP_001925104.1| Flp pilus assembly protein CpaB [Methylobacterium populi BJ001]
 gi|179345157|gb|ACB80569.1| Flp pilus assembly protein CpaB [Methylobacterium populi BJ001]
          Length = 260

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 78/261 (29%), Positives = 133/261 (50%), Gaps = 7/261 (2%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  RL  + ++ V    A ++     +P      +     P     VL++  +L +G  
Sbjct: 1   MKPARLAVLGIALVAGCGAALLMGGEKAPEPAPVVKAEPPPPIPMSEVLVAAAELPMGQT 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           + P  L W+ +PE+ +  G ID    P  +++  G ++R      +PIR E+L+  G+G 
Sbjct: 61  LKPEDLRWIPWPEQAIAPGLIDRRAAPKGLEDAVGAIIRTGFSANEPIRPERLIKAGSGF 120

Query: 121 LSSLLPKGKRAATMDISI--SSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIA 178
           +S++LP G RA  +      SS+ GG I PNDHVD++   +    +     +L+++RV+A
Sbjct: 121 MSAILPPGMRAVAITTDTRGSSSAGGFILPNDHVDIIKTSNEGSDQ-FAETLLTDVRVLA 179

Query: 179 IDHNIDSDE--RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDV 236
           +   +       V+   TAT+ LTP QA+ +  AQ V +LSLVLRSI D    ++  S+ 
Sbjct: 180 VGQIVQDKNGANVVTAETATVALTPAQAETVTLAQKVGQLSLVLRSIQDSA-RTAALSEE 238

Query: 237 WDVQEEGKEIQIIKAGVIVNK 257
            D+  EG  + +++ GV   +
Sbjct: 239 ADLPPEGP-MTVVRFGVAKQQ 258


>gi|163757626|ref|ZP_02164715.1| pilus assembly protein [Hoeflea phototrophica DFL-43]
 gi|162285128|gb|EDQ35410.1| pilus assembly protein [Hoeflea phototrophica DFL-43]
          Length = 269

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 108/266 (40%), Positives = 165/266 (62%), Gaps = 12/266 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSP----HHVQTEEVITENPAKFINVLISKGDLA 56
           MK  R++ + V+ + A +AG +AM L +P    + +    VI + P   ++VL+    L 
Sbjct: 1   MKPARVVIMAVAVLAAGLAGYLAMNLTAPTVQVNEISATPVIEKMP--TLDVLVVSASLP 58

Query: 57  VGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR 116
           VG  +    +EW  +PE+ V +G I    +P+A+ EL G +VR+P+  G+P+R EK+VD 
Sbjct: 59  VGARLNEETMEWKGWPEDAVTEGLIRRESRPDAITELTGSIVRLPLFTGEPLRPEKIVDS 118

Query: 117 GNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT-VTVVLSNIR 175
            +  +SSLLP GKRA   +IS++++ GG I PND VDV+MVR  +E++     V+LSNIR
Sbjct: 119 SSRIMSSLLPAGKRAIATEISVATSAGGFILPNDRVDVIMVRRKTEQEGFLTEVILSNIR 178

Query: 176 VIAIDHNIDSD---ERVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSS 231
           V+AID  I+ D    R  VG+TATLELTP Q+K +  AQ +A +L+L LRS+AD+    +
Sbjct: 179 VLAIDQRIEEDAQGNRTAVGTTATLELTPDQSKIITVAQQMADRLTLALRSVADVQEPDT 238

Query: 232 EDSDVWDVQEEG-KEIQIIKAGVIVN 256
           + +      E+G   IQ+I++G I N
Sbjct: 239 DGAKHLLSGEDGTSAIQLIRSGAITN 264


>gi|209886527|ref|YP_002290384.1| Flp pilus assembly protein CpaB [Oligotropha carboxidovorans OM5]
 gi|209874723|gb|ACI94519.1| Flp pilus assembly protein CpaB [Oligotropha carboxidovorans OM5]
          Length = 272

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 74/219 (33%), Positives = 116/219 (52%), Gaps = 10/219 (4%)

Query: 26  LVSPHHVQTEEVITENPA-KFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDV 84
           L S    +  EV    P  +  +VL++K D+ +G  +    + W  +P       FI   
Sbjct: 22  LASGSDQKPAEVAAPAPKLETTDVLVAKADIPLGQTIKAEDMTWQTWPAATASSSFIRKS 81

Query: 85  HQPNAMQELDGVLVRVPILKGDPIRLEKLVD-RGNGGLSSLLPKGKRAATMDISISSAVG 143
            + +A+ +L G + R P L G+PIR  KLV   G+G ++++LP G RA + +IS  +  G
Sbjct: 82  ERASAVADLTGSIARSPFLAGEPIRETKLVKSNGSGFMAAILPSGMRAVSTEISPETGAG 141

Query: 144 GMIKPNDHVDVVMVRSLSERKPT------VTVVLSNIRVIAIDHNIDSD--ERVLVGSTA 195
           G I PND VDV++ R                ++LS++RV+AID  I+    ++V+VG TA
Sbjct: 142 GFILPNDRVDVMLSRRQRNPDSNGGEMVSSEIILSDVRVLAIDQTIEEKNGQKVVVGKTA 201

Query: 196 TLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           TLEL P QA+ L  ++    L+L LRS+ D N  +  + 
Sbjct: 202 TLELKPAQAEMLTRSRQSGTLTLALRSLVDANKQNEVEE 240


>gi|254473714|ref|ZP_05087109.1| Flp pilus assembly protein CpaB [Pseudovibrio sp. JE062]
 gi|211957100|gb|EEA92305.1| Flp pilus assembly protein CpaB [Pseudovibrio sp. JE062]
          Length = 259

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 82/262 (31%), Positives = 129/262 (49%), Gaps = 12/262 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK +RL+ ++++     +A  + +   S    QT  V+ E     + +L++  DL VG  
Sbjct: 1   MKASRLLVLIIALSAGGLAAWLNLSSGSREPAQTI-VVQEQEIPSLEILVAAQDLKVGTA 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +T   L W  +PEE+V DG I     P A +E  G +++  +  G+PIR E+L++   G 
Sbjct: 60  LTEGDLSWAKWPEESVSDGVILRSSSPQADEEFLGQIIKAAMFSGEPIRAERLINTDKGF 119

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP--TVTVVLSNIRVIA 178
           L+++LPKGKRA  + +   S  GG I P D VDV++     +R        +L NI+V+A
Sbjct: 120 LAAILPKGKRAVAVPVDAVSTAGGFILPGDKVDVLISMQAKKRDEGFISETLLENIKVLA 179

Query: 179 IDHNIDSDERVL---VGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
           ID    S+          TATLEL P +A+ +  A  +  LSL LRS AD      +   
Sbjct: 180 IDTTTASENSEKAMSPDQTATLELFPHEAETIARATQMGTLSLSLRSAADSKDGVKQPPR 239

Query: 236 VWDVQEEGKEIQIIKAGVIVNK 257
           V         ++ +K G+    
Sbjct: 240 VKG------GVKFVKYGIASQS 255


>gi|27376551|ref|NP_768080.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
 gi|27349692|dbj|BAC46705.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
          Length = 269

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 82/264 (31%), Positives = 130/264 (49%), Gaps = 17/264 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   R++ + V+     VA  +A       +              ++VL++K D+ +G  
Sbjct: 4   MNRARIVVLTVAICAGGVAAYLAS---GSDNSAPPPAAPVAQLPTVDVLVAKNDIGLGQT 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRGNG 119
           V P  ++W  +P       FI    +P  + ++ G + R P ++G+PIR +KLV   G+G
Sbjct: 61  VKPEDVQWQTWPAATASATFIRRNERPEGVTQVTGSIARAPFIQGEPIRDQKLVKAEGSG 120

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP--------TVTVVL 171
            ++++LP G RA + +IS  +  GG I PND VDV++ R L    P        T  ++L
Sbjct: 121 FMAAILPTGMRAISTEISPETGAGGFILPNDRVDVLLTRRLKNPDPSNGAPDIVTSEIIL 180

Query: 172 SNIRVIAIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
           +NIRV+AID        +  +VG T TLEL P Q   L AA+    LSL LRSI D+   
Sbjct: 181 ANIRVLAIDQAPKEKDGQNTVVGKTVTLELNPTQTATLSAARQSGTLSLALRSIVDV--- 237

Query: 230 SSEDSDVWDVQEEGKEIQIIKAGV 253
              +  + D  +    + II+ G+
Sbjct: 238 KMSEITLDDSAQRRDGVSIIRYGI 261


>gi|300704929|ref|YP_003746532.1| pilus assembly (cpab), transmembrane protein [Ralstonia
           solanacearum CFBP2957]
 gi|299072593|emb|CBJ43943.1| Putative pilus assembly (cpaB), transmembrane protein [Ralstonia
           solanacearum CFBP2957]
          Length = 284

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 68/248 (27%), Positives = 127/248 (51%), Gaps = 30/248 (12%)

Query: 1   MKLTRLM-GIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK  R++  ++++ +  L A + A R +S           ++ +    V+++  D+ +G 
Sbjct: 1   MKNLRILSMLLIATIAGLAAVVFASRWLSQ----------QSNSGITKVVVAAADIDLGQ 50

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
            ++P+ ++ V +P  ++  G I D H       LDG +VR  +++G+P+   KL  +G  
Sbjct: 51  RLSPDFIKTVDWPSASLPPGAISDTH------ALDGRVVRTSLIRGEPVLESKLTPQGTA 104

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-----------VRSLSERKPTV 167
           GGLS+++  GKRA T+ ++    V G   P  +VD+++                  +   
Sbjct: 105 GGLSAVIADGKRAITVRVNDVVGVAGFALPGSYVDIIVNTIQDSKDAKATGGDRADQSIS 164

Query: 168 TVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADL 226
            +VL  I V+A+   ++ D+ +  V +  TLE+TP QA+ L  A+SV  LSLVLR+  D 
Sbjct: 165 KIVLEKILVLAVAQEVNRDDTKPKVVNAVTLEVTPDQAEKLDLARSVGTLSLVLRNQVDP 224

Query: 227 NPSSSEDS 234
           +P+ +  +
Sbjct: 225 HPADTAGA 232


>gi|83749639|ref|ZP_00946622.1| TRANSMEMBRANE PILUS ASSEMBLY PROTEIN; cpaB1 [Ralstonia solanacearum
           UW551]
 gi|207728107|ref|YP_002256501.1| pilus assembly protein cpab [Ralstonia solanacearum MolK2]
 gi|207744157|ref|YP_002260549.1| pilus assembly protein cpab [Ralstonia solanacearum IPO1609]
 gi|83723700|gb|EAP70895.1| TRANSMEMBRANE PILUS ASSEMBLY PROTEIN; cpaB1 [Ralstonia solanacearum
           UW551]
 gi|206591352|emb|CAQ56964.1| pilus assembly protein cpab [Ralstonia solanacearum MolK2]
 gi|206595561|emb|CAQ62488.1| pilus assembly protein cpab [Ralstonia solanacearum IPO1609]
          Length = 284

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 68/248 (27%), Positives = 127/248 (51%), Gaps = 30/248 (12%)

Query: 1   MKLTRLM-GIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK  R++  ++++ +  L A + A R +S           ++ +    V+++  D+ +G 
Sbjct: 1   MKNLRILSMLLIATIAGLAAVVFASRWLSQ----------QSSSGITKVVVAAADIDLGQ 50

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
            ++P+ ++ V +P  ++  G I D H       LDG +VR  +++G+P+   KL  +G  
Sbjct: 51  RLSPDFIKTVDWPSASLPPGAISDTH------ALDGRVVRTSLIRGEPVLESKLTPQGTA 104

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM-----------VRSLSERKPTV 167
           GGLS+++  GKRA T+ ++    V G   P  +VD+++                  +   
Sbjct: 105 GGLSAVIADGKRAITVRVNDVVGVAGFALPGSYVDIIVNTIQDSKDAKATGGDRADQSIS 164

Query: 168 TVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADL 226
            +VL  I V+A+   ++ D+ +  V +  TLE+TP QA+ L  A+SV  LSLVLR+  D 
Sbjct: 165 KIVLEKILVLAVAQEVNRDDTKPKVVNAVTLEVTPDQAEKLDLARSVGTLSLVLRNQVDP 224

Query: 227 NPSSSEDS 234
           +P+ +  +
Sbjct: 225 HPADTAGA 232


>gi|86355863|ref|YP_467755.1| pilus assembly protein [Rhizobium etli CFN 42]
 gi|86279965|gb|ABC89028.1| pilus assembly protein [Rhizobium etli CFN 42]
          Length = 271

 Score =  214 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 113/265 (42%), Positives = 163/265 (61%), Gaps = 6/265 (2%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  RL+ + V+ V A +AG++AMR+     V T+          +N+L+S  +L VG  
Sbjct: 1   MKPARLIILAVAVVAAGLAGLLAMRMAGSGGVVTQVQSVIKKEPTVNILVSNKNLPVGAR 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +  + + W+A+P+E V  GFI +  +P+A+++L G +VR+PI +G+PIR EK+ D  +  
Sbjct: 61  LGDDSVHWMAWPKEGVVQGFITEADRPDAIKDLQGAVVRLPIFEGEPIRPEKVADSSSRI 120

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE-RKPTVTVVLSNIRVIAI 179
           LSSLLP GKRA   +IS+++  GG I PND VDV+MVR  +E  K     VLSN+RV+AI
Sbjct: 121 LSSLLPAGKRAVATEISVATGAGGFILPNDRVDVIMVRKGTEANKLITETVLSNVRVLAI 180

Query: 180 DHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSD 235
           D  I   +   + +VG+TATLELTP Q K L  AQ +A +LSL LRS+AD     +  +D
Sbjct: 181 DQQIQEKDDGSKTVVGTTATLELTPDQTKVLAVAQQMADRLSLALRSVADAQEQDTSAAD 240

Query: 236 VWDVQEEGKE-IQIIKAGVIVNKDG 259
                + G   IQ+IK+G IV   G
Sbjct: 241 YLLSGDNGSAIIQVIKSGAIVTDAG 265


>gi|118589702|ref|ZP_01547107.1| Flp pilus assembly CpaB [Stappia aggregata IAM 12614]
 gi|118437788|gb|EAV44424.1| Flp pilus assembly CpaB [Stappia aggregata IAM 12614]
          Length = 256

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 74/265 (27%), Positives = 131/265 (49%), Gaps = 14/265 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAK--FINVLISKGDLAVG 58
           MK+ R+   V++   A       M ++S +     +++    A+     VL+++ D+ +G
Sbjct: 1   MKIARI--FVLAIAVAAGIIAFRMVMMSGNKPAEPQIVQAPVAEQTKTQVLVAQRDIPLG 58

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN 118
             ++P+ + W  +PE+ V  G +     P A +E  G + R PI  G+P+R E+L++   
Sbjct: 59  AKLSPDDMSWANWPEDAVPFGAVTKEAAPLANEEYAGRIARAPIFAGEPVRPERLINTDK 118

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIA 178
           G ++++LPKGKRA  + +   ++ GG I P D VDV++ R  S+       +L NIRV+A
Sbjct: 119 GFMAAILPKGKRAIAVSVEEETSAGGFILPGDKVDVILTRK-SDTSAVSETILENIRVLA 177

Query: 179 IDHNIDSDERVL---VGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
           ID     ++         TATLEL+  Q++ +  +Q +  ++L LRS  D         D
Sbjct: 178 IDSTTAGEQEQKNLSPKRTATLELSLPQSEIIAQSQQIGTIALALRSAQDSAD------D 231

Query: 236 VWDVQEEGKEIQIIKAGVIVNKDGE 260
             D     + +  +K GV      +
Sbjct: 232 AEDDGGRRRGVSYVKYGVTSQAGAQ 256


>gi|299067806|emb|CBJ39017.1| Putative pilus assembly (cpaB), transmembrane protein [Ralstonia
           solanacearum CMR15]
          Length = 295

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 69/250 (27%), Positives = 118/250 (47%), Gaps = 31/250 (12%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  R++ +++    A +AG+ AM   S   +Q      +  +    V ++  D+ +G  
Sbjct: 8   MKNLRILSMLL---IATIAGLAAMLFASRWLIQ------QGNSGTTKVAVAAVDVNLGQR 58

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           ++P  +  V +P  ++  G I D H       +DG + R  +  G+P+   KL   G  G
Sbjct: 59  LSPEFIRLVDWPAASLPPGAISDEH------AIDGRVTRTSLSPGEPVLESKLTPVGTKG 112

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS--------------ERKP 165
           GLS+++  GKRA T+ ++    V G   P  +VD+++                   E   
Sbjct: 113 GLSAVIADGKRAITVRVNDVVGVAGFALPGSYVDIIVNTQQEAPDGKPAKGAQADREEHS 172

Query: 166 TVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
              +VL  I V+A+   ++ DE +  V +  TLE+TP +A+ L  A+SV  LSLVLR+  
Sbjct: 173 ISKIVLEKILVLAVAQEVNRDETKPKVVNAVTLEVTPDEAEKLDLARSVGTLSLVLRNQV 232

Query: 225 DLNPSSSEDS 234
           D  P  +  +
Sbjct: 233 DPRPVDTAGA 242


>gi|163851902|ref|YP_001639945.1| Flp pilus assembly protein CpaB [Methylobacterium extorquens PA1]
 gi|254561620|ref|YP_003068715.1| pilus assembly protein cpaB [Methylobacterium extorquens DM4]
 gi|163663507|gb|ABY30874.1| Flp pilus assembly protein CpaB [Methylobacterium extorquens PA1]
 gi|254268898|emb|CAX24859.1| pilus assembly protein cpaB [Methylobacterium extorquens DM4]
          Length = 261

 Score =  212 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 81/262 (30%), Positives = 134/262 (51%), Gaps = 8/262 (3%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLV-SPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK  RL  + ++ V    A ++      +P      +     P     VL++  +L +G 
Sbjct: 1   MKPARLAVLGIALVAGCGAALLMQGEEKAPEPAPVAKAEPVAPVPMSEVLVAAAELPMGQ 60

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG 119
            + P  L W+A+PE+ +  G I+    P  +++  G ++R      +PIR E+LV  G+G
Sbjct: 61  TLKPEDLRWIAWPEQAISPGLIERRAAPKGLEDSVGAIIRTGFSANEPIRPERLVKAGSG 120

Query: 120 GLSSLLPKGKRAATMDISI--SSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVI 177
            +S++LP G RA  +      SS+ GG + PNDHVDV+   S    +     +L+++RV+
Sbjct: 121 FMSAILPPGMRAVAITTDTRGSSSAGGFVLPNDHVDVIKT-SNEGTEQFAETLLTDVRVL 179

Query: 178 AIDHNIDSDE--RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
           A+   +       V+   TATL LTP QA+ +  AQ V +LSLVLRSI D    ++  S+
Sbjct: 180 AVGQIVQEKNGANVVTAETATLALTPSQAETVTLAQKVGQLSLVLRSIQDSA-RTAALSE 238

Query: 236 VWDVQEEGKEIQIIKAGVIVNK 257
             D+  EG  + +++ GV   +
Sbjct: 239 EADMPPEGP-MTVVRFGVAKQQ 259


>gi|240139025|ref|YP_002963500.1| pilus assembly protein cpaB [Methylobacterium extorquens AM1]
 gi|240008997|gb|ACS40223.1| pilus assembly protein cpaB [Methylobacterium extorquens AM1]
          Length = 261

 Score =  212 bits (539), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 81/262 (30%), Positives = 134/262 (51%), Gaps = 8/262 (3%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLV-SPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK  RL  + ++ V    A ++      +P      +     P     VL++  +L +G 
Sbjct: 1   MKPARLAVLGIALVAGCGAALLMQGEEKAPEPAPVAKAEPVVPVPMSEVLVAAAELPMGQ 60

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG 119
            + P  L W+A+PE+ +  G I+    P  +++  G ++R      +PIR E+LV  G+G
Sbjct: 61  TLKPEDLRWIAWPEQAISPGLIERRAAPKGLEDSVGAIIRTGFSANEPIRPERLVKAGSG 120

Query: 120 GLSSLLPKGKRAATMDISI--SSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVI 177
            +S++LP G RA  +      SS+ GG + PNDHVDV+   S    +     +L+++RV+
Sbjct: 121 FMSAILPPGMRAVAITTDTRGSSSAGGFVLPNDHVDVIKT-SNEGTEQFAETLLTDVRVL 179

Query: 178 AIDHNIDSDE--RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
           A+   +       V+   TATL LTP QA+ +  AQ V +LSLVLRSI D    ++  S+
Sbjct: 180 AVGQIVQEKNGANVVTAETATLALTPSQAETVTLAQKVGQLSLVLRSIQDSA-RTAALSE 238

Query: 236 VWDVQEEGKEIQIIKAGVIVNK 257
             D+  EG  + +++ GV   +
Sbjct: 239 EADMPPEGP-MTVVRFGVAKQQ 259


>gi|190889880|ref|YP_001976422.1| pilus assembly protein [Rhizobium etli CIAT 652]
 gi|218509313|ref|ZP_03507191.1| pilus assembly protein [Rhizobium etli Brasil 5]
 gi|190695159|gb|ACE89244.1| pilus assembly protein [Rhizobium etli CIAT 652]
 gi|327194695|gb|EGE61541.1| pilus assembly protein [Rhizobium etli CNPAF512]
          Length = 271

 Score =  211 bits (537), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 114/265 (43%), Positives = 163/265 (61%), Gaps = 6/265 (2%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  RL+ + V+ V A +AG++AMR+     V T+          +NVL+S G+LAVG  
Sbjct: 1   MKPARLIILAVAVVAAGLAGLLAMRMAGSGGVVTQVQSVIEKEPTVNVLVSSGNLAVGQR 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +    + W+A+P+  V  G I ++ +P+A+++L G +VR+PI +G+PIR EK+ D  +  
Sbjct: 61  LEEGSVHWMAWPQGGVVPGLITEIEKPDAIKDLQGAVVRLPIFEGEPIRPEKVADSSSRI 120

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE-RKPTVTVVLSNIRVIAI 179
           LSSLLP GKRA   +IS+++  GG I PND VDV+MVR  +E  K     VLSN+RV+AI
Sbjct: 121 LSSLLPAGKRAVATEISVATGAGGFILPNDRVDVIMVRKGTEANKLITETVLSNVRVLAI 180

Query: 180 DHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSD 235
           D  I   +   + +VG+TATLELTP Q K L  AQ +A +LSL LRS+AD     +  +D
Sbjct: 181 DQQIQEKDDGSKAVVGTTATLELTPDQTKVLAVAQQMADRLSLALRSVADAQEQDTSAAD 240

Query: 236 VWDVQEEGKE-IQIIKAGVIVNKDG 259
                + G   IQ+IK+G IV   G
Sbjct: 241 YLLSGDNGSAIIQVIKSGSIVTDAG 265


>gi|307943144|ref|ZP_07658489.1| Flp pilus assembly protein CpaB [Roseibium sp. TrichSKD4]
 gi|307773940|gb|EFO33156.1| Flp pilus assembly protein CpaB [Roseibium sp. TrichSKD4]
          Length = 256

 Score =  210 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 80/266 (30%), Positives = 129/266 (48%), Gaps = 16/266 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEV--ITENPAKFINVLISKGDLAVG 58
           MK  RL  + V    A+ AG++A RLVS    + E V  +T    +   VL++  D+ +G
Sbjct: 1   MKYARLAILGV----AVGAGLLAARLVSTSAPEPEPVAEVTAPTIEKTEVLVASSDITLG 56

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN 118
             +  +   W ++P E +  G +     P AM+ L G + R PI  G+PIR E+L+    
Sbjct: 57  SKLGGSDFTWASWPTEALPAGVLTKDDDPEAMERLVGQVTRTPIFSGEPIREERLIRTDK 116

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE-RKPTVTVVLSNIRVI 177
           G ++++LPKG RA  + +   +  GG I P D VDV++ ++  E        +L N+RV+
Sbjct: 117 GFMAAILPKGMRAIAVSVEAETTAGGFILPGDKVDVILTKASGETGSAVSNTILENVRVL 176

Query: 178 AIDHNIDSDERVLVG---STATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           AID     D+         TATLEL   Q++ +  AQ V  +SL LRS  D   ++ +  
Sbjct: 177 AIDAVTAGDQDEKNVSPDRTATLELNLPQSEIISQAQQVGTISLALRSAQDSADNAEQTV 236

Query: 235 DVWDVQEEGKEIQIIKAGVIVNKDGE 260
                    + +  +K G+      +
Sbjct: 237 ------RRKRAVNFVKYGLTSQAASQ 256


>gi|17545375|ref|NP_518777.1| pilus assembly transmembrane protein [Ralstonia solanacearum
           GMI1000]
 gi|17427667|emb|CAD14186.1| probable pilus assembly cpab transmembrane protein [Ralstonia
           solanacearum GMI1000]
          Length = 288

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 69/250 (27%), Positives = 118/250 (47%), Gaps = 31/250 (12%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  R++ +++    A +AG+ AM   S   +Q      +  +    V ++  D+ +G  
Sbjct: 1   MKNLRILSMLL---IATIAGLAAMLFASRWLIQ------QGNSGTTKVAVAAVDVNLGQR 51

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           ++P  +  V +P  ++  G I D H       +DG + R  +  G+P+   KL   G  G
Sbjct: 52  LSPEFIRLVDWPAASLPPGAISDEH------AIDGRVTRTSLSPGEPVLESKLTPVGTKG 105

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS--------------ERKP 165
           GLS+++  GKRA T+ ++    V G   P  +VD+++                   E   
Sbjct: 106 GLSAVIADGKRAITVRVNDVVGVAGFALPGSYVDIIVNTQQETPDGKPAKGAQADREEHS 165

Query: 166 TVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
              +VL  I V+A+   ++ DE +  V +  TLE+TP +A+ L  A+SV  LSLVLR+  
Sbjct: 166 ISKIVLEKILVLAVAQEVNRDETKPKVVNAVTLEVTPDEAEKLDLARSVGTLSLVLRNQV 225

Query: 225 DLNPSSSEDS 234
           D  P  +  +
Sbjct: 226 DPRPVDTAGA 235


>gi|218530653|ref|YP_002421469.1| Flp pilus assembly protein CpaB [Methylobacterium chloromethanicum
           CM4]
 gi|218522956|gb|ACK83541.1| Flp pilus assembly protein CpaB [Methylobacterium chloromethanicum
           CM4]
          Length = 261

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 80/262 (30%), Positives = 133/262 (50%), Gaps = 8/262 (3%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLV-SPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK  RL  + ++ V    A ++      +P  V   +     P     VL++  +L +G 
Sbjct: 1   MKPARLAVLGIALVAGCGAALLMQGEEKAPEAVPVAKAEPVAPVPMSEVLVAAAELPMGQ 60

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG 119
            + P  L W+A+PE+ +  G I+    P  +++  G ++R      +PIR E+LV  G+G
Sbjct: 61  TLKPEDLRWLAWPEQAISPGLIERRAAPKGLEDAVGAIIRTGFSANEPIRPERLVKAGSG 120

Query: 120 GLSSLLPKGKRAATMDISI--SSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVI 177
            +S++LP G RA  +      SS+ GG + PNDHVDV+   S    +     +L+++RV+
Sbjct: 121 FMSAILPPGMRAVAITTDTRGSSSAGGFVLPNDHVDVIKT-SNEGTEQFAETLLTDVRVL 179

Query: 178 AIDHNIDSDE--RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
           A+   +       V+   TATL LTP QA+ +  AQ V +LSLVLRSI D    ++   +
Sbjct: 180 AVGQIVQEKNGANVVTAETATLALTPSQAETVTLAQKVGQLSLVLRSIQDSA-RTAALFE 238

Query: 236 VWDVQEEGKEIQIIKAGVIVNK 257
              +  EG  + +++ GV   +
Sbjct: 239 EAGMPPEGP-MTVVRFGVAKQQ 259


>gi|13474659|ref|NP_106228.1| pilus assembly protein cpaB [Mesorhizobium loti MAFF303099]
 gi|14025414|dbj|BAB52014.1| pilus assembly protein; CpaB [Mesorhizobium loti MAFF303099]
          Length = 271

 Score =  209 bits (533), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 92/266 (34%), Positives = 142/266 (53%), Gaps = 12/266 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQ--TEEVITENPAKFINVLISKGDLAVG 58
           M  +RL+ + V+   A  AG +A  +V+    Q   +           +VL+  GD+A+G
Sbjct: 1   MPASRLIILSVAVAAAGGAGYVAKNMVAAPPPQIVVDSGPQAPAVPLQDVLVLSGDVAMG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN 118
             +  N + W ++P + V   FI   + P+A+++L G + RVP+  G+P+R  KL+  G 
Sbjct: 61  NALQ-NNISWQSWPADGVNANFITKANAPDALEKLKGSIARVPMYAGEPVRRSKLIGEGQ 119

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP----TVTVVLSNI 174
             +SS+LP G RA    IS  ++ GG I PND VDV+M R               +L NI
Sbjct: 120 SFMSSILPSGMRAVATTISADTSAGGFILPNDFVDVIMTRRADANSGSTGFNTETILKNI 179

Query: 175 RVIAIDHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSS 230
           RV+AID  I  DE   +  VG TATLELTP QA+ +  AQ +A +L+L LR++AD    +
Sbjct: 180 RVLAIDQTIQEDEEGKKTRVGQTATLELTPKQAEIITVAQQMADRLTLALRAVADTQEKN 239

Query: 231 SEDSDVWDVQEEGK-EIQIIKAGVIV 255
             ++D        K  +++IK+G + 
Sbjct: 240 VGEADYLVSGNGRKGTVRLIKSGEVS 265


>gi|260461950|ref|ZP_05810195.1| Flp pilus assembly protein CpaB [Mesorhizobium opportunistum
           WSM2075]
 gi|259032197|gb|EEW33463.1| Flp pilus assembly protein CpaB [Mesorhizobium opportunistum
           WSM2075]
          Length = 271

 Score =  209 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 91/266 (34%), Positives = 140/266 (52%), Gaps = 12/266 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQ--TEEVITENPAKFINVLISKGDLAVG 58
           M  +RL+ + V+   A  AG +A  +V+P   Q   +           +VL+  GD+A+G
Sbjct: 1   MPASRLIILSVAVAAAGGAGYVAKNMVAPPPAQIVVDSGPKAPAVALQDVLVLSGDVAMG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN 118
             +  N + W  +P + +   FI     P+A+++L G + RV +  G+P+R  KL+  G 
Sbjct: 61  NQL-ENNIAWQPWPADGINPNFITKATAPDALEKLKGSIARVGMYAGEPVRRSKLIGEGQ 119

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP----TVTVVLSNI 174
             +SS+LP G RA    IS  ++ GG I PND VDV+M R               +L NI
Sbjct: 120 SFMSSILPSGMRAVATTISADTSAGGFILPNDFVDVIMTRRADANSGSTGFNTETILKNI 179

Query: 175 RVIAIDHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSS 230
           RV+AID  I  DE   +  VG TATLELTP QA+ +  AQ +A +L+L LR+I D    +
Sbjct: 180 RVLAIDQTIQEDEEGKKTRVGQTATLELTPKQAEIITVAQQMADRLTLALRAITDTQEKN 239

Query: 231 SEDSDVWDVQEEGK-EIQIIKAGVIV 255
            +++D        K  +++IK+G + 
Sbjct: 240 VDEADYLVSGNGRKGTVRLIKSGEVS 265


>gi|39937141|ref|NP_949417.1| Flp pilus assembly CpaB [Rhodopseudomonas palustris CGA009]
 gi|39650999|emb|CAE29522.1| possible pilus assembly protein cpaB [Rhodopseudomonas palustris
           CGA009]
          Length = 270

 Score =  208 bits (530), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 86/261 (32%), Positives = 137/261 (52%), Gaps = 16/261 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+L++   +V+    A  A    +   S      +        + ++VL++K ++A+G +
Sbjct: 1   MRLSKPRIVVLGIALAAGAAAAFLASSSDSERPRQVAEPAPQLQTVDVLVAKSNIALGQL 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR-GNG 119
           VTP+ + W ++P ++  + F+     PN    L G + R P + G+PIR  KLV   G+G
Sbjct: 61  VTPSDVRWQSWPADSASEHFLRRDKMPNTEAFLAGTIARSPFVAGEPIREVKLVKPNGSG 120

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK-------PTVTVVLS 172
            ++++LP G RA + +IS  ++ GG I PND VDV++ +              T T +L+
Sbjct: 121 FMAAILPTGMRAVSTEISPETSAGGFILPNDKVDVILTKRDKSSDIPGAKDTVTSTTILT 180

Query: 173 NIRVIAIDH--NIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           N+RV+AID        + V+VG TATLELT  QA+ L  A+    LSL LRSIAD     
Sbjct: 181 NVRVLAIDQLPKEREGQNVVVGKTATLELTGDQAEVLTRARQSGTLSLALRSIADARIV- 239

Query: 231 SEDSDVWDVQEEGKEIQIIKA 251
           +E SD  D     K+I + + 
Sbjct: 240 AEASDQGD-----KQITVYRG 255


>gi|192292976|ref|YP_001993581.1| Flp pilus assembly protein CpaB [Rhodopseudomonas palustris TIE-1]
 gi|192286725|gb|ACF03106.1| Flp pilus assembly protein CpaB [Rhodopseudomonas palustris TIE-1]
          Length = 270

 Score =  208 bits (529), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 86/261 (32%), Positives = 137/261 (52%), Gaps = 16/261 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+L++   +V+    A  A    +   S      +        + ++VL++K ++A+G +
Sbjct: 1   MRLSKPRIVVLGIALAAGAAAAFLASSSDSERPRQVAEPAPQLQTVDVLVAKSNIALGQL 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR-GNG 119
           VTP+ + W ++P ++  + F+     PN    L G + R P + G+PIR  KLV   G+G
Sbjct: 61  VTPSDVRWQSWPADSASEHFLRRDKMPNTEAFLAGTIARSPFVAGEPIREVKLVKPNGSG 120

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK-------PTVTVVLS 172
            ++++LP G RA + +IS  ++ GG I PND VDV++ +              T T +L+
Sbjct: 121 FMAAILPTGMRAVSTEISPETSAGGFILPNDKVDVILTKRDKSSDIPGAKDTVTSTTILT 180

Query: 173 NIRVIAIDH--NIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           N+RV+AID        + V+VG TATLELT  QA+ L  A+    LSL LRSIAD     
Sbjct: 181 NVRVLAIDQLPKEREGQNVVVGKTATLELTGDQAEVLTRARQSGTLSLALRSIADARVV- 239

Query: 231 SEDSDVWDVQEEGKEIQIIKA 251
           +E SD  D     K+I + + 
Sbjct: 240 AEASDQGD-----KQITVYRG 255


>gi|319785609|ref|YP_004145085.1| Flp pilus assembly protein CpaB [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317171497|gb|ADV15035.1| Flp pilus assembly protein CpaB [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 270

 Score =  207 bits (528), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 93/266 (34%), Positives = 144/266 (54%), Gaps = 13/266 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPA-KFINVLISKGDLAVGM 59
           M  +RL+ + V+   A  AG +A  +V+P      +   + PA    +VL+  GD+ +G 
Sbjct: 1   MPASRLIILSVAVAAAGGAGYVAKNMVAPPPQVVVDSAPQAPAVALQDVLVLSGDVPMGS 60

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG 119
            +  N + W ++P + V   FI    +P A+ +L G + RV +  G+P+R  KL+  G  
Sbjct: 61  PIQ-NNIAWQSWPADGVNANFITRTAEPEALDKLKGSIARVAMYAGEPLRRSKLIGEGQS 119

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP----TVTVVLSNIR 175
            +SS+LP G RA    IS  ++ GG I PND VDV+M R               +L NIR
Sbjct: 120 FMSSILPSGMRAVATAISADTSAGGFILPNDFVDVIMTRRADAASGAAGFNTETILKNIR 179

Query: 176 VIAIDHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSS 231
           V+AID  I  DE   +  VG TATLELTP QA+ +  AQ +A +L+L LR++AD    + 
Sbjct: 180 VLAIDQTIQEDEEGKKTRVGQTATLELTPKQAEIITVAQQMADRLTLALRAVADTQEKNV 239

Query: 232 EDSDVWDVQEEGKE--IQIIKAGVIV 255
            ++D + V   G+   +++IK+G + 
Sbjct: 240 GEAD-YLVSGNGRRGTVRLIKSGEVS 264


>gi|254255253|ref|ZP_04948569.1| Flp pilus assembly protein CpaB [Burkholderia dolosa AUO158]
 gi|124900990|gb|EAY71740.1| Flp pilus assembly protein CpaB [Burkholderia dolosa AUO158]
          Length = 323

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 71/240 (29%), Positives = 123/240 (51%), Gaps = 21/240 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK +R + +    V A+VAG+ A+   S   VQT            +V ++  DL +G  
Sbjct: 43  MKNSRAVMM---LVVAMVAGLAAVVFASHWLVQTSTSA------VTSVAVAATDLNLGEP 93

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           +  N +  V++P  +V  G   D       + L+G +VR  + +G+P+   KL   G  G
Sbjct: 94  LGANQIHMVSWPSGSVPTGAFTDT------KALEGRVVRTSLARGEPVIESKLAPIGTKG 147

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV----RSLSERKPTVTVVLSNIR 175
           GLS+++ +G RA T+ ++    V G   P ++VDV++     +  ++ +    +VL +I 
Sbjct: 148 GLSAVIAEGSRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQQGKTDGQSISKIVLEHIL 207

Query: 176 VIAIDHNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           V+A+   +  D+    V +  TLE+TP QA+ L  A+SV  LSLVLR+  D    +++ +
Sbjct: 208 VLAVAQQVSRDDTAPKVVNAVTLEVTPEQAERLDLARSVGTLSLVLRNQIDKQTLNTDGA 267


>gi|254502627|ref|ZP_05114778.1| Flp pilus assembly protein CpaB [Labrenzia alexandrii DFL-11]
 gi|222438698|gb|EEE45377.1| Flp pilus assembly protein CpaB [Labrenzia alexandrii DFL-11]
          Length = 256

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 77/259 (29%), Positives = 128/259 (49%), Gaps = 12/259 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  R++ + ++    ++A    + +      Q              VL +  D+ +G  
Sbjct: 3   MKFARILVLAIAVAAGVLA-FRMVMMSGGSSDQASNAPVPLEQAKGQVLTAATDILLGAK 61

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +T   + W  +PEE V  G +     P+A +EL G + + PI KG+PIR E+L++   G 
Sbjct: 62  LTAEDMVWTDWPEEAVPIGAVTKQVNPSASEELMGQIAKTPIFKGEPIRPERLINTDKGF 121

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
           +S++LPKGKRA  + +   +  GG I P D VDV++ R   +       +L NIRV+AID
Sbjct: 122 MSAILPKGKRAIAVSVEAETTAGGFILPGDKVDVILTRRTDDT-AISETILENIRVLAID 180

Query: 181 HNI--DSDERVL-VGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVW 237
                + D++ L    TATLELT  Q++ +  +Q V  ++L LRS  D        +D  
Sbjct: 181 TTTAGEQDQKNLSPQRTATLELTLGQSEVVAQSQQVGAIALALRSAQDS-------ADDA 233

Query: 238 DVQEEGKEIQIIKAGVIVN 256
           +  E  + + ++K G+   
Sbjct: 234 EPTETRRGVNLVKYGITSQ 252


>gi|241207156|ref|YP_002978252.1| Flp pilus assembly protein CpaB [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861046|gb|ACS58713.1| Flp pilus assembly protein CpaB [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 271

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 110/265 (41%), Positives = 161/265 (60%), Gaps = 6/265 (2%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  RL+ + V+ V A +AG++AM++     V T+          +N+L+S G+L+VG  
Sbjct: 1   MKPARLIILAVAVVAAGLAGLLAMQMAGSGGVVTQVRSVVEKEPTVNILVSSGNLSVGAR 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +    + W+A+P+  V  G I +  +P+A+++L G +VR+PI +G+PIR EK+ D  +  
Sbjct: 61  LDDQAVHWMAWPQGGVVPGLITETDKPDAIKDLQGAVVRLPIFEGEPIRPEKIADSSSRI 120

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP-TVTVVLSNIRVIAI 179
           LSSLLP GKRA   +IS+++  GG I PND VDV+MVR  +E        VLSN+RV+AI
Sbjct: 121 LSSLLPAGKRAVATEISVATGAGGFILPNDRVDVIMVRKGAEADKLITETVLSNVRVLAI 180

Query: 180 DHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSD 235
           D  I   +   + +VG+TATLELTP Q K L  AQ +A +LSL LRS+AD     +  +D
Sbjct: 181 DQQIQEKDDGSKSVVGTTATLELTPDQTKVLAVAQQMADRLSLALRSVADAQEQDTSAAD 240

Query: 236 VWDVQEEGKE-IQIIKAGVIVNKDG 259
                + G   IQ+IK+G IV   G
Sbjct: 241 YLLSGDNGSAIIQVIKSGAIVTDAG 265


>gi|325525577|gb|EGD03367.1| Flp pilus assembly protein CpaB [Burkholderia sp. TJI49]
          Length = 277

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 73/240 (30%), Positives = 125/240 (52%), Gaps = 21/240 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK++R + +    V A++AG  A+   S   VQT        +    + ++  DL +G  
Sbjct: 1   MKISRAVMM---LVIAMIAGFAAVVFASRWLVQTST------SSVTPIAVAATDLNLGEP 51

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           + PN +  V++P  +V  G   D       +ELDG +VR  + +G+P+   KL   G  G
Sbjct: 52  LGPNQVHTVSWPTGSVPPGAFTDP------KELDGRVVRTSLARGEPVIESKLAPVGTKG 105

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV----RSLSERKPTVTVVLSNIR 175
           GLS+++ +G RA T+ ++    V G   P ++VDV++     +  S+ +    +VL +I 
Sbjct: 106 GLSAVIAEGSRAITVRVNDVVGVAGFALPGNYVDVIVNTQAQQGKSDGQSISKIVLEHIL 165

Query: 176 VIAIDHNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           V+A+   +  D+    V +  TLE+TP QA+ L  A+SV  LSLVLR+  D    +++ +
Sbjct: 166 VLAVAQQVSRDDTAPKVVNAVTLEVTPDQAERLDLARSVGTLSLVLRNQIDKQTLNTDGA 225


>gi|110632966|ref|YP_673174.1| putative CpaB2 pilus assembly protein [Mesorhizobium sp. BNC1]
 gi|110283950|gb|ABG62009.1| putative CpaB2 pilus assembly protein [Chelativorans sp. BNC1]
          Length = 267

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 76/236 (32%), Positives = 119/236 (50%), Gaps = 6/236 (2%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
           + R++ ++ +     +A  +AM    P   Q    + +       VL++  DL  G V+ 
Sbjct: 1   MVRILILLFALGSGGIAAWLAMGTAEPTASQPAAAVEQEADPAREVLVAGADLVHGSVLD 60

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLS 122
            + L W  +    V   FI    +P+A Q L G LVR   + G+PIR ++L   G G LS
Sbjct: 61  ESHLRWQPWTAGTVPAVFISRAAKPDAPQALKGSLVRGGFVAGEPIREDRLALPGAGFLS 120

Query: 123 SLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV----RSLSERKPTVTVVLSNIRVIA 178
             LP GKRA  + ++  SA GG I PND VD++            + +   +LSNIRV+A
Sbjct: 121 GQLPSGKRAIAVRVTAESAAGGFILPNDRVDLIHTSVLSGQSGGEQVSSRTILSNIRVLA 180

Query: 179 IDHNI--DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSE 232
           +D N   +SD   +V  TATLE+ P Q   + AA++   +SL LR+ +D +  ++ 
Sbjct: 181 VDQNASGESDGEAVVAKTATLEVEPDQIPIVTAAEASGTISLALRAASDEDEPAAA 236


>gi|134291858|ref|YP_001115627.1| SAF domain-containing protein [Burkholderia vietnamiensis G4]
 gi|134135047|gb|ABO59372.1| SAF domain protein [Burkholderia vietnamiensis G4]
          Length = 281

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 70/241 (29%), Positives = 124/241 (51%), Gaps = 23/241 (9%)

Query: 1   MKLTR-LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK +R ++ +VV+ V  L A + A R +          +  +     +V ++  DL +G 
Sbjct: 1   MKNSRAILMLVVAMVAGLAAVVFASRWL----------MNTSNGSVTSVAVATTDLNLGE 50

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
            + PN +  V++P  +V  G   D       +EL+G +VR  + +G+P+   KL   G  
Sbjct: 51  PLGPNQIHMVSWPAGSVPTGAFTDT------KELEGRVVRTSLARGEPVIESKLAPVGTK 104

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV----RSLSERKPTVTVVLSNI 174
           GGLS+++  G RA T+ ++    V G   P ++VDV++     +  ++ +    +VL +I
Sbjct: 105 GGLSAVIADGSRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQQGKTDGQSISKIVLEHI 164

Query: 175 RVIAIDHNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
            V+A+   +  D+    V +  TLE+TP QA+ L  A+SV  LSLVLR+  D    +++ 
Sbjct: 165 LVLAVAQQVSRDDTAPKVVNAVTLEVTPDQAERLDLARSVGTLSLVLRNQVDHKTLTTDG 224

Query: 234 S 234
           +
Sbjct: 225 A 225


>gi|296156488|ref|ZP_06839326.1| Flp pilus assembly protein CpaB [Burkholderia sp. Ch1-1]
 gi|295893087|gb|EFG72867.1| Flp pilus assembly protein CpaB [Burkholderia sp. Ch1-1]
          Length = 269

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 62/252 (24%), Positives = 121/252 (48%), Gaps = 25/252 (9%)

Query: 8   GIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILE 67
            ++++ +  L A + A R +          ++++      V+++  D+ +G  + P+ L+
Sbjct: 1   MLLIATLAGLTAVVFASRWM----------VSQSSNATTKVVVAATDINLGQRIGPDFLK 50

Query: 68  WVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLP 126
              +P  +V  G   D+      Q+LDG +++  +L G+P+   KL   G  GGLS+++ 
Sbjct: 51  LTEWPSNSVPPGSFTDI------QKLDGRVLKESLLHGEPVLEAKLTPVGTLGGLSAVIG 104

Query: 127 KGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP-------TVTVVLSNIRVIAI 179
           +GKRA T+ ++    V G   P ++VD+++      R P          +VL  I V+A+
Sbjct: 105 EGKRAITVRVNDVIGVAGFALPGNYVDIIVNTQKDARDPGTQRDQNISKIVLEKILVLAV 164

Query: 180 DHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWD 238
              +  DE +  V    TLE++P QA+ +  A+S+  LSLVLR+  D     +  +    
Sbjct: 165 AQEVGRDETKPKVVDAVTLEVSPEQAEKIDLARSIGTLSLVLRNQIDPQAIDTAGATKAT 224

Query: 239 VQEEGKEIQIIK 250
           + +    +  + 
Sbjct: 225 LLKTPVAVAPVP 236


>gi|170750188|ref|YP_001756448.1| Flp pilus assembly protein CpaB [Methylobacterium radiotolerans JCM
           2831]
 gi|170656710|gb|ACB25765.1| Flp pilus assembly protein CpaB [Methylobacterium radiotolerans JCM
           2831]
          Length = 271

 Score =  205 bits (521), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 76/270 (28%), Positives = 124/270 (45%), Gaps = 14/270 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   R   + ++      A  + M    P            P    +VL++  D+ +G V
Sbjct: 1   MNPARFAVLGIALAAGTGAAFL-MSGGDPPPPPPPPAAEAPPQPTTDVLVAAIDMPMGQV 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +    L W  +P+  V +G++     P A++E  G  VR   L G+PIR +KLV   +G 
Sbjct: 60  LRAADLRWQPWPDGAVANGYMTRKINPKALEETVGASVRSGFLTGEPIRAQKLVRPESGF 119

Query: 121 LSSLLPKGKRAATMDISI--SSAVGGMIKPNDHVDVVMVRSLSERK-------PTVTVVL 171
           ++++LP G RA  +      +++ GG I PND VDV+                     +L
Sbjct: 120 MAAILPPGMRAVAIVTDSRGTNSAGGFILPNDRVDVIRTFRDESNSRANNSDVQLSQTIL 179

Query: 172 SNIRVIAIDHNIDSDE--RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLN-- 227
           ++IRV+AI   +       V+ G TATL +TP QA+ L  AQ V  L+L LRS+AD    
Sbjct: 180 TDIRVLAIGQLVQEKNGTNVVTGETATLAVTPAQAETLALAQKVGALTLSLRSLADAGRP 239

Query: 228 PSSSEDSDVWDVQEEGKEIQIIKAGVIVNK 257
           P ++  ++    Q     + +++ GV   +
Sbjct: 240 PEATPLAEASAAQMPEPALTVVRFGVARQQ 269


>gi|90419763|ref|ZP_01227672.1| Flp pilus assembly protein CpaB [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335804|gb|EAS49552.1| Flp pilus assembly protein CpaB [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 293

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 87/228 (38%), Positives = 130/228 (57%), Gaps = 11/228 (4%)

Query: 35  EEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELD 94
                E P K   VL++  DL++G  V    L+W ++PE+ +    I    +P+A++ L 
Sbjct: 58  TAAPAEPPIKLAEVLVTSRDLSMGEAVD-EALDWQSWPEDGIGPTLIRKSDRPDALETLK 116

Query: 95  GVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDV 154
           G L R     G+P+R  KL+    G +S++LP GKRA  + I+  ++ GG + PNDHVDV
Sbjct: 117 GSLARQSFFAGEPVRESKLIRSDQGFMSAVLPAGKRAVAVQIAAETSAGGFVLPNDHVDV 176

Query: 155 VMVRSLS-----ERKPTVTVVLSNIRVIAIDHNIDSD--ERVLVGSTATLELTPMQAKAL 207
           +M R +S       +     VL N+RV+AID  I     E+V+VGSTATLE+ P QA+AL
Sbjct: 177 IMTRRVSSSENRGDQVLTETVLRNLRVLAIDQTIQEKDGEKVVVGSTATLEVDPEQAEAL 236

Query: 208 VAAQSVA-KLSLVLRSIADLNPSSSEDSDVWDVQEEGK--EIQIIKAG 252
            AAQ +A +L L LRS+AD  P S   +     QE  +  +I++++ G
Sbjct: 237 TAAQQIADRLVLSLRSLADSVPGSPGYAAFLLAQENARNGKIRVVRYG 284


>gi|295700371|ref|YP_003608264.1| Flp pilus assembly protein CpaB [Burkholderia sp. CCGE1002]
 gi|295439584|gb|ADG18753.1| Flp pilus assembly protein CpaB [Burkholderia sp. CCGE1002]
          Length = 276

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 120/240 (50%), Gaps = 21/240 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK +R + +      A++AG+ A+   S   +QT            +V ++  D+++G  
Sbjct: 1   MKNSRALVM---LTIAVLAGLAAVSFASRWLLQTSSAA------VTSVAVASSDISLGQP 51

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           +  N++  V++P  +V  G   D       + L+G ++   +  G+P+   KL  +G  G
Sbjct: 52  LNQNLIHMVSWPTSSVPPGAFADS------KALEGRVLLTSLAPGEPVLESKLAPQGTKG 105

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER----KPTVTVVLSNIR 175
           GLS+++ +G RA T+ ++    V G   P ++VDV++    + +    +    +VL  I 
Sbjct: 106 GLSAVIGEGHRAITVRVNDVVGVAGFALPGNYVDVIVNTQQANKTDASQSISKIVLEKIL 165

Query: 176 VIAIDHNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           V+A+   +  D+    V +  TLE+TP QA+ L  A+SV  LSLVLR+  D    S+  +
Sbjct: 166 VLAVAQRVSRDDTAPKVVNAVTLEVTPEQAEKLDLARSVGTLSLVLRNQVDKQTPSTGGA 225


>gi|116249980|ref|YP_765818.1| pilus assembly protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254628|emb|CAK05702.1| putative pilus assembly protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 271

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 108/264 (40%), Positives = 159/264 (60%), Gaps = 6/264 (2%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  RL+ + V+ V A +AG++AM++     V T+          +N+L+S  +L+VG  
Sbjct: 1   MKPARLIILAVAVVAAGLAGLLAMQMAGSGGVVTQVRSVVEKEPTVNILVSSANLSVGAR 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +    + W+A+P+  V  G I +  +P+A+++L G +VR+PI +G+PIR EK+ D  +  
Sbjct: 61  LDDQSVHWMAWPQGGVVPGLITEADKPDAVKDLQGAVVRLPIFEGEPIRPEKIADSSSRI 120

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP-TVTVVLSNIRVIAI 179
           LSSLLP GKRA   +IS+++  GG I PND VDV+MVR  +E        VLSN+RV+AI
Sbjct: 121 LSSLLPAGKRAVATEISVATGAGGFILPNDRVDVIMVRKGAEADKLITETVLSNVRVLAI 180

Query: 180 DHNIDSDE---RVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSD 235
           D  I   +   + +VG+TATLELTP Q K L  AQ +A +LSL LRS+AD     +  +D
Sbjct: 181 DQQIQEKDDGSKSVVGTTATLELTPDQTKVLAVAQQMADRLSLALRSVADAQEQDTSAAD 240

Query: 236 VWDVQEEGKE-IQIIKAGVIVNKD 258
                + G   IQ+IK+G IV   
Sbjct: 241 YLLSGDNGSAIIQVIKSGAIVTDA 264


>gi|197295152|ref|YP_002153693.1| putative flp type pilus assembly protein [Burkholderia cenocepacia
           J2315]
 gi|195944631|emb|CAR57235.1| putative flp type pilus assembly protein [Burkholderia cenocepacia
           J2315]
          Length = 279

 Score =  203 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 68/241 (28%), Positives = 122/241 (50%), Gaps = 23/241 (9%)

Query: 1   MKLTR-LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK +R +M +VV+ +  L A + A   +          +  +     +V ++  DL +G 
Sbjct: 1   MKNSRAVMMLVVAMIAGLAAVVFASHWL----------MQTSTNSVTSVAVATTDLNLGE 50

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
            + PN +  V++P  +V  G   D       + L+G +VR  + +G+P+   KL   G  
Sbjct: 51  PLGPNQIHMVSWPSGSVPTGAFTDT------KALEGRVVRTSLSRGEPVIESKLAPVGTK 104

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV----RSLSERKPTVTVVLSNI 174
           GGLS+++  G RA T+ ++    V G   P ++VDV++     +  ++ +    +VL +I
Sbjct: 105 GGLSAVIADGSRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQQGKTDGQSISKIVLEHI 164

Query: 175 RVIAIDHNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
            V+A+   +  D+    V +  TLE+TP QA+ L  A+SV  LSLVLR+  D    +++ 
Sbjct: 165 LVLAVAQQVSRDDTAPKVVNAVTLEVTPDQAERLDLARSVGTLSLVLRNQVDQKTLNTDG 224

Query: 234 S 234
           +
Sbjct: 225 A 225


>gi|170692565|ref|ZP_02883727.1| Flp pilus assembly protein CpaB [Burkholderia graminis C4D1M]
 gi|170142221|gb|EDT10387.1| Flp pilus assembly protein CpaB [Burkholderia graminis C4D1M]
          Length = 278

 Score =  203 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 69/242 (28%), Positives = 119/242 (49%), Gaps = 23/242 (9%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK +R + +      AL+AG+ A+   S   +QT             V ++  ++++G  
Sbjct: 1   MKTSRAIVM---LGMALLAGLAAVGFASRWLLQTSSSA------LTPVAVATAEVSLGQP 51

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           +   ++  V +P  +V  G   D       + LDG +VR  +  G+P+   KL  +G  G
Sbjct: 52  LNSTMIRTVNWPTASVPPGAFKDP------KALDGRVVRASLEPGEPVIESKLAPQGTKG 105

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE------RKPTVTVVLSN 173
           GLS+++ +GKRA T+ ++    V G   P ++VDV++     E      ++    +VL  
Sbjct: 106 GLSAVIGEGKRAITVRVNDVVGVAGFALPGNYVDVIVNTQEPEAKTADPQQSISKIVLEK 165

Query: 174 IRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSE 232
           I V+A+   +  D+ +  V +  TLE+TP QA+ L  A+SV  LSLVLR+  D     + 
Sbjct: 166 ILVLAVAQQVSRDDTQPKVVNAVTLEVTPDQAEKLDLARSVGSLSLVLRNQIDDRALPTG 225

Query: 233 DS 234
            +
Sbjct: 226 GA 227


>gi|186474102|ref|YP_001861444.1| Flp pilus assembly protein CpaB [Burkholderia phymatum STM815]
 gi|184196434|gb|ACC74398.1| Flp pilus assembly protein CpaB [Burkholderia phymatum STM815]
          Length = 282

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 67/248 (27%), Positives = 122/248 (49%), Gaps = 30/248 (12%)

Query: 1   MKLTR-LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK  R L+ ++V+    L A + A R +          + +       V+I+  D+++G 
Sbjct: 1   MKNARALVMLLVATAAGLAAVVFAARWM----------VQQTSTSTTKVVIASADMSLGQ 50

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
            V+P +L+   +P  +V  G  +DV      ++L+G +++  + +G+P+   KL   G  
Sbjct: 51  RVSPEMLKVSDWPAGSVPPGTFNDV------KKLEGRVLKASLSRGEPVLEAKLSPVGTL 104

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE-----------RKPTV 167
           GGLS+++ +GKRA T+ ++    V G   P ++VD+++                  +   
Sbjct: 105 GGLSAVINEGKRAITVRVNDVIGVAGFALPGNYVDILVNTEKENASREGAGASGRDQNIS 164

Query: 168 TVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADL 226
            +VL  I V+A+      DE +  V    TLE+TP QA+ +  A+S+  LSLVLR+  D 
Sbjct: 165 KIVLEKILVLAVAQEAGRDETKPKVVDAVTLEVTPEQAEKIDLARSIGSLSLVLRNQVDP 224

Query: 227 NPSSSEDS 234
             +S+  +
Sbjct: 225 QDTSTAGA 232


>gi|85373132|ref|YP_457194.1| pilus assembly protein CpaB [Erythrobacter litoralis HTCC2594]
 gi|84786215|gb|ABC62397.1| pilus assembly protein CpaB [Erythrobacter litoralis HTCC2594]
          Length = 371

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 73/253 (28%), Positives = 123/253 (48%), Gaps = 17/253 (6%)

Query: 22  IAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFI 81
           +A R +       E        +   VL+++  L VG ++T + L +  +PEE V D + 
Sbjct: 21  MAARSMFAGASAPEATAAVQEPQGPKVLVAQRGLPVGTIITADALGFQMWPEELVQDAYF 80

Query: 82  DDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISS 140
             +   + + +L G +VR P+  G+P+    LV  G+ G L++ L  G RA T+ +S ++
Sbjct: 81  --IEGESDITQLLGTVVRHPVTAGEPLTQGTLVSPGDRGFLAAALGPGMRAITVPVSANT 138

Query: 141 AVGGMIKPNDHVDVVMVRSLSERK---PTVTVVLSNIRVIAIDHNIDSDER------VLV 191
            V G + P D VD+++ +++   +        +L N+RV+A D   +          V  
Sbjct: 139 GVAGFVFPGDRVDLMLTQAVKGEETDLKATETILRNLRVLATDQTTEQTTNEAGKTVVRA 198

Query: 192 GSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS-----SSEDSDVWDVQEEGKEI 246
             T TLE+TP  A+ +  AQ++  LSL LRSIAD         +S D  + D     +E 
Sbjct: 199 FRTVTLEVTPKIAEKVAVAQTLGTLSLALRSIADNQAELERAIASGDVKIPDGASPEEEE 258

Query: 247 QIIKAGVIVNKDG 259
           +II+A +    DG
Sbjct: 259 RIIQAAMNRPNDG 271


>gi|170734869|ref|YP_001773983.1| Flp pilus assembly protein CpaB [Burkholderia cenocepacia MC0-3]
 gi|169820907|gb|ACA95488.1| Flp pilus assembly protein CpaB [Burkholderia cenocepacia MC0-3]
          Length = 279

 Score =  202 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 73/263 (27%), Positives = 128/263 (48%), Gaps = 23/263 (8%)

Query: 1   MKLTR-LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK +R LM +VV+ V  L A + A R +          +  + +   +V ++  DL +G 
Sbjct: 1   MKNSRALMMLVVAMVAGLAAVVFASRWL----------VQTSTSSVTSVAVASTDLNLGE 50

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
            + PN +  V++P  +V  G   D       + L+G +VR  + +G+P+   KL   G  
Sbjct: 51  PLGPNQIHMVSWPAGSVPTGAFTDT------KALEGRVVRTSLARGEPVIESKLAPVGTK 104

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV----RSLSERKPTVTVVLSNI 174
           GGLS+++  G RA T+ ++    V G   P ++VDV++     +  ++ +    +VL +I
Sbjct: 105 GGLSAVIADGSRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQQGKTDGQSISKIVLEHI 164

Query: 175 RVIAIDHNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
            V+A+   +  D+    V +  TLE+TP QA+ L  A+SV  LSLVLR+  D    ++  
Sbjct: 165 LVLAVAQQVSRDDTAPKVVNAVTLEVTPDQAERLDLARSVGTLSLVLRNQVDQKTLTTGG 224

Query: 234 SDVWDVQEEGKEIQIIKAGVIVN 256
           +    +  +    +   A V   
Sbjct: 225 ATKLTLLGKEPVPEAAPAPVHAR 247


>gi|224824212|ref|ZP_03697320.1| Flp pilus assembly protein CpaB [Lutiella nitroferrum 2002]
 gi|224603631|gb|EEG09806.1| Flp pilus assembly protein CpaB [Lutiella nitroferrum 2002]
          Length = 282

 Score =  202 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 67/234 (28%), Positives = 119/234 (50%), Gaps = 24/234 (10%)

Query: 8   GIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILE 67
            IVVS +  LVA ++A + ++       +           V+++  D+ +G  ++P +L 
Sbjct: 1   MIVVSVIIGLVAVVMASQWINKQTNVAAQ----------KVVVASMDIDLGSKLSPEMLR 50

Query: 68  WVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLP 126
            V +P  ++ +G I D       + LDG +++  + +G+ I   KL   G  GGLS+++ 
Sbjct: 51  SVDWPSGSIPEGAILDP------KALDGRVLKTSVNRGEAILESKLAPVGTKGGLSAVVM 104

Query: 127 KGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP------TVTVVLSNIRVIAID 180
           +GKRA T+ ++    V G   P ++VD+++  +   +K          +VL +I V+A+ 
Sbjct: 105 EGKRAMTVRVNDVVGVAGFALPGNYVDILVNTTDDAKKGQNNDASISKIVLEHILVLAVA 164

Query: 181 HNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
                D+ +  V +  TLE+TP QA+ L  A+SV  LSLVLR+  D  P  +  
Sbjct: 165 QEASRDDTKPKVVNAVTLEVTPEQAEKLDLARSVGTLSLVLRNQVDPKPVQTAG 218


>gi|167584956|ref|ZP_02377344.1| Flp pilus assembly CpaB [Burkholderia ubonensis Bu]
          Length = 280

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 69/240 (28%), Positives = 120/240 (50%), Gaps = 21/240 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK TR + +    + A+VAG+ A+   S   VQT             V ++  DL +G  
Sbjct: 1   MKNTRAITM---LIIAMVAGLAAVAFASRWLVQTSTSA------VTQVAVATTDLNLGEP 51

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           + P  +  +++P  +V  G   D       + L+G +VR  + +G+P+   KL   G  G
Sbjct: 52  IGPAQIRTISWPTGSVPPGAFTDT------KSLEGRVVRTSLARGEPVLEAKLAPLGTKG 105

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV----RSLSERKPTVTVVLSNIR 175
           GLS+++  G RA T+ ++    V G   P ++VDV++          ++    +VL +I 
Sbjct: 106 GLSAVIGAGNRAITVRVNDVVGVAGFALPGNYVDVIVNTQEPGKTDNQQSISKIVLEHIL 165

Query: 176 VIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           V+A+   +  D+ +  V +  TLE++P QA+ L  A+SV  LSLVLR+  D    +++ +
Sbjct: 166 VLAVAQQVSRDDTQPKVVNAVTLEVSPEQAEKLDVARSVGTLSLVLRNQVDKQTLNTDGA 225


>gi|87199102|ref|YP_496359.1| Flp pilus assembly CpaB [Novosphingobium aromaticivorans DSM 12444]
 gi|87134783|gb|ABD25525.1| Flp pilus assembly CpaB [Novosphingobium aromaticivorans DSM 12444]
          Length = 342

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 75/251 (29%), Positives = 129/251 (51%), Gaps = 14/251 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   +LM +V + + A+     A  L + +     E   + P     VL+++  L VG +
Sbjct: 1   MDKRKLMLLVGALIVAIGTAFAARSLFAGNSTPQAEAAAKVPTGP-KVLVAQRALPVGTI 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           +T + + + A+P++ V D +   V     MQ+L G +VR PI  G+P+    LV  G+ G
Sbjct: 60  ITADSINFQAWPKDMVQDAYF--VEGEADMQKLLGTVVRNPITAGEPVTKGNLVAPGDRG 117

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK-----PTVTVVLSNI 174
            L++ L  G RA T+ +S  + V G + P DH+D+V+ +++              +L N+
Sbjct: 118 FLAAALGAGMRAVTIPVSARTGVAGFVFPGDHIDLVLTQTVKGTGEGMALKASETILKNL 177

Query: 175 RVIAIDHNIDSDE-----RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
           RV+A D + + ++     RV   ST TLE+TP  A+ +  AQ++  +SL LRS+AD +  
Sbjct: 178 RVLATDQSTEQEQVEGKTRVRTFSTVTLEVTPKIAEKIAVAQTIGTISLSLRSLADNSAE 237

Query: 230 SSEDSDVWDVQ 240
             +     DV+
Sbjct: 238 LEQAIAAGDVK 248


>gi|91788410|ref|YP_549362.1| Flp pilus assembly CpaB [Polaromonas sp. JS666]
 gi|91697635|gb|ABE44464.1| Flp pilus assembly CpaB [Polaromonas sp. JS666]
          Length = 284

 Score =  202 bits (514), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 75/244 (30%), Positives = 123/244 (50%), Gaps = 26/244 (10%)

Query: 1   MKLTR-LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           M+ TR L+ I V+ V A  A I+A R +S           +  A    V ++  D+++G 
Sbjct: 1   MRNTRALVMIAVAVVLAFGAVIVAARWIS----------AQASADTSKVAVAAVDISLGA 50

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
            ++P ++  V +P   +  G I D       ++L+  + R  I +G+P+   KL   G  
Sbjct: 51  RLSPEMVRMVDWPASAMPPGAITDA------KQLETRVTRTSIQRGEPVMEGKLAPPGTQ 104

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV-------RSLSERKPTVTVVL 171
           GGLS+++ +GKRA T+ ++    V G   P + VD+++            + +    +VL
Sbjct: 105 GGLSAVVAEGKRAMTVRVNDVVGVAGFALPGNFVDILVNTQDEPGKGGAGKDQTISKIVL 164

Query: 172 SNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
             I V+AI      DE +  V +  TLELTP QA+ L  A+SV  LSLVLR+  D NP +
Sbjct: 165 ERILVLAIAQESSRDETKPKVVNAVTLELTPDQAEKLDLARSVGTLSLVLRNQVDPNPVN 224

Query: 231 SEDS 234
           ++ +
Sbjct: 225 TKGA 228


>gi|107028249|ref|YP_625344.1| Flp pilus assembly CpaB [Burkholderia cenocepacia AU 1054]
 gi|116687160|ref|YP_840407.1| Flp pilus assembly CpaB [Burkholderia cenocepacia HI2424]
 gi|105897413|gb|ABF80371.1| Flp pilus assembly CpaB [Burkholderia cenocepacia AU 1054]
 gi|116652875|gb|ABK13514.1| Flp pilus assembly CpaB [Burkholderia cenocepacia HI2424]
          Length = 279

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 72/258 (27%), Positives = 127/258 (49%), Gaps = 23/258 (8%)

Query: 1   MKLTR-LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK +R LM +VV+ V  L A + A R +          +  + +   +V ++  DL +G 
Sbjct: 1   MKNSRALMMLVVAMVAGLAAVVFASRWL----------VQTSTSSVTSVAVATTDLNLGE 50

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
            + PN +  V++P  +V  G   D       + L+G +VR  + +G+P+   KL   G  
Sbjct: 51  PLGPNQIHMVSWPAGSVPTGAFTDT------KTLEGRVVRTSLARGEPVIESKLAPVGTK 104

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV----RSLSERKPTVTVVLSNI 174
           GGLS+++  G RA T+ ++    V G   P ++VDV++     +  ++ +    +VL +I
Sbjct: 105 GGLSAVIADGSRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQQGKTDGQSISKIVLEHI 164

Query: 175 RVIAIDHNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
            V+A+   +  D+    V +  TLE+TP QA+ L  A+SV  LSLVLR+  D    ++  
Sbjct: 165 LVLAVAQQVSRDDTAPKVVNAVTLEVTPDQAERLDLARSVGTLSLVLRNQVDQKTLTTGG 224

Query: 234 SDVWDVQEEGKEIQIIKA 251
           +    +  +    +   A
Sbjct: 225 ATKLTLLGKEPVPEAAPA 242


>gi|187919323|ref|YP_001888354.1| Flp pilus assembly protein CpaB [Burkholderia phytofirmans PsJN]
 gi|187717761|gb|ACD18984.1| Flp pilus assembly protein CpaB [Burkholderia phytofirmans PsJN]
          Length = 269

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 63/248 (25%), Positives = 120/248 (48%), Gaps = 25/248 (10%)

Query: 8   GIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILE 67
            ++++ +  L A + A R +          ++++      V+++  D+ +G  + P+ L+
Sbjct: 1   MLLIATLAGLTAVVFASRWM----------VSQSSNATTRVVVAAADINLGQRIGPDYLK 50

Query: 68  WVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLP 126
              +P  +V  G   D+      Q+LDG +++  +L+G+PI   KL   G  GGLS+++ 
Sbjct: 51  LTDWPSNSVPPGSYSDI------QKLDGRVLKESLLRGEPILDAKLTPVGTLGGLSAVIG 104

Query: 127 KGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP-------TVTVVLSNIRVIAI 179
           +GKRA T+ ++    V G   P ++VD+++      R P          +VL  I V+A+
Sbjct: 105 EGKRAITVRVNDVIGVAGFALPGNYVDIIVNTQKDGRDPGATRDQNISKIVLEKILVLAV 164

Query: 180 DHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWD 238
              +  DE +  V    TLE+ P QA+ +  A+S+  LSLVLR+  D     +  +    
Sbjct: 165 AQEVGRDETKPKVVDAVTLEVLPEQAEKIDLARSIGTLSLVLRNQIDPKAIDTAGATKAS 224

Query: 239 VQEEGKEI 246
           + +    +
Sbjct: 225 LLQTPVAV 232


>gi|78060315|ref|YP_366890.1| Flp pilus assembly CpaB [Burkholderia sp. 383]
 gi|77964865|gb|ABB06246.1| Flp pilus assembly CpaB [Burkholderia sp. 383]
          Length = 279

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 72/240 (30%), Positives = 122/240 (50%), Gaps = 21/240 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK +R + +    V A+VAG+ A+   S   VQT        +    V ++  DL +G  
Sbjct: 1   MKNSRAVMM---LVVAMVAGLAAVVFASHWLVQTST------SSVTPVAVATTDLNLGEP 51

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           + PN +  V++P  +V  G   D         L+G +VR  + +G+P+   KL   G  G
Sbjct: 52  LGPNQIHMVSWPSGSVPTGAFTDTKG------LEGRVVRTSLSRGEPVIESKLAPVGTKG 105

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV----RSLSERKPTVTVVLSNIR 175
           GLS+++  G RA T+ ++    V G   P ++VDV++     +  ++ +    +VL +I 
Sbjct: 106 GLSAVIADGSRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQQGKTDGQSISKIVLEHIL 165

Query: 176 VIAIDHNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           V+A+   +  D+    V +  TLE+TP QA+ L  A+SV  LSLVLR+  D    +++ +
Sbjct: 166 VLAVAQQVSRDDTAPKVVNAVTLEVTPDQAERLDLARSVGTLSLVLRNQVDQKTLNTDGA 225


>gi|326388865|ref|ZP_08210447.1| Flp pilus assembly CpaB [Novosphingobium nitrogenifigens DSM 19370]
 gi|326206465|gb|EGD57300.1| Flp pilus assembly CpaB [Novosphingobium nitrogenifigens DSM 19370]
          Length = 347

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 78/269 (28%), Positives = 132/269 (49%), Gaps = 19/269 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   +L+ +V + +FA+   + A  L++      + +          VL+++  L VG +
Sbjct: 1   MDRKKLILLVGALIFAIATSLAARALLTGGSTP-QAIAAAKVLDGPKVLVAQRALPVGTI 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           +T + + + A+P++ V D +   +     MQ+L G +VR PI  G PI    LV  G+ G
Sbjct: 60  ITADAVSYQAWPKDLVQDAYF--LQDKTDMQKLLGTVVRNPITAGQPITTGSLVAPGDRG 117

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK-----PTVTVVLSNI 174
            L++ L  G RA T+ +S  + V G + P DHVD+++ +S+              +L N+
Sbjct: 118 FLAAALGPGMRAVTIPVSTRTGVAGFVFPGDHVDLLLTQSVKGDGESQALKATETILKNL 177

Query: 175 RVIAIDHNIDSD-----ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADL--- 226
           RV+A D + D +      RV   S  T+E TP  A+ L  A+S+  +SL LRSIAD    
Sbjct: 178 RVLATDQSTDQETVDGHTRVKGFSLVTVEATPKIAEELAVAESIGTISLSLRSIADNSSE 237

Query: 227 --NPSSSEDSDVWDVQEEGKEIQIIKAGV 253
                +S          + +E ++IKA +
Sbjct: 238 LEQAVASGQVKFPAGASKAEEDRLIKAAM 266


>gi|300021853|ref|YP_003754464.1| Flp pilus assembly protein CpaB [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299523674|gb|ADJ22143.1| Flp pilus assembly protein CpaB [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 267

 Score =  200 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 80/269 (29%), Positives = 136/269 (50%), Gaps = 14/269 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  +L+G  V+   A +A  IA   ++P       V  E       VL++  D++VG +
Sbjct: 1   MKRAQLVGFSVAFAAAALAYYIASAFMTPPK----TVTVEKQVDSTEVLVAATDISVGQI 56

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQ-PNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG 119
           V      W  +P+  V   ++   +  P    E  G + R  IL G+P+  +KL+  G G
Sbjct: 57  VNEGNFHWATWPKSAVTADYVTKANSGPGKAHEFTGAVARSAILSGEPVTTQKLIKAGQG 116

Query: 120 G-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVR----SLSERKPTVTVVLSNI 174
           G L+++LP+G RA +  I   +A G +I PNDHVDV+++R       + +     +  N+
Sbjct: 117 GVLAAILPQGMRAISTKIKAETAAGSLILPNDHVDVILIRHVRSRSGQEETVADTLFRNV 176

Query: 175 RVIAIDHNIDSDERV----LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           RV+AI   I++ +      +  STATLEL P QA+ +  A S+ +++L LRS+ADL+   
Sbjct: 177 RVMAIGQQIETKDGKKSADISASTATLELMPKQAEMMALANSMGEITLSLRSVADLSSDP 236

Query: 231 SEDSDVWDVQEEGKEIQIIKAGVIVNKDG 259
               ++   + +   ++I++ G      G
Sbjct: 237 ERAGNLDLNKPQNNSVRIVRYGAKSRVYG 265


>gi|83859356|ref|ZP_00952877.1| Flp pilus assembly CpaB [Oceanicaulis alexandrii HTCC2633]
 gi|83852803|gb|EAP90656.1| Flp pilus assembly CpaB [Oceanicaulis alexandrii HTCC2633]
          Length = 268

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 75/222 (33%), Positives = 115/222 (51%), Gaps = 4/222 (1%)

Query: 39  TENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLV 98
                + + VL++  D++    V+     W  +P E V   FI    +P+AM EL G + 
Sbjct: 40  QAAAPEVVQVLVAARDMSPSSRVSGADFRWTNWPVEAVIPAFITREARPDAMDELSGAVT 99

Query: 99  RVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV 157
           R   + G+PI   KLV  G  G +++++  G RA  + IS  S  GG I PND VDV++ 
Sbjct: 100 RAAFVDGEPILPGKLVQPGEAGFMAAVIDPGMRAVAVPISAESGAGGFILPNDRVDVLVT 159

Query: 158 RSLSERKPTVTVVLSNIRVIAIDHN-IDSDERVLVGSTATLELTPMQAKALVAAQSVAKL 216
            S  +      V++ N+RV+AID   +D  E V++GSTATLELTP Q  ++    +   +
Sbjct: 160 TSARDMGYISEVLVENVRVLAIDQTYVDDGEGVVLGSTATLELTPQQTSSVALGVAEGDI 219

Query: 217 SLVLRSIADL--NPSSSEDSDVWDVQEEGKEIQIIKAGVIVN 256
            L LRS+AD    P     +D    +  G+E++II+ G    
Sbjct: 220 VLALRSVADREGGPRLPNGADDEAGERRGREVRIIRYGAEQR 261


>gi|167624206|ref|YP_001674500.1| SAF domain-containing protein [Shewanella halifaxensis HAW-EB4]
 gi|167354228|gb|ABZ76841.1| SAF domain protein [Shewanella halifaxensis HAW-EB4]
          Length = 270

 Score =  199 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 67/250 (26%), Positives = 117/250 (46%), Gaps = 16/250 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M    ++ +++S VF + A  +A   +  +        TE      NV+    ++ +G +
Sbjct: 1   MNNKTVLFVILSLVFGVTAVYLAQSWLKSN------TQTETVGTTSNVITMVTEVPLGTI 54

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +    L     PE  V  G I D+       E +G +V+  + +G+ +R E+L  +G G 
Sbjct: 55  IERKHLALTPVPENLVPKGAITDI------TEAEGQVVKHRLYQGEVLRKERLTPKGEGS 108

Query: 121 -LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAI 179
            L+SL+    RA T+ ++    V G + P + VD++ +   S  K    +VLSN++++AI
Sbjct: 109 TLASLITPTMRAVTIRVNDVVGVAGFLLPGNRVDIINIFKSSGLK--TDIVLSNVKILAI 166

Query: 180 DHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWD 238
           D    +DE + ++    TLEL+  QA+ L+ A+S   L L LR+  D       + D  D
Sbjct: 167 DQKASNDENKPVLVRAVTLELSLEQAEVLMIAKSRGSLQLALRNPNDTAVIELAEIDEPD 226

Query: 239 VQEEGKEIQI 248
             E      I
Sbjct: 227 EDEVEISENI 236


>gi|149186254|ref|ZP_01864568.1| pilus assembly protein CpaB [Erythrobacter sp. SD-21]
 gi|148830285|gb|EDL48722.1| pilus assembly protein CpaB [Erythrobacter sp. SD-21]
          Length = 361

 Score =  198 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 71/274 (25%), Positives = 131/274 (47%), Gaps = 16/274 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   +L+ +V + + A+   ++A  + +       +      ++   VL+++  L  G +
Sbjct: 1   MDRKKLVLLVGALIVAIGTALVARSMFAGASAPQAQAAAVVESQGPKVLVAQRALPTGTI 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           +T + + +  +PEE V D +  D      + +L G +VR P+  G+P+    LV  G+ G
Sbjct: 61  ITADAIGYQLWPEELVQDAYFLDGEA--DVSKLIGTVVRHPVTAGEPVTQGSLVSPGDRG 118

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK---PTVTVVLSNIRV 176
            L++ L  G RA T+ +   S V G + P D VD+V+ +++S           +L N+RV
Sbjct: 119 FLAAALTPGMRAITVPVDAKSGVAGFVFPGDRVDMVLTQAVSGEGQALKASETILRNLRV 178

Query: 177 IAIDH-----NIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS-- 229
           +A D       +D   +V    T TLE+TP  A+ +  AQ++  LSL LR +AD      
Sbjct: 179 LATDQSTTQTTVDGKTQVRAFRTVTLEVTPTIAEKVAVAQTLGTLSLALRPLADSQGELE 238

Query: 230 ---SSEDSDVWDVQEEGKEIQIIKAGVIVNKDGE 260
              +S D  + +     +E ++++       DG+
Sbjct: 239 RAIASGDLVIPEDATPEEEERMLREVAGRPDDGK 272


>gi|115361032|ref|YP_778169.1| Flp pilus assembly CpaB [Burkholderia ambifaria AMMD]
 gi|115286360|gb|ABI91835.1| Flp pilus assembly CpaB [Burkholderia ambifaria AMMD]
          Length = 281

 Score =  198 bits (504), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 69/241 (28%), Positives = 120/241 (49%), Gaps = 23/241 (9%)

Query: 1   MKLTR-LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK +R LM ++++ V  L A + A R +      +   +               DL +G 
Sbjct: 1   MKNSRALMMLIIAMVAGLAAVVFASRWLMHTSSSSVTSVAVA----------TTDLNLGE 50

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
            + PN +  V++P  +V  G   D       +EL+G +VR  + +G+P+   KL   G  
Sbjct: 51  PLGPNQIHMVSWPSGSVPTGAFADT------KELEGRVVRTSLARGEPVIESKLAPVGTK 104

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV----RSLSERKPTVTVVLSNI 174
           GGLS+++  G RA T+ ++    V G   P ++VDV++     +  ++ +    +VL +I
Sbjct: 105 GGLSAVIADGSRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQQGKTDGQSISKIVLEHI 164

Query: 175 RVIAIDHNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
            V+A+   +  D+    V +  TLE+TP QA+ L  A+SV  LSLVLR+  D    +++ 
Sbjct: 165 LVLAVAQQVSRDDTAPKVVNAVTLEVTPDQAERLDLARSVGTLSLVLRNQVDQKTLTTDG 224

Query: 234 S 234
           +
Sbjct: 225 A 225


>gi|170701162|ref|ZP_02892135.1| Flp pilus assembly protein CpaB [Burkholderia ambifaria IOP40-10]
 gi|170133943|gb|EDT02298.1| Flp pilus assembly protein CpaB [Burkholderia ambifaria IOP40-10]
          Length = 281

 Score =  198 bits (503), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 69/241 (28%), Positives = 120/241 (49%), Gaps = 23/241 (9%)

Query: 1   MKLTR-LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK +R LM ++++ V  L A + A R +      +   +               DL +G 
Sbjct: 1   MKNSRALMMLIIAMVAGLAAVVFASRWLMNTSSSSVTSVAVA----------TTDLNLGE 50

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
            + PN +  V++P  +V  G   D       +EL+G +VR  + +G+P+   KL   G  
Sbjct: 51  PLGPNQIHMVSWPSGSVPTGAFADT------KELEGRVVRTSLARGEPVIESKLAPVGTK 104

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV----RSLSERKPTVTVVLSNI 174
           GGLS+++  G RA T+ ++    V G   P ++VDV++     +  ++ +    +VL +I
Sbjct: 105 GGLSAVIADGSRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQQGKTDGQSISKIVLEHI 164

Query: 175 RVIAIDHNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
            V+A+   +  D+    V +  TLE+TP QA+ L  A+SV  LSLVLR+  D    +++ 
Sbjct: 165 LVLAVAQQVSRDDTAPKVVNAVTLEVTPDQAERLDLARSVGTLSLVLRNQVDQKTLTTDG 224

Query: 234 S 234
           +
Sbjct: 225 A 225


>gi|253996770|ref|YP_003048834.1| Flp pilus assembly protein CpaB [Methylotenera mobilis JLW8]
 gi|253983449|gb|ACT48307.1| Flp pilus assembly protein CpaB [Methylotenera mobilis JLW8]
          Length = 298

 Score =  198 bits (503), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 74/243 (30%), Positives = 121/243 (49%), Gaps = 24/243 (9%)

Query: 1   MK-LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK     + IVVS    L A ++A R +S                   V+++  ++ +G 
Sbjct: 1   MKNPRAFLMIVVSVGIGLGAVVLASRWISQQAATVASS---------KVVVAAINIDLGT 51

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-N 118
            +TP +L+   +P  +V  G  DD+      + LD  +V+  +L+G+P+   KL   G  
Sbjct: 52  PLTPQMLKVADWPRGSVPVGATDDI------KTLDARVVKTSLLQGEPVLESKLAPLGAT 105

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE------RKPTVTVVLS 172
           GGLS+++ +G RA T+ ++    V G   P ++VD+V+             K    +VL 
Sbjct: 106 GGLSAVIAEGNRAMTVRVNDVVGVAGFALPGNYVDIVVNTEDESVKAENVNKSISKIVLE 165

Query: 173 NIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSS 231
           +I V+A+    + DE +  V +  TLE+TP QA+ L  A+SV  LSLVLR+  D N  ++
Sbjct: 166 HIMVLAVAQEQNRDETKPKVVNAVTLEVTPAQAEKLDLARSVGTLSLVLRNQIDKNVVTT 225

Query: 232 EDS 234
           E S
Sbjct: 226 EGS 228


>gi|56477529|ref|YP_159118.1| pilus assembly transmembrane protein [Aromatoleum aromaticum EbN1]
 gi|56313572|emb|CAI08217.1| pilus assembly transmembrane protein [Aromatoleum aromaticum EbN1]
          Length = 283

 Score =  197 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 66/264 (25%), Positives = 119/264 (45%), Gaps = 30/264 (11%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK   +  ++V+ +  L A ++  R +            ++      + ++  +L +G  
Sbjct: 1   MKAKGMGFLLVAMLAGLAAVVLGTRWLQ----------AKSAGDGNRIAVAAVELQLGSR 50

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           + P  +  V +P  ++  G   D      + +LDG +    I  G+P+   +L   G  G
Sbjct: 51  IAPEAIRLVEWPSGSIPAGAFHD------LAKLDGRVAITGIQPGEPVLESRLAPEGTKG 104

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE------RKPTVTVVLSN 173
           GLS+++P+GKRA T+ ++    V G   P ++VD+++    +        +    +VL  
Sbjct: 105 GLSAVVPEGKRAITVRVNDVIGVAGFTLPGNYVDIMVNTENTGANRNSADQMISKIVLER 164

Query: 174 IRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSE 232
           I V+A+    + DE +  V +  TLE+TP QA+ L  A+SV  LSLVLR+  D N + + 
Sbjct: 165 ILVLAVAQEANRDETKPKVVNAVTLEVTPEQAERLDLARSVGNLSLVLRNQIDSNTTDTA 224

Query: 233 DSD------VWDVQEEGKEIQIIK 250
                      D        Q +K
Sbjct: 225 GITKAMLLRTPDDAPVTPAPQAVK 248


>gi|323137424|ref|ZP_08072502.1| Flp pilus assembly protein CpaB [Methylocystis sp. ATCC 49242]
 gi|322397411|gb|EFX99934.1| Flp pilus assembly protein CpaB [Methylocystis sp. ATCC 49242]
          Length = 267

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 81/245 (33%), Positives = 122/245 (49%), Gaps = 11/245 (4%)

Query: 22  IAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFI 81
             M   S    Q   V+   P     VL++  DL  G  +    + WV +P+ +V  G +
Sbjct: 20  FMMMNSSSPPPQAPVVVAPPPMNTEQVLVATRDLTYGTEIVDQDMAWVEWPKTSVPVGSL 79

Query: 82  DDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGL-SSLLPKGKRAATMDISISS 140
                PNA +E+    VR+PI  G+PIR ++L+     GL S++L  GKRA  +D+++++
Sbjct: 80  TKTESPNAQEEVKSSYVRIPIAGGEPIRKDRLIKGVTAGLMSTMLSPGKRAIAIDVTLNN 139

Query: 141 AVGGMIKPNDHVDVVMVRSLSERKP-------TVTVVLSNIRVIAIDHNIDSD--ERVLV 191
             GG I PND VDV+     +E             VVLSN+RV+A+   I+    E V+ 
Sbjct: 140 TAGGFILPNDRVDVLRTYRDTEATKDLGHEVYNSEVVLSNVRVLAMGQTIEKKGAEPVVT 199

Query: 192 GSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKA 251
           GSTATLEL P QA+ +V AQ   +L L LR I D   +    ++          + +++ 
Sbjct: 200 GSTATLELDPRQAELVVLAQRTGQLVLSLRPITDA-INKDAAAEAPADPGSDDSLTVVRH 258

Query: 252 GVIVN 256
           GV  N
Sbjct: 259 GVAAN 263


>gi|82703478|ref|YP_413044.1| Flp pilus assembly CpaB [Nitrosospira multiformis ATCC 25196]
 gi|82411543|gb|ABB75652.1| Flp pilus assembly CpaB [Nitrosospira multiformis ATCC 25196]
          Length = 261

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 68/234 (29%), Positives = 120/234 (51%), Gaps = 18/234 (7%)

Query: 8   GIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILE 67
            IV+S +  L A ++A R +          I         V+++  D+ VG  +TP++L+
Sbjct: 1   MIVISLLLGLAAVVVAGRWI----------IDRASVDAATVIVASRDIDVGTRLTPDMLQ 50

Query: 68  WVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLP 126
              +P   V +G   D         LD  +V+V +++G+P+   KL  +G  GGLS ++ 
Sbjct: 51  PSDWPRATVPEGSFQDAKL------LDTRVVKVNLVRGEPLLEAKLAPQGAAGGLSGVIA 104

Query: 127 KGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSD 186
           +GKRA T+ ++    + G   P ++VD+++       KP   +VL  I V+A+  ++  D
Sbjct: 105 EGKRAITVKVNEIVGLAGFALPGNNVDILVNAKDENDKPISKIVLERILVLAVGQDLGRD 164

Query: 187 E-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDV 239
           E +    +  TLE+TP +A+ L  A+S+  LSLVLR+  D +P ++      D+
Sbjct: 165 ETKPKAVTAVTLEVTPQEAEKLDLARSIGTLSLVLRNQIDKSPGTTAGVRTRDL 218


>gi|73542328|ref|YP_296848.1| Flp pilus assembly CpaB [Ralstonia eutropha JMP134]
 gi|72119741|gb|AAZ62004.1| Flp pilus assembly CpaB [Ralstonia eutropha JMP134]
          Length = 280

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 69/259 (26%), Positives = 129/259 (49%), Gaps = 26/259 (10%)

Query: 1   MKLTRLMGIVVSGVF-ALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK TR + +++  +   + A + A R +          + ++      V+++  DL +G 
Sbjct: 1   MKNTRAILMLLIALLAGVAAVVSASRWL----------MEQSSNSVKQVVVAANDLNLGQ 50

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
            +  + L  V +P  +V  G  +D      ++ L+G +VR  + +G+P+   KL   G  
Sbjct: 51  PLNGSQLRLVNWPTASVPPGAFED------LKLLEGRVVRTSLQRGEPVLDAKLAPIGTK 104

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS----ERKPTVTVVLSNI 174
           GGLS+++  GKRA T+ ++    V G   P ++VDV++  +      +      +VL  I
Sbjct: 105 GGLSAVINDGKRAITVRVNDVVGVAGFALPGNYVDVIVNTNEEAKTAQNGSISKIVLEKI 164

Query: 175 RVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRS---IADLNPSS 230
            V+A+   +  D+ +  V +  TLE+TP QA+ L  A+SV  LSLVLR+   +AD+N   
Sbjct: 165 LVLAVAQQVSRDDTQPKVVNAVTLEVTPDQAEKLDVARSVGTLSLVLRNQMDVADINTGG 224

Query: 231 SEDSDVWDVQEEGKEIQII 249
           +    +     E  +++++
Sbjct: 225 ATKGTLLGKAPEAPQVKVV 243


>gi|148557762|ref|YP_001265344.1| SAF domain-containing protein [Sphingomonas wittichii RW1]
 gi|148502952|gb|ABQ71206.1| SAF domain [Sphingomonas wittichii RW1]
          Length = 332

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 66/252 (26%), Positives = 117/252 (46%), Gaps = 14/252 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   +L+ ++++ V A ++ ++A  +   +                 V ++   L VG +
Sbjct: 1   MDARKLLLLIMALVMAGISAVVARSMFGGNSEAEAAPAAAPQPSGPEVAVAVRPLPVGTI 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           + P    +  +P E V   +   +   + +  L+G +VR  I  G P+    LV  G+ G
Sbjct: 61  IGPESFRYQRWPAELVSKTYF--IKGESDLAALNGSVVRYAITAGAPVTQGALVKPGDRG 118

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK-----PTVTVVLSNI 174
            L++ L  G RA T+ +S  S V G + P D VD+++ + +              ++ NI
Sbjct: 119 FLAAALGPGMRAVTISVSAQSGVAGFVFPGDRVDLMLTQEVPGGGDGPPLKAAETIIRNI 178

Query: 175 RVIAIDH----NIDSDERVLVGST--ATLELTPMQAKALVAAQSVAKLSLVLRSIADLNP 228
           RV+A D      +D + + +V +T   TLE TP  A+ +  AQ++ +LSL LRSIAD   
Sbjct: 179 RVLAADQRTDKTVDEEGKTVVANTSNVTLEATPKIAEKIAVAQTIGQLSLALRSIADDRA 238

Query: 229 SSSEDSDVWDVQ 240
              E     D++
Sbjct: 239 ELEERIANGDIK 250


>gi|172065272|ref|YP_001815984.1| Flp pilus assembly protein CpaB [Burkholderia ambifaria MC40-6]
 gi|171997514|gb|ACB68431.1| Flp pilus assembly protein CpaB [Burkholderia ambifaria MC40-6]
          Length = 281

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 68/241 (28%), Positives = 120/241 (49%), Gaps = 23/241 (9%)

Query: 1   MKLTR-LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK +R +M ++++ V  L A + A R +      +   +               DL +G 
Sbjct: 1   MKNSRAVMMLIIAMVAGLAAVVFASRWLMNTSSSSVTSVAVA----------TTDLNLGE 50

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
            + PN +  V++P  +V  G   D       +EL+G +VR  + +G+P+   KL   G  
Sbjct: 51  PLGPNQIHMVSWPSGSVPTGAFADT------KELEGRVVRTSLARGEPVIESKLAPVGTK 104

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV----RSLSERKPTVTVVLSNI 174
           GGLS+++  G RA T+ ++    V G   P ++VDV++     +  ++ +    +VL +I
Sbjct: 105 GGLSAVIADGSRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQQGKTDGQSISKIVLEHI 164

Query: 175 RVIAIDHNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
            V+A+   +  D+    V +  TLE+TP QA+ L  A+SV  LSLVLR+  D    +++ 
Sbjct: 165 LVLAVAQQVSRDDTAPKVVNAVTLEVTPDQAERLDLARSVGTLSLVLRNQVDQKTLTTDG 224

Query: 234 S 234
           +
Sbjct: 225 A 225


>gi|218710407|ref|YP_002418028.1| Flp pilus assembly protein CpaB [Vibrio splendidus LGP32]
 gi|218323426|emb|CAV19603.1| Flp pilus assembly protein CpaB [Vibrio splendidus LGP32]
          Length = 279

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 52/228 (22%), Positives = 102/228 (44%), Gaps = 11/228 (4%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVV 61
           K    +  ++S VF L A   A + +     Q +  +     +   V+++  ++  G ++
Sbjct: 33  KSQVFLLFLLSVVFGLAAVFFAKQWM---EDQVQPTVEVEAVERHPVVVASQEIEAGTII 89

Query: 62  TPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG- 120
               L       + + +    D        EL G +V   I  G+ +   +    G G  
Sbjct: 90  EEQFLATKLMEVDWINENNFSDAS------ELVGKVVANTIYAGEVLHKMRFTIPGEGST 143

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
           L++L+P+ KRA T+ +     V G + P + VD++   S S+       VL +I+V+A+D
Sbjct: 144 LAALIPENKRAVTIRVDDVIGVAGFLLPGNKVDILSTVSYSKNSAATRTVLKDIKVLAVD 203

Query: 181 HNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLN 227
               ++E   ++    TLE++P  A+ L+ A+S   + L LR+  ++ 
Sbjct: 204 QTAKTNENSPIIVRAVTLEVSPKDAEKLLTAKSKGSIQLTLRNPHEVE 251


>gi|292491518|ref|YP_003526957.1| Flp pilus assembly protein CpaB [Nitrosococcus halophilus Nc4]
 gi|291580113|gb|ADE14570.1| Flp pilus assembly protein CpaB [Nitrosococcus halophilus Nc4]
          Length = 265

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 60/261 (22%), Positives = 114/261 (43%), Gaps = 19/261 (7%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVV 61
           K   LM   ++ V    A  +A + +          +     +   V+++  ++  G  +
Sbjct: 3   KRKSLMLFFIAIVLGTGATWMANQWL--QDRMQPGPVEVVAPETAPVVVAALEIPFGQKI 60

Query: 62  TPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR-GNGG 120
               L+ +++P +N+ +G   +         ++G +    I  G+PI  ++ V++ G   
Sbjct: 61  ETMHLKVISWPADNMPEGIFHETS------AVEGRVASQKIYPGEPIMKDRAVEQLGGST 114

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVR--SLSERKPTVTVVLSNIRVIA 178
           LS+++P+ KRA T+ ++    V G + P + VDV+  R    S+ K  +  +L N++V+A
Sbjct: 115 LSAIVPRDKRAVTVRVNDVIGVAGFLLPGNQVDVLSSRKIDRSQNKVQIETILQNLKVLA 174

Query: 179 IDHNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNP-SSSEDSDV 236
           +D     D+   LV    TLE  P QA+ L  A     + LVLR+  D+      E   V
Sbjct: 175 VDQTASQDKNQPLVVRAVTLEADPKQAEKLFKATEEGTIQLVLRNPQDVAVIKDPEPVKV 234

Query: 237 WDV------QEEGKEIQIIKA 251
                    Q     + +I+ 
Sbjct: 235 AKKTYSKAPQPISDSVTVIRG 255


>gi|218671060|ref|ZP_03520731.1| Flp pilus assembly protein CpaB [Rhizobium etli GR56]
          Length = 214

 Score =  195 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 95/209 (45%), Positives = 133/209 (63%), Gaps = 6/209 (2%)

Query: 58  GMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG 117
           G  +  + + W+A+P++ V  GFI +  +P+A+++L G +VR+PI +G+PIR EK+ D  
Sbjct: 1   GARLGDDTVHWMAWPKDGVVQGFITEADKPDAIKDLQGAVVRLPIFEGEPIRPEKVADSS 60

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE-RKPTVTVVLSNIRV 176
           +  LSSLLP GKRA   +IS+++  GG I PND VDV+MVR  +E  K     VLSN+RV
Sbjct: 61  SRILSSLLPAGKRAVATEISVATGAGGFILPNDRVDVIMVRKGTEANKLITETVLSNVRV 120

Query: 177 IAIDHNI---DSDERVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSE 232
           +AID  I   D   + +VG+TATLELTP Q K L  AQ +A +LSL LRS+AD     + 
Sbjct: 121 LAIDQQIQEQDDGSKAVVGTTATLELTPDQTKVLAVAQQMADRLSLALRSVADAQEQDTS 180

Query: 233 DSDVWDVQEEGKE-IQIIKAGVIVNKDGE 260
            +D     + G   IQ+IK+G IV   GE
Sbjct: 181 AADYLLSGDNGSAIIQVIKSGSIVTDAGE 209


>gi|323529414|ref|YP_004231566.1| Flp pilus assembly protein CpaB [Burkholderia sp. CCGE1001]
 gi|323386416|gb|ADX58506.1| Flp pilus assembly protein CpaB [Burkholderia sp. CCGE1001]
          Length = 278

 Score =  195 bits (495), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 108/210 (51%), Gaps = 14/210 (6%)

Query: 33  QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQE 92
            +  ++  + +    V ++  ++++G  +  N++  V +P  +V  G   D       + 
Sbjct: 24  ASRWLLQTSSSAVTPVAVATAEVSLGQPLNANMIRTVNWPTASVPPGAFKDP------KA 77

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDH 151
           LDG +VR  +  G+P+   KL  +G  GGLS+++ +GKRA T+ ++    V G   P ++
Sbjct: 78  LDGRVVRTSLEPGEPVIESKLAPQGTKGGLSAVIGEGKRAITVRVNDVVGVAGFALPGNY 137

Query: 152 VDVVMVRSLSE------RKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQA 204
           VDV++     E      ++    +VL  I V+A+   +  D+ +  V +  TLE+TP QA
Sbjct: 138 VDVIVNTQEPESKTADPQQSISKIVLEKILVLAVAQQVSRDDTQPKVVNAVTLEVTPDQA 197

Query: 205 KALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           + L  A+SV  LSLVLR+  D  P  +  +
Sbjct: 198 EKLDLARSVGSLSLVLRNQIDDRPLPTGGA 227


>gi|264678239|ref|YP_003278146.1| pilus assembly transmembrane protein [Comamonas testosteroni CNB-2]
 gi|262208752|gb|ACY32850.1| pilus assembly transmembrane protein [Comamonas testosteroni CNB-2]
          Length = 281

 Score =  194 bits (494), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 66/195 (33%), Positives = 105/195 (53%), Gaps = 14/195 (7%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
            V+++  D+ +G  + PN+L  V +P  ++ DG   D      MQ+L   +V+V +L+G+
Sbjct: 38  KVVVAATDIPLGGKILPNMLNTVDWPRGSIPDGAFHD------MQQLQDRVVKVGVLRGE 91

Query: 107 PIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV------RS 159
            +   KL   G  GGL++++  GKRA T+ ++    V G   P ++VDVV+         
Sbjct: 92  AVLEGKLAPVGTKGGLAAVIAPGKRAMTVRVNDVVGVAGFALPGNYVDVVVNAQQEQNGK 151

Query: 160 LSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSL 218
             E +     VL N+ V+A+    D DE +  V S  TLEL+P  A+ L  A+SV  LSL
Sbjct: 152 TEESRQISKTVLENVLVLAVAQEADRDETKPKVVSAVTLELSPEDAEKLDLARSVGNLSL 211

Query: 219 VLRSIADLNPSSSED 233
           VLR+  D +P+S+  
Sbjct: 212 VLRNQIDKDPTSTAG 226


>gi|302381757|ref|YP_003817580.1| Flp pilus assembly protein CpaB [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192385|gb|ADK99956.1| Flp pilus assembly protein CpaB [Brevundimonas subvibrioides ATCC
           15264]
          Length = 310

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 85/303 (28%), Positives = 126/303 (41%), Gaps = 50/303 (16%)

Query: 1   MKLTRLMGIVVSGVFALVAGII--AMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVG 58
           MK  R+  I ++ V A+    +  AM   S                   VL++  DLA G
Sbjct: 1   MKPARIAVICIAAVSAIGLAFVVRAMGSPSGEPTAVATAAPAPTRPMAKVLVAARDLAPG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQP------------------------------- 87
             +    LEW  +P + V   FI D   P                               
Sbjct: 61  QRLVEADLEWKDWPVDEVNPAFITDGSVPVPAAAAPEGEAAPATTDTTAESAVARVTRAA 120

Query: 88  ------NAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISS 140
                  A  +  G +VR PIL G+PI   K+V  G+ G +++ L  G RA  + +S+ S
Sbjct: 121 NDLTTGGAKADYFGSVVREPILAGEPIVGRKIVRAGDSGYMAAYLEPGMRAMAIGVSVES 180

Query: 141 AVGGMIKPNDHVDVVMVR--------SLSERKPTVTVVLSNIRVIAIDH--NIDSDERVL 190
           A GG I P D VDV++               K    +V+ N++V+AID       D++ +
Sbjct: 181 AAGGFILPGDRVDVIVTVEQQAGNDDDAGRAKFASRIVMQNVKVLAIDQSTRAGDDQQAV 240

Query: 191 VGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIK 250
           VG+TATLE+ P  A+ +  A++   LSLVLRS AD +  S   S      E    I++ +
Sbjct: 241 VGATATLEVAPQDAEVVALAKAAGTLSLVLRSYADTSGPSGRVSMPPRASERSTAIRVFR 300

Query: 251 AGV 253
            G 
Sbjct: 301 GGE 303


>gi|89899602|ref|YP_522073.1| Flp pilus assembly CpaB [Rhodoferax ferrireducens T118]
 gi|89344339|gb|ABD68542.1| Flp pilus assembly CpaB [Rhodoferax ferrireducens T118]
          Length = 286

 Score =  193 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 59/242 (24%), Positives = 110/242 (45%), Gaps = 25/242 (10%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+   ++ + ++ +  L A  +A R +                +   + ++  D+ +G  
Sbjct: 1   MRSRGILMLFIAVIAGLAAVFLATRWMQGQG-----------GEGGRIAVANTDIELGGR 49

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           ++P ++    +P  +   G   +        +L+G +V V + +G+P+   +L   G  G
Sbjct: 50  ISPEMIRMADWPLGSTPTGAYKEAA------KLEGRVVLVSMQRGEPLIEARLAPIGTKG 103

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK------PTVTVVLSN 173
           GLS+++P+GKRA T+ ++    V G   P   VDV++       +          +VL  
Sbjct: 104 GLSAVVPQGKRAMTVRVNDVVGVAGFALPGTFVDVMVNTQDEGGQRNDRDRSVSKIVLER 163

Query: 174 IRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSE 232
           I V+A+    D D  +  V +  TLE+TP  A+ L  A+SV  LSLVLR+  D    ++ 
Sbjct: 164 ILVLAVAQEADRDSTKPRVVNAVTLEVTPRDAEMLDLARSVGTLSLVLRNQTDPKGVAAT 223

Query: 233 DS 234
             
Sbjct: 224 GG 225


>gi|85707703|ref|ZP_01038769.1| pilus assembly protein CpaB [Erythrobacter sp. NAP1]
 gi|85689237|gb|EAQ29240.1| pilus assembly protein CpaB [Erythrobacter sp. NAP1]
          Length = 365

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 79/273 (28%), Positives = 135/273 (49%), Gaps = 19/273 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   +L+ ++ + V A+ +  +A  + +     T +   E       VL++   L  G +
Sbjct: 1   MDRKKLVLLLGALVVAIGSAFLARSMFAGDPAPTAQAAPEPTGP--KVLVANRALPAGTI 58

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           +T + + +  +PEE V D +   +   + M +L G +VR P+  G+P+    LV  G+ G
Sbjct: 59  ITADAMGYQMWPEELVQDAYF--IEGESDMSQLLGTVVRFPVTAGEPVTQGSLVSPGDRG 116

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK---PTVTVVLSNIRV 176
            L++ L  G RA T+ +S  + V G + P D VDVV+ +++S           VL N+RV
Sbjct: 117 FLAAALGPGMRAVTVPVSAKTGVAGFVFPGDRVDVVLTQTVSGEGRPLNAAETVLRNLRV 176

Query: 177 IAIDHNIDS---DERVLVG---STATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS- 229
           +A D   +    DE   V     T TLE+TP  A+ +  AQ++ +L+LVLRSIAD     
Sbjct: 177 LATDQTTEQVTNDEGKTVVRAFRTVTLEVTPQIAEKVAVAQTIGQLTLVLRSIADNQAEL 236

Query: 230 ----SSEDSDVWDVQEEGKEIQIIKAGVIVNKD 258
               +S D ++ D     +E +I++  +    D
Sbjct: 237 ERAIASGDLEIPDDATPEEEERILRTAMGQPVD 269


>gi|16263309|ref|NP_436102.1| CpaB2 pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|14523988|gb|AAK65514.1| CpaB2 pilus assembly protein [Sinorhizobium meliloti 1021]
          Length = 263

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 81/256 (31%), Positives = 125/256 (48%), Gaps = 18/256 (7%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
           + R++ ++++      A  +A   +     +  EV          VL++  +L  G V+ 
Sbjct: 1   MIRIVILLLALASGGAASWLA---LGTGDQRAVEVAEVQETPSQEVLVAAAELKRGAVIE 57

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLS 122
            N L W  + E  +   FI    +P+A   L G L     + G+PIR +KL   G G LS
Sbjct: 58  ENQLRWQPW-EGEIPPVFISRSSRPDATTALKGSLALSGFVAGEPIRDDKLAQGGTGYLS 116

Query: 123 SLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVR-----SLSERKPTVTVVLSNIRVI 177
           SLLP GKRA  + ++  S  GG I PNDHVDV+        S    K     +LSNIRV+
Sbjct: 117 SLLPSGKRAIAVRVTAESTAGGFILPNDHVDVIHTVARPDASGDAGKVVSRAILSNIRVL 176

Query: 178 AIDHNIDS--DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
           A+D  +    D   ++G TATLE+ P Q  A+ AA++   +SL LR+I D + +S  ++ 
Sbjct: 177 AVDQTVSQASDGASVIGKTATLEVDPEQISAVAAAEASGTVSLALRAITDNHEASVVEA- 235

Query: 236 VWDVQEEGKEIQIIKA 251
                 EG    +++ 
Sbjct: 236 ------EGTRPGVVRF 245


>gi|167924331|ref|ZP_02511422.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           BCC215]
          Length = 281

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 68/240 (28%), Positives = 115/240 (47%), Gaps = 21/240 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK +R   ++   + A +A +      S   VQT             V ++  D+++G  
Sbjct: 1   MKNSRAFTMLAIAILAGLAAV---AFASRWLVQTSSSA------VTPVAVAATDVSLGEP 51

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           + PN L  V +P  +V  G   D+        L+G +VR  + +G+P+   KL   G  G
Sbjct: 52  LGPNQLRIVNWPTASVPPGAFTDLKP------LEGRVVRTSLARGEPVLGTKLAPVGTKG 105

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE----RKPTVTVVLSNIR 175
           GLS+++  G RA T+ ++    V G   P ++VDV++          ++    +VL  I 
Sbjct: 106 GLSAVIAPGHRAITVRVNDVVGVAGFALPGNYVDVIVNTQEQSKADPQQSISKIVLEKIL 165

Query: 176 VIAIDHNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           V+A+   +  D+    V +  TLE++P QA+ L  A+SV  LSLVLR+  D +  S+  +
Sbjct: 166 VLAVAQQVSRDDTAPKVVNAVTLEVSPEQAEKLDLARSVGTLSLVLRNQIDKDALSTGGA 225


>gi|299532591|ref|ZP_07045980.1| pilus assembly transmembrane protein [Comamonas testosteroni S44]
 gi|298719394|gb|EFI60362.1| pilus assembly transmembrane protein [Comamonas testosteroni S44]
          Length = 281

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 66/208 (31%), Positives = 108/208 (51%), Gaps = 14/208 (6%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
            V+++  D+ +G  + PN+L  V +P  ++ DG   D      MQ+L   +V+V +L+G+
Sbjct: 38  KVVVAATDIPLGGKILPNMLNTVDWPRGSIPDGAFHD------MQQLQDRVVKVGVLRGE 91

Query: 107 PIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV------RS 159
            +   KL   G  GGL++++  GKRA T+ ++    V G   P ++VDVV+         
Sbjct: 92  AVLEGKLAPVGTKGGLAAVIAPGKRAMTVRVNDVVGVAGFALPGNYVDVVVNAQQEQNGK 151

Query: 160 LSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSL 218
             E +     VL N+ V+A+    D DE +  V S  TLEL+P  A+ L  A+SV  LSL
Sbjct: 152 TEESRQISKTVLENVLVLAVAQEADRDETKPKVVSAVTLELSPEDAEKLDLARSVGNLSL 211

Query: 219 VLRSIADLNPSSSEDSDVWDVQEEGKEI 246
           VLR+  D +P+S+       +    + +
Sbjct: 212 VLRNQIDKDPTSTAGITKHQLFGTPEPV 239


>gi|307726374|ref|YP_003909587.1| Flp pilus assembly protein CpaB [Burkholderia sp. CCGE1003]
 gi|307586899|gb|ADN60296.1| Flp pilus assembly protein CpaB [Burkholderia sp. CCGE1003]
          Length = 278

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 61/209 (29%), Positives = 106/209 (50%), Gaps = 14/209 (6%)

Query: 34  TEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQEL 93
           +  ++  + +    V +   ++++G  +  N++  V +P  +V  G   D       + L
Sbjct: 25  SRWLLQTSSSAVTPVAVVTAEVSLGQPLNANMIRTVNWPTASVPPGAFKDP------KAL 78

Query: 94  DGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHV 152
           DG +VR  +  G+P+   KL  +G  GGLS+++ +GKRA T+ ++    V G   P ++V
Sbjct: 79  DGRVVRTSLEPGEPVIESKLAPQGTKGGLSAVIGEGKRAITVRVNDVVGVAGFALPGNYV 138

Query: 153 DVVMVRSLSERK------PTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAK 205
           DV++     E K          +VL  I V+A+   +  D+ +  V +  TLE+TP QA+
Sbjct: 139 DVIVNTQEPEAKTADPQHSISKIVLEKILVLAVAQQVSRDDTQPKVVNAVTLEVTPDQAE 198

Query: 206 ALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
            L  A+SV  LSLVLR+  D  P  +  +
Sbjct: 199 KLDLARSVGSLSLVLRNQIDDRPLPTGGA 227


>gi|187927688|ref|YP_001898175.1| Flp pilus assembly protein CpaB [Ralstonia pickettii 12J]
 gi|187724578|gb|ACD25743.1| Flp pilus assembly protein CpaB [Ralstonia pickettii 12J]
          Length = 283

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 69/261 (26%), Positives = 126/261 (48%), Gaps = 28/261 (10%)

Query: 1   MKLTR-LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK  R ++ ++V+ V  + A + A R +S           ++ +    V+++  D+ +G 
Sbjct: 1   MKNARAIVMLIVALVAGIAAVVSASRWLSQ----------QSTSSVKQVVVAASDMDLGQ 50

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
            +    L  V++P  ++  G  DD       + L G +VR  + KG+PI   KL   G  
Sbjct: 51  PLGNEQLRTVSWPAGSLPPGTFDDP------KALQGRVVRASLQKGEPILENKLAPIGTK 104

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTV------VLS 172
           GGLS+++ +GKRA T+ ++    V G   P + VDV++  +   +  +         VL 
Sbjct: 105 GGLSAVIAEGKRAITVRVNDVVGVAGFALPGNLVDVIVNTNEDAKSASNNNNSISKIVLE 164

Query: 173 NIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSS 231
            I V+A+   +  D+ +  V +  TLE+TP QA+ L  A+SV  LSLVLR+  D+  +++
Sbjct: 165 KILVLAVAQQVSRDDTQPKVVNAVTLEVTPDQAEKLDVARSVGTLSLVLRNQVDVAATAT 224

Query: 232 EDS---DVWDVQEEGKEIQII 249
             +    +          +++
Sbjct: 225 GGATKGTLLGTPAAEPAPKVV 245


>gi|53723206|ref|YP_112191.1| pilus assembly-related, exported protein [Burkholderia pseudomallei
           K96243]
 gi|76817358|ref|YP_336468.1| pilus assembly transmembrane protein [Burkholderia pseudomallei
           1710b]
 gi|126444606|ref|YP_001064075.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           668]
 gi|126455786|ref|YP_001076988.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1106a]
 gi|167829714|ref|ZP_02461185.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei 9]
 gi|167899812|ref|ZP_02487213.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           7894]
 gi|167916475|ref|ZP_02503566.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           112]
 gi|217424287|ref|ZP_03455786.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           576]
 gi|226194084|ref|ZP_03789685.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           Pakistan 9]
 gi|237507313|ref|ZP_04520028.1| Flp pilus assembly protein CpaB [Burkholderia pseudomallei MSHR346]
 gi|242313081|ref|ZP_04812098.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1106b]
 gi|254182584|ref|ZP_04889178.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1655]
 gi|254187135|ref|ZP_04893650.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254262844|ref|ZP_04953709.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1710a]
 gi|254296484|ref|ZP_04963940.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           406e]
 gi|52213620|emb|CAH39674.1| putative pilus assembly-related, exported protein [Burkholderia
           pseudomallei K96243]
 gi|76581831|gb|ABA51305.1| pilus assembly transmembrane protein [Burkholderia pseudomallei
           1710b]
 gi|126224097|gb|ABN87602.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           668]
 gi|126229554|gb|ABN92967.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1106a]
 gi|157806446|gb|EDO83616.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           406e]
 gi|157934818|gb|EDO90488.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           Pasteur 52237]
 gi|184213119|gb|EDU10162.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1655]
 gi|217392752|gb|EEC32775.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           576]
 gi|225934029|gb|EEH30015.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           Pakistan 9]
 gi|234999518|gb|EEP48942.1| Flp pilus assembly protein CpaB [Burkholderia pseudomallei MSHR346]
 gi|242136320|gb|EES22723.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1106b]
 gi|254213846|gb|EET03231.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1710a]
          Length = 281

 Score =  192 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 59/208 (28%), Positives = 105/208 (50%), Gaps = 12/208 (5%)

Query: 33  QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQE 92
            +  ++  + +    V ++  D+++G  + PN L  V +P  +V  G   D+        
Sbjct: 24  ASRWLVQTSSSAVTPVAVAATDVSLGEPLGPNQLRIVNWPTASVPPGAFTDLKP------ 77

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDH 151
           L+G +VR  + +G+P+   KL   G  GGLS+++  G RA T+ ++    V G   P ++
Sbjct: 78  LEGRVVRTSLARGEPVLGTKLAPVGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNY 137

Query: 152 VDVVMVRSLSE----RKPTVTVVLSNIRVIAIDHNIDSDER-VLVGSTATLELTPMQAKA 206
           VDV++          ++    +VL  I V+A+   +  D+    V +  TLE++P QA+ 
Sbjct: 138 VDVIVNTQEQSKADPQQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVSPEQAEK 197

Query: 207 LVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           L  A+SV  LSLVLR+  D +  S+  +
Sbjct: 198 LDLARSVGTLSLVLRNQVDKDALSTGGA 225


>gi|77919344|ref|YP_357159.1| Flp pilus assembly protein CpaB [Pelobacter carbinolicus DSM 2380]
 gi|77545427|gb|ABA88989.1| Flp pilus assembly protein CpaB [Pelobacter carbinolicus DSM 2380]
          Length = 272

 Score =  192 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 58/237 (24%), Positives = 106/237 (44%), Gaps = 9/237 (3%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVV 61
           K   ++ + ++ +F ++A I+  R +S   V  E            ++++  D+ +G  +
Sbjct: 3   KYGTIIALALAVIFGVIAVILVNRWLS-SKVSQEATTPRESIAMTEIVVAAADVNIGTRL 61

Query: 62  TPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-G 120
              +L    +P+ +V  G  +D+      +++ G +    ++ G PI   +L    +G G
Sbjct: 62  DQTLLAMAQWPKASVPKGAFEDI------EQVVGRVSVSKMVTGTPILAAELAAPNSGAG 115

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
           L +L+  G RA  + ++    VGG I PN  VD++ +   S+R       L  + V+AI 
Sbjct: 116 LVALIKPGMRAMAIKVNEVVGVGGFILPNTFVDIISLDERSKRTKVADTFLHKVEVLAIA 175

Query: 181 HNID-SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDV 236
                 + +  V  T TLELTP  A+ LV       + LVLR+  D   +      V
Sbjct: 176 QETFIEEGKPKVVRTVTLELTPEDAEKLVEKTHEGPIQLVLRNPLDEKETPPPPKKV 232


>gi|241662166|ref|YP_002980526.1| Flp pilus assembly protein CpaB [Ralstonia pickettii 12D]
 gi|309780761|ref|ZP_07675502.1| Flp pilus assembly protein CpaB [Ralstonia sp. 5_7_47FAA]
 gi|240864193|gb|ACS61854.1| Flp pilus assembly protein CpaB [Ralstonia pickettii 12D]
 gi|308920443|gb|EFP66099.1| Flp pilus assembly protein CpaB [Ralstonia sp. 5_7_47FAA]
          Length = 283

 Score =  192 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 58/213 (27%), Positives = 108/213 (50%), Gaps = 18/213 (8%)

Query: 34  TEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQEL 93
           +  +  ++ +    + ++  D+ +G  ++P  ++ V +P  ++  G I+D H       L
Sbjct: 25  SRWLTQQSGSGITKIAVAATDIDLGQRLSPEAIKLVDWPASSLPPGAINDPH------AL 78

Query: 94  DGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHV 152
           DG +VR  + +G+P+   KL   G  GGLS+++ +GKRA T+ ++    V G   P  +V
Sbjct: 79  DGRVVRASLTRGEPVLDSKLTPVGTAGGLSAVIAEGKRAITVRVNDVVGVAGFALPGSYV 138

Query: 153 DVVMVRSLSER----------KPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTP 201
           D+++      R          +    +VL  I V+A+   ++ D+ +  V +  TLE+TP
Sbjct: 139 DIIVNTQQDSREAKPGADRNDQSISKIVLEKILVLAVAQEVNRDDTKPKVVNAVTLEVTP 198

Query: 202 MQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
            QA+ +  A+SV  LSLVLR+  D     +  +
Sbjct: 199 EQAEKIDLARSVGNLSLVLRNQVDSQHDVTAGA 231


>gi|254192395|ref|ZP_04898834.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           S13]
 gi|169649153|gb|EDS81846.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           S13]
          Length = 281

 Score =  192 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 59/208 (28%), Positives = 105/208 (50%), Gaps = 12/208 (5%)

Query: 33  QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQE 92
            +  ++  + +    V ++  D+++G  + PN L  V +P  +V  G   D+        
Sbjct: 24  ASRWLVQTSSSAVTPVAVAATDVSLGEPLGPNQLRIVNWPTASVPPGAFTDLKP------ 77

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDH 151
           L+G +VR  + +G+P+   KL   G  GGLS+++  G RA T+ ++    V G   P ++
Sbjct: 78  LEGRVVRTSLARGEPVLGTKLAPVGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNY 137

Query: 152 VDVVMVRSLSE----RKPTVTVVLSNIRVIAIDHNIDSDER-VLVGSTATLELTPMQAKA 206
           VDV++          ++    +VL  I V+A+   +  D+    V +  TLE++P QA+ 
Sbjct: 138 VDVIVNTQEQSKADPQQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVSPEQAEK 197

Query: 207 LVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           L  A+SV  LSLVLR+  D +  S+  +
Sbjct: 198 LDLARSVGTLSLVLRNQVDKDTLSTGGA 225


>gi|86147468|ref|ZP_01065780.1| Flp pilus assembly protein CpaB [Vibrio sp. MED222]
 gi|85834761|gb|EAQ52907.1| Flp pilus assembly protein CpaB [Vibrio sp. MED222]
          Length = 249

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 54/228 (23%), Positives = 102/228 (44%), Gaps = 11/228 (4%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVV 61
           K    +  ++S VF L A   A + +     Q +  I     +   V+++  ++  G V+
Sbjct: 3   KSQVFLLFLLSVVFGLAAVFFAKQWMDN---QVQPTIEVEEVERHPVVVASQEIEAGTVI 59

Query: 62  TPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG- 120
               L       + + +    D +      EL G +V   I  G+ +   +    G G  
Sbjct: 60  EDQYLTTKLMEVDWINENNYSDQN------ELIGKVVANTIYAGEVLHKLRFTVPGEGST 113

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
           L++L+P+ KRA T+ +     V G + P + VD++   S  +       VL +I+V+A+D
Sbjct: 114 LAALIPENKRAVTIRVDDVIGVAGFLLPGNKVDILNTVSYGKNSAATRTVLKDIKVLAVD 173

Query: 181 HNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLN 227
               + E   ++    TLE+TP  A+ L+ A+S   + L LR+  +++
Sbjct: 174 QTARTKENSPIIVRAVTLEVTPKDAEKLLTAKSKGSIQLTLRNPHEVD 221


>gi|254418623|ref|ZP_05032347.1| Flp pilus assembly protein CpaB [Brevundimonas sp. BAL3]
 gi|196184800|gb|EDX79776.1| Flp pilus assembly protein CpaB [Brevundimonas sp. BAL3]
          Length = 305

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 79/298 (26%), Positives = 123/298 (41%), Gaps = 45/298 (15%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  R+  I ++ V AL   ++   + +                   +L++  +L  G  
Sbjct: 1   MKPARIAVICIAAVSALGLALVVRAMGNGEPAAPAAAAPVETRPMAKILVAAKNLEPGKR 60

Query: 61  VTPNILEWVAFPEENVFDGFIDD-------------------------------VHQPNA 89
           +    L W  +P + V   FI D                               +  P A
Sbjct: 61  LAEADLAWKDWPVDEVNPAFITDGSTPIPAKPAPEGAGEKAGAAVERVAEAAGQMAGPGA 120

Query: 90  MQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKP 148
             +  G +VR PIL G+PI   K+V  G+ G L++ L  G RA  + +++ SA GG I P
Sbjct: 121 KSDYIGSVVREPILAGEPIVGRKIVRAGDSGYLAAYLEPGMRAMAIAVTVESAAGGFILP 180

Query: 149 NDHVDVVMVRS-----------LSERKPTVTVVLSNIRVIAIDH--NIDSDERVLVGSTA 195
            D VDVV+               +  K +   V+ N++V+AID       D + +VG+TA
Sbjct: 181 GDRVDVVLTVQNEGGGSAVEGGGATAKYSSATVMQNVKVLAIDQSTRAGDDAQAVVGATA 240

Query: 196 TLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAGV 253
           TLE+ P  A  L  A+S  +LSL LRS AD    S        V    + +++ + G 
Sbjct: 241 TLEVRPQDAVLLAQAKSEGELSLSLRSYADTAGPSGATRAPRAVASASRSVRVYRGGE 298


>gi|154250688|ref|YP_001411512.1| SAF domain-containing protein [Parvibaculum lavamentivorans DS-1]
 gi|154154638|gb|ABS61855.1| SAF domain protein [Parvibaculum lavamentivorans DS-1]
          Length = 250

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 85/259 (32%), Positives = 139/259 (53%), Gaps = 16/259 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   R+  +V++ V A +A ++A  LVS +    E+ + E P     VL++  +L +G  
Sbjct: 1   MNPVRIGVLVLALVAAGLAALLARGLVSGNDEPVEQKVVEAP--TTEVLVASSNLQLGQR 58

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD-RGNG 119
           +    L W  +P+ ++   +I     P A++E  G + R  +L G+P+  EKLV   G G
Sbjct: 59  IGGGDLRWQRWPDTSLNGAYITRNQSPAALEEYTGSVARASLLSGEPVTSEKLVTLTGAG 118

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAI 179
            +S+L+  G RA  + I+  ++ GG I PND VD+V +            +L NIRV+AI
Sbjct: 119 FMSALIEPGMRATAISITPETSAGGFILPNDRVDIVDLAKGQ-------TILRNIRVLAI 171

Query: 180 DHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVW 237
           D   D    E+V VG TATLELTP Q + +  A++  ++ L LRS+A+ + + SE +   
Sbjct: 172 DQRFDEKAGEQVAVGRTATLELTPAQVEVVSVAEAEGRIGLSLRSMAEQDLAGSEKT--- 228

Query: 238 DVQEEGKEIQIIKAGVIVN 256
            V E G  +++++ G   N
Sbjct: 229 -VAEGGSVVKVVRYGTAQN 246


>gi|167744174|ref|ZP_02416948.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei 14]
          Length = 281

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 59/208 (28%), Positives = 105/208 (50%), Gaps = 12/208 (5%)

Query: 33  QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQE 92
            +  ++  + +    V ++  D+++G  + PN L  V +P  +V  G   D+        
Sbjct: 24  ASRWLVQTSSSAVTPVAVAATDVSLGEPLGPNQLRIVNWPTASVPPGAFTDLKP------ 77

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDH 151
           L+G +VR  + +G+P+   KL   G  GGLS+++  G RA T+ ++    V G   P ++
Sbjct: 78  LEGRVVRTSLARGEPVLGTKLAPVGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNY 137

Query: 152 VDVVMVRSLSE----RKPTVTVVLSNIRVIAIDHNIDSDER-VLVGSTATLELTPMQAKA 206
           VDV++          ++    +VL  I V+A+   +  D+    V +  TLE++P QA+ 
Sbjct: 138 VDVIVNTQEQSKADPQQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVSPEQAEK 197

Query: 207 LVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           L  A+SV  LSLVLR+  D +  S+  +
Sbjct: 198 LDLARSVGTLSLVLRNQVDKDALSTGGA 225


>gi|220923695|ref|YP_002498997.1| Flp pilus assembly protein CpaB [Methylobacterium nodulans ORS
           2060]
 gi|219948302|gb|ACL58694.1| Flp pilus assembly protein CpaB [Methylobacterium nodulans ORS
           2060]
          Length = 264

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 75/263 (28%), Positives = 126/263 (47%), Gaps = 20/263 (7%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
           + RL  ++V+    + A  +A+ L          V         +VL+   +LA G  +T
Sbjct: 1   MLRLCLLIVALGAGIAAAWLAVSL--RDQPVAAVVPAPVQPATQDVLVVSTELAQGERLT 58

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLS 122
              + W  +PE  +   ++    +P A+ E  G  +R  +  G+P++  KL     G L+
Sbjct: 59  KENMRWQPWPESALNSAYVTRSARPAALDEFAGSTLRSRMAPGEPVQDGKLAGLNAGFLA 118

Query: 123 SLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV-----RSLSERKPTVTVVLSNIRVI 177
           ++LP GKRA  + IS  +  GG I P+D VDV+       +    R+     +L N+ V+
Sbjct: 119 TVLPSGKRAVAVRISAENTAGGFILPSDRVDVIHTFAPQAQGEGAREHRSRTILKNVPVL 178

Query: 178 AIDHNIDSDERV--------LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
           AID  +D  ++         ++G TATLEL   QA+ L AA++   LSL LRS AD N  
Sbjct: 179 AIDQTVDEAQKADKGKGKSVVIGKTATLELDSRQAEILAAAEAAGTLSLSLRSAADSNEV 238

Query: 230 SSEDSDVWDVQEEGKEIQIIKAG 252
            +  ++     E  + +++I+ G
Sbjct: 239 PTAATE-----ERIQTVRVIRGG 256


>gi|163738371|ref|ZP_02145786.1| CpaB family protein [Phaeobacter gallaeciensis BS107]
 gi|161388292|gb|EDQ12646.1| CpaB family protein [Phaeobacter gallaeciensis BS107]
          Length = 286

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 112/247 (45%), Gaps = 14/247 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVS--PHHVQTEEVITENPAKFINVLISKGDLAVG 58
           M+    + ++V    A  A ++A   ++   + +  E          ++V I+   L  G
Sbjct: 1   MRAVFGLVLIVGVALAGGAVMMAKNYITAYQNELARERASRGENIPLVDVFIANDQLKYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFI---DDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD 115
             +T + +  V +PE  + +G     D +  P    +L   +V   + K + I   K+  
Sbjct: 61  ERLTRDSVRSVRWPENAIPEGAFLTMDALFPPQYPDDL--RVVLRRMEKDEAILAVKVTK 118

Query: 116 RG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER-----KPTVTV 169
            G + G++S L KG RA  + + +SS V G ++P DHVDV    SL+++          +
Sbjct: 119 PGEDAGITSRLAKGMRAFAIRVDVSSGVSGFLRPGDHVDVYWTGSLNDQNGGRNGEFTRL 178

Query: 170 VLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNP 228
           + +NI +IA+D     D +  ++  T T  + P Q  AL  AQS  +LSL L    D   
Sbjct: 179 IQTNIELIAVDQTAGGDLDGAVIARTVTAAVRPEQVAALAQAQSTGRLSLSLVGAGDDTV 238

Query: 229 SSSEDSD 235
           +S  + D
Sbjct: 239 ASVIEVD 245


>gi|303248301|ref|ZP_07334563.1| Flp pilus assembly protein CpaB [Desulfovibrio fructosovorans JJ]
 gi|302490326|gb|EFL50238.1| Flp pilus assembly protein CpaB [Desulfovibrio fructosovorans JJ]
          Length = 304

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 65/251 (25%), Positives = 116/251 (46%), Gaps = 16/251 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK   +  ++++ + A+ AG++ +R +       +    +  AK ++VL++   +  G  
Sbjct: 1   MKSKAIPHMILAVILAVAAGVLTIRWLGSVRGPGQAQRPKVEAKKVDVLVAARAIPKGAR 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG--N 118
           +   +L    +  E V  G +       A+ E +G +    I K DPI  +KL+ +G   
Sbjct: 61  LDAAMLRLKPYEAEAVPGGALR------AVAEAEGRVAARDISKDDPITPDKLMAKGVTR 114

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV--RSLSERKPTVTVVLSNIRV 176
           GGL + +  GKRA T+  +     GG++ P   VDVV+   R   + +    V+L NI V
Sbjct: 115 GGLDAAVAPGKRAVTVKGTKVMGSGGLVTPGSRVDVVVTYSRPGKQEEKVSKVILENIPV 174

Query: 177 IAIDHNIDS----DERVLVGST--ATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           +A    ++     D R  + ST   TL +TP +A+ L  A  +  + + LR   D +   
Sbjct: 175 LATGTELEPRIGKDGREELASTDSFTLMVTPEEAERLALAADLGSMHMALRKPGDDDVVK 234

Query: 231 SEDSDVWDVQE 241
           +  +DV    E
Sbjct: 235 TPGADVAGSLE 245


>gi|300692330|ref|YP_003753325.1| pilus assembly (cpaB), transmembrane protein [Ralstonia
           solanacearum PSI07]
 gi|299079390|emb|CBJ52061.1| Putative pilus assembly (cpaB), transmembrane protein [Ralstonia
           solanacearum PSI07]
          Length = 284

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 67/248 (27%), Positives = 123/248 (49%), Gaps = 30/248 (12%)

Query: 1   MKLTRLMGIVVSGVFALVAGII-AMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK  R+  +++    A +A ++ A R +          + ++ +    V ++  D+ +G 
Sbjct: 1   MKNLRIFSMLLIAAIAGLAAVMFASRWL----------MQQSASGITKVAVASADVELGQ 50

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
            ++P +++ V +P  ++  G + D H       LDG +V+  + +G+P+   KL   G  
Sbjct: 51  RLSPEMVKLVDWPAASLPPGVVTDAH------ALDGRVVKASLTRGEPVLESKLTPVGTA 104

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK-----------PTV 167
           GGLS+++  GKRA T+ ++    V G   P  +VDV++     E++              
Sbjct: 105 GGLSAVIADGKRAITVRVNDVVGVAGFALPGSYVDVIVNTMEDEKQAKAAGNDQKEHSIS 164

Query: 168 TVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADL 226
            +VL  I V+A+   +  D+ +  V +  TLE+TP QA+ L  A+SV  LSLVLR+ AD 
Sbjct: 165 KIVLEKILVLAVAQEVGRDDTKPKVVNAVTLEVTPDQAEKLDLARSVGTLSLVLRNQADP 224

Query: 227 NPSSSEDS 234
             + +  +
Sbjct: 225 RAADTTGA 232


>gi|157961833|ref|YP_001501867.1| SAF domain-containing protein [Shewanella pealeana ATCC 700345]
 gi|157846833|gb|ABV87332.1| SAF domain protein [Shewanella pealeana ATCC 700345]
          Length = 272

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 61/244 (25%), Positives = 118/244 (48%), Gaps = 16/244 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M    ++ +++S VF + A  +A   +  +        TE  A   NV+    ++ +G +
Sbjct: 1   MNNKTVLFVILSLVFGVTAVYLAQNWLKTNTK------TEAVASTSNVMTMVTEVPLGTI 54

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +    L      +  + +G I D+       E +G +V+  + +G+ +R E++  +G G 
Sbjct: 55  IERKHLALTPVADNLIPEGAITDI------TEAEGFVVKHRLYQGEVLRKERITPKGEGS 108

Query: 121 -LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAI 179
            L+SL+    RA T+ ++    V G + P + VD++ + +    K    +VLSN++++AI
Sbjct: 109 TLASLITPTMRAVTIRVNDVVGVAGFLLPGNRVDIINIFTTPSLK--TDIVLSNVKILAI 166

Query: 180 DHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWD 238
           D    +DE + ++    TLEL+  QA+ L+ A+S   L L LR+  D       D +  +
Sbjct: 167 DQKASNDENKPVLVRAVTLELSLEQAETLMIAKSRGSLQLALRNPNDTAVIELADIEEAN 226

Query: 239 VQEE 242
             E+
Sbjct: 227 KTEK 230


>gi|227818614|ref|YP_002822585.1| CpaB2, Flp pilus assembly protein CpaB [Sinorhizobium fredii
           NGR234]
 gi|36958870|gb|AAQ87295.1| Pilus assembly protein, CpaB [Sinorhizobium fredii NGR234]
 gi|227337613|gb|ACP21832.1| CpaB2, Flp pilus assembly protein CpaB [Sinorhizobium fredii
           NGR234]
          Length = 263

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 84/257 (32%), Positives = 129/257 (50%), Gaps = 15/257 (5%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
           + RL+ ++ +      A  +A+       V+  EV     +    VL++  +LA G  + 
Sbjct: 1   MIRLVILLFALASGGAASWLALGFADQPTVEAAEV---QQSPSQEVLVAAQELARGTTLE 57

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLS 122
              L W A+ E  +   FI    +P+A + L G+L +   + G+PIR +KL  RG G LS
Sbjct: 58  EPHLRWQAW-EGEIPPVFISRSARPDAKESLKGLLAQSSFVAGEPIREDKLAQRGAGFLS 116

Query: 123 SLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV-----RSLSERKPTVTVVLSNIRVI 177
           S+LP GKRA  + ++  S  GG I PNDHVDV+        S  + K     VLSNIRV+
Sbjct: 117 SMLPSGKRAIAVRVTAESTAGGFILPNDHVDVIHTVARPDSSGKDGKVVSRAVLSNIRVL 176

Query: 178 AIDHNIDS--DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
           A+D  I    D   +VG TATLE  P Q   + AA++   +SL LR++AD   +   +++
Sbjct: 177 AVDQTISEGADGTSVVGKTATLEADPGQIDIIAAAEASGTVSLALRAVADNLEAPVVETE 236

Query: 236 VWDVQEEGKEIQIIKAG 252
                     ++I+  G
Sbjct: 237 ----GSRPGVVRIVSGG 249


>gi|167841424|ref|ZP_02468108.1| putative pilus assembly protein CpaB [Burkholderia thailandensis
           MSMB43]
          Length = 281

 Score =  192 bits (487), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 58/208 (27%), Positives = 104/208 (50%), Gaps = 12/208 (5%)

Query: 33  QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQE 92
            +  ++  + +    V ++  D+ +G  + PN L  V +P  +V  G   D+        
Sbjct: 24  ASRWLVQTSSSAVTPVAVAATDVNLGEPLGPNQLRIVNWPTASVPPGAFTDLKP------ 77

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDH 151
           L+G +VR  + +G+P+   KL   G  GGLS+++  G RA T+ ++    V G   P ++
Sbjct: 78  LEGRVVRTSLARGEPVLGTKLAPIGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNY 137

Query: 152 VDVVMVRSLSE----RKPTVTVVLSNIRVIAIDHNIDSDER-VLVGSTATLELTPMQAKA 206
           VDV++          ++    +VL  I V+A+   +  D+    V +  TLE++P QA+ 
Sbjct: 138 VDVIVNTQEQSKADPQQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVSPDQAEK 197

Query: 207 LVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           L  A+SV  LSLVLR+  D +  ++  +
Sbjct: 198 LDLARSVGTLSLVLRNQIDKDALNTGGA 225


>gi|227819322|ref|YP_002823293.1| CpaB pilus assembly protein [Sinorhizobium fredii NGR234]
 gi|227338321|gb|ACP22540.1| CpaB pilus assembly protein [Sinorhizobium fredii NGR234]
          Length = 352

 Score =  191 bits (486), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 55/258 (21%), Positives = 110/258 (42%), Gaps = 8/258 (3%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+ + ++ ++V+ + AL A       ++    +          +   V ++   +  G  
Sbjct: 21  MRSSTMISLIVALLLALGAVFATRSFLADQQARLVSANAPKAEERTLV-VAAKPMRFGDR 79

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           V    L+ + +P E   +G    +       + +       I  G+P+   K+   G   
Sbjct: 80  VRSENLKAIPWPSEERPEGSFQTLEAVLG-DDTEPRYAMEAIDPGEPVLTSKITGTGERA 138

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVR----SLSERKPTVTVVLSNIR 175
            LS+ L +G +A ++ ++    V G ++P+D VDV++ R      +  +  V V+L  ++
Sbjct: 139 TLSAALDQGMKAVSIRVNDVLGVAGFVRPSDRVDVLLTRVVRQQNNSEQTYVDVLLQGVK 198

Query: 176 VIAIDHNID-SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           V+A+D   D   +   +  T T E+T  +A+ L    S+  LSL LR+IA  N   +   
Sbjct: 199 VLAVDQTADERKDEPSIVKTVTFEVTTDEAQRLTLGASIGTLSLTLRNIASSNVEQTRPI 258

Query: 235 DVWDVQEEGKEIQIIKAG 252
            V D+        + K+ 
Sbjct: 259 TVADLGGGLISADLAKSA 276


>gi|148976663|ref|ZP_01813350.1| Flp pilus assembly protein CpaB [Vibrionales bacterium SWAT-3]
 gi|145964014|gb|EDK29272.1| Flp pilus assembly protein CpaB [Vibrionales bacterium SWAT-3]
          Length = 249

 Score =  191 bits (486), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 59/257 (22%), Positives = 108/257 (42%), Gaps = 17/257 (6%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVV 61
           K    +  ++S VF L A   A + +     Q +  I     +   V+++  ++  G V+
Sbjct: 3   KSQVFLLFLLSVVFGLAAVFFAKQWMD---DQVQPTIEVEKVERHPVVVASQEIEAGTVI 59

Query: 62  TPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG- 120
               L       + + +    D       +EL G +V   I  G+ +   +    G G  
Sbjct: 60  EEQFLTTKLMEVDWINENNYSD------KEELIGKVVANTIYAGEVLHKLRFTVPGEGST 113

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
           L++L+P+ KRA T+ +     V G + P + VD++   S  +       VL +I+V+A+D
Sbjct: 114 LAALIPENKRAVTIRVDDVIGVAGFLLPGNKVDILNTVSYGKNSAATQTVLKDIKVLAVD 173

Query: 181 HNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDV 239
               + E   ++    TLE+TP  A+ L+ A+S   + L LR+  ++      +  V   
Sbjct: 174 QTARTKENSPIIVRAVTLEVTPKDAEKLLTAKSKGSIQLTLRNPHEV------EKKVVRR 227

Query: 240 QEEGKEIQIIKAGVIVN 256
                 + IIK     N
Sbjct: 228 YVPRPSVTIIKGTETSN 244


>gi|294140773|ref|YP_003556751.1| Flp pilus assembly protein CpaB [Shewanella violacea DSS12]
 gi|293327242|dbj|BAJ01973.1| Flp pilus assembly protein CpaB [Shewanella violacea DSS12]
          Length = 270

 Score =  191 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 58/249 (23%), Positives = 116/249 (46%), Gaps = 20/249 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M    ++ +++S  F +VA  +A   +  +        T  P     V+     + +G +
Sbjct: 1   MNNKTMLFVLLSLAFGVVAVFLAQSWLESNSE------TGGPENTSTVITMATLVPLGAI 54

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +    L+    P+  + +  I         +E +G++V+  +  G+ +R E+++ +G G 
Sbjct: 55  LERKHLKLTPMPKSVIPETAIKT------FEEAEGMVVKHNLYTGEILRSERIIKKGEGS 108

Query: 121 -LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAI 179
            L+SL+    RA T+ ++    V G + P + VDV+ +           +VL+N++++AI
Sbjct: 109 TLASLISPNMRAVTIRVNDVVGVAGFLLPGNRVDVLNLFKKDGALH-TDIVLANVKILAI 167

Query: 180 DHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWD 238
           D    +DE +  +    TLEL+  QA+ L+ A+   KL L LR+  D     S + ++  
Sbjct: 168 DQRSSNDENKPKLVRAVTLELSLEQAEILLIAKGRGKLQLALRNPND-----SAEVELAL 222

Query: 239 VQEEGKEIQ 247
           + E  K  +
Sbjct: 223 INETEKREK 231


>gi|194288837|ref|YP_002004744.1| pilus assembly transmembrane protein [Cupriavidus taiwanensis LMG
           19424]
 gi|193222672|emb|CAQ68675.1| PILUS ASSEMBLY TRANSMEMBRANE PROTEIN [Cupriavidus taiwanensis LMG
           19424]
          Length = 279

 Score =  191 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 71/252 (28%), Positives = 122/252 (48%), Gaps = 23/252 (9%)

Query: 1   MKLTR-LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK TR ++ ++++ V  + A + A R +      + + +            +  DL +G 
Sbjct: 1   MKNTRAILMLLIALVAGVAAVVSASRWLVQQSSSSVKQVVV----------AANDLNLGQ 50

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
            +    L  V++P  +V  G   D      ++ L+G +VR  + +G+PI   KL   G  
Sbjct: 51  PLNGAQLRMVSWPAGSVPPGAFTD------LKALEGRVVRTSLQRGEPILDAKLAPVGTK 104

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVR----SLSERKPTVTVVLSNI 174
           GGLS+++  GKRA T+ ++    V G   P ++VDV++        S+      +VL  I
Sbjct: 105 GGLSAVINDGKRAITVRVNDVVGVAGFALPGNYVDVIVNTNEEAKSSQNSSISKIVLEKI 164

Query: 175 RVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
            V+A+   +  DE +  V +  TLE+TP QA+ L  A+SV  LSLVLR+  D+   S+  
Sbjct: 165 LVLAVAQQVSRDETQPKVVNAVTLEVTPDQAEKLDVARSVGTLSLVLRNQMDVADISTGG 224

Query: 234 SDVWDVQEEGKE 245
           +    +  +  E
Sbjct: 225 ATKGTLLGKAPE 236


>gi|323499922|ref|ZP_08104881.1| Flp pilus assembly protein CpaB [Vibrio sinaloensis DSM 21326]
 gi|323315163|gb|EGA68215.1| Flp pilus assembly protein CpaB [Vibrio sinaloensis DSM 21326]
          Length = 247

 Score =  191 bits (485), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 53/224 (23%), Positives = 102/224 (45%), Gaps = 11/224 (4%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNI 65
           ++  ++S VF L A   A + +     Q +  +     +   V+I+  ++  G  +    
Sbjct: 7   ILLFLLSIVFGLGAVFFAKQWMDR---QLQPQVEMELIEREPVIIASQEIPAGTPIEEQH 63

Query: 66  LEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSL 124
           +       +   +G           +EL G +V   I +G+ +   +L   G G  L+SL
Sbjct: 64  VSSRLLEVDWRNEGQFTKA------EELIGQVVATTIYQGEVVHQNRLAAPGEGSTLASL 117

Query: 125 LPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNID 184
           +P+ KRA T+ ++    V G + P + VDV+     S        VL +I+V+A+D    
Sbjct: 118 IPENKRAVTIRVNDVIGVAGFLLPGNRVDVLNTIKYSSTYANTVTVLKDIKVLAVDQTAR 177

Query: 185 SDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLN 227
           + E + ++    TLE++P  A+ L+ A+S  ++ L LR+  +  
Sbjct: 178 TKENKPIIVRAVTLEVSPKDAEKLLTARSKGEIQLTLRNPHEEE 221


>gi|307304372|ref|ZP_07584123.1| Flp pilus assembly protein CpaB [Sinorhizobium meliloti BL225C]
 gi|307318079|ref|ZP_07597515.1| Flp pilus assembly protein CpaB [Sinorhizobium meliloti AK83]
 gi|306896120|gb|EFN26870.1| Flp pilus assembly protein CpaB [Sinorhizobium meliloti AK83]
 gi|306902574|gb|EFN33168.1| Flp pilus assembly protein CpaB [Sinorhizobium meliloti BL225C]
          Length = 263

 Score =  191 bits (485), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 80/240 (33%), Positives = 121/240 (50%), Gaps = 11/240 (4%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
           + R++ ++++      A  +A   +     +  EV          VL++  +L  G VV 
Sbjct: 1   MIRIVILLLALASGGAASWLA---LGTGDQRAVEVAEVQETPSQEVLVAAAELKRGAVVE 57

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLS 122
            N L W  + E  +   FI    +P+A   L G L     + G+PIR +KL   G G LS
Sbjct: 58  ENQLRWQPW-EGEIPPVFISRSSRPDATTALKGSLALSGFVAGEPIRDDKLAQGGTGYLS 116

Query: 123 SLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVR-----SLSERKPTVTVVLSNIRVI 177
           SLLP GKRA  + ++  S  GG I PNDHVDV+        S    K     +LSNIRV+
Sbjct: 117 SLLPSGKRAIAVRVTAESTAGGFILPNDHVDVIHTVARPDASGDAGKVVSRAILSNIRVL 176

Query: 178 AIDHNIDS--DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
           A+D  +    D   ++G TATLE+ P Q  A+ AA++   +SL LR+I D + +S  +++
Sbjct: 177 AVDQTVSQASDGASVIGKTATLEVDPEQISAVAAAEASGTVSLALRAITDNHEASVVEAE 236


>gi|103486618|ref|YP_616179.1| Flp pilus assembly CpaB [Sphingopyxis alaskensis RB2256]
 gi|98976695|gb|ABF52846.1| Flp pilus assembly CpaB [Sphingopyxis alaskensis RB2256]
          Length = 345

 Score =  191 bits (485), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 65/242 (26%), Positives = 108/242 (44%), Gaps = 17/242 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   ++M IV + V A+ A      ++                    +L++   L VG +
Sbjct: 1   MDTRKIMLIVGALVIAIGAAFGVNYMMRGAGAPAARAAAAPEITGPMILVATRQLPVGTI 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRGNG 119
           V P+   +  +P++ V + +   V +   +  L G +VR PI  G P+    LV     G
Sbjct: 61  VGPDSFRFQPWPKDLVENAYF--VKEKTDVNTLVGTVVRHPITAGQPLTQGALVHPNDRG 118

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS---------LSERKPTVTVV 170
            L++ L  G RA T+ +S    V G + P D VDVV+ ++           ++  T   +
Sbjct: 119 FLAAALGPGMRAITVKVSQEQGVAGFVFPGDRVDVVLTQTIEVEEGSTYPDDQIFTAETI 178

Query: 171 LSNIRVIAIDHNIDSDERV--LVGST---ATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           + NIRV+A D   D+++        T    TLE TP  A+ +  AQ + +LSL LR +A+
Sbjct: 179 VRNIRVLATDQRYDAEDETGKTPVRTFGSVTLEATPEIAEKIAVAQGMGRLSLALRPLAE 238

Query: 226 LN 227
             
Sbjct: 239 SA 240


>gi|260431083|ref|ZP_05785054.1| Flp pilus assembly protein CpaB [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260414911|gb|EEX08170.1| Flp pilus assembly protein CpaB [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 293

 Score =  190 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 63/252 (25%), Positives = 105/252 (41%), Gaps = 17/252 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENP----------AKFINVLI 50
           M+    + ++V    A  A  +A   ++ +                         + VL+
Sbjct: 1   MRAVFGLVLIVGIALAGGAVYLARNYITEYQNALARERQAAQEALASAKVDVVPTVGVLV 60

Query: 51  SKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRL 110
           +   L  G  +T   +  V +PE  V +G   ++         +   V   + K + I  
Sbjct: 61  ANRPLKYGERLTEEDIRVVDWPENAVPEGAFTEMAALFPETGANERFVLRAMEKDEAIME 120

Query: 111 EKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE-----RK 164
            K+   G   GL+S L KG RA  + + ++S V G ++P D VDV    SLS      R 
Sbjct: 121 VKVTKPGELAGLTSRLEKGMRAFAISVDVASGVSGFLRPGDVVDVYWTGSLSGAVEGARG 180

Query: 165 PTVTVVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSI 223
               ++ +NI +IA+D +  SD     +  T T+  TP Q  AL  AQ+  +LSL L  +
Sbjct: 181 EITRLIQTNIELIAVDQSAGSDVTGTTIARTVTVAATPEQVAALAQAQNTGRLSLALVGV 240

Query: 224 ADLNPSSSEDSD 235
            D   +S+ + D
Sbjct: 241 HDETVASAIEVD 252


>gi|163733543|ref|ZP_02140986.1| pilus assembly domain protein [Roseobacter litoralis Och 149]
 gi|161393331|gb|EDQ17657.1| pilus assembly domain protein [Roseobacter litoralis Och 149]
          Length = 276

 Score =  190 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 53/234 (22%), Positives = 95/234 (40%), Gaps = 6/234 (2%)

Query: 7   MGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPA--KFINVLISKGDLAVGMVVTPN 64
           M ++     A  A  +A   +  +  +         A      V ++   L  G  + P 
Sbjct: 1   MVLLAGVALAGGAVYMAKGYIGQYQAELARAQQMQSAIVPTQPVFVATRHLRYGDTLNPE 60

Query: 65  ILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSS 123
            +  V +P   + DG   D+         +  L+  P+   + +   K+ + G + GL++
Sbjct: 61  DVRAVNWPTNAIPDGIFTDIAVLFPEGTDEPRLIIRPMEPNEALLAVKITEPGEDIGLTT 120

Query: 124 LLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV---RSLSERKPTVTVVLSNIRVIAID 180
            L KG RA  + + +++ V G ++P D VDV      ++ + R+    ++ S +R+IA+D
Sbjct: 121 RLEKGMRAFAIRVDVATGVSGFLRPGDKVDVYWTGGVQTSNGREDVTKLIQSAVRLIAVD 180

Query: 181 HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
              D      +  T T+  +P Q  AL  AQS   LSL L    D         
Sbjct: 181 QTEDQMNGARIARTVTVAASPEQVAALAQAQSTGNLSLSLVGAGDDAELDEIKV 234


>gi|269966891|ref|ZP_06180964.1| putative pilus assembly protein [Vibrio alginolyticus 40B]
 gi|269828558|gb|EEZ82819.1| putative pilus assembly protein [Vibrio alginolyticus 40B]
          Length = 251

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 64/250 (25%), Positives = 114/250 (45%), Gaps = 17/250 (6%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNI 65
           +M +++S VF L A +IA + +   +  T E+      +   VL++  +L  G +++   
Sbjct: 7   IMLLLLSIVFGLAAVLIAKQWMDGRNQPTVEL---EEVERHPVLVAAMELEPGTILSEKH 63

Query: 66  LEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-GLSSL 124
           L       + +      D       ++  G +V   I  G+ +   +L   G G  L++L
Sbjct: 64  LSTKLMEVDWI------DDETLKVKEQALGRIVANTIYAGELVNPHRLALPGEGATLAAL 117

Query: 125 LPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK-PTVTVVLSNIRVIAIDHNI 183
           +P+ KRA T+ ++    V G + P + VDV+   S  + K  T   VL NI V+A+D   
Sbjct: 118 IPENKRAITIRVNDVIGVAGFLLPGNKVDVLNTVSYGQGKNATTKTVLKNINVLAVDQTA 177

Query: 184 DS-DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEE 242
            + D + ++    TLE+TP +A+ L++A S   + L LR+     P   +   V      
Sbjct: 178 KTNDNKPVIVRAVTLEVTPKEAEKLLSANSKGDIQLALRN-----PHEVDKPVVARKYTP 232

Query: 243 GKEIQIIKAG 252
              + IIK  
Sbjct: 233 RPSVTIIKGS 242


>gi|167574002|ref|ZP_02366876.1| putative pilus assembly protein CpaB [Burkholderia oklahomensis
           C6786]
          Length = 282

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 60/208 (28%), Positives = 105/208 (50%), Gaps = 12/208 (5%)

Query: 33  QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQE 92
            +  ++  + +    V ++  D+ +G  + PN L  V +P  +V  G   DV      + 
Sbjct: 24  ASRWLVQTSSSAVTPVAVAAIDVNLGEPLVPNQLRVVNWPTASVPPGAFTDV------KS 77

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDH 151
           L+G +VR  + +G+P+   KL   G  GGLS+++  G RA T+ ++    V G   P ++
Sbjct: 78  LEGRVVRTSLARGEPVLGSKLAPVGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNY 137

Query: 152 VDVVMVRSLSE----RKPTVTVVLSNIRVIAIDHNIDSDER-VLVGSTATLELTPMQAKA 206
           VDV++          ++    +VL  I V+A+   +  D+    V +  TLE+TP QA+ 
Sbjct: 138 VDVIVNTQEQSKADPQQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVTPDQAEK 197

Query: 207 LVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           L  A+SV  LSLVLR+  D +  ++  +
Sbjct: 198 LDLARSVGTLSLVLRNQVDKDALNTGGA 225


>gi|110679398|ref|YP_682405.1| pilus assembly domain-containing protein [Roseobacter denitrificans
           OCh 114]
 gi|109455514|gb|ABG31719.1| pilus assembly domain protein [Roseobacter denitrificans OCh 114]
          Length = 282

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 54/240 (22%), Positives = 99/240 (41%), Gaps = 6/240 (2%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPA--KFINVLISKGDLAVG 58
           M++   M ++     A  A  +A   +  +  +       + A      V ++   L  G
Sbjct: 1   MRVIFGMVLLAGVALAGGAVYMAKGYIGQYQAELARAQQMHSAIVPTQQVFVATRHLRYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG- 117
             + P  +  V +P   +  G   D+         +  L+  P+   + +   K+ + G 
Sbjct: 61  DTLKPEDVRAVNWPVNAIPQGVFTDIAALFPEGTDEPRLIIRPMEPSEAVLAVKITEPGE 120

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV---RSLSERKPTVTVVLSNI 174
           + GL++ L KG RA  + + ++S V G ++P D VDV      ++ + R+    ++ + +
Sbjct: 121 DIGLTTRLEKGMRAFAIRVDVASGVSGFLRPGDKVDVYWTGGVQTGNGREDVTKLIQTAV 180

Query: 175 RVIAIDHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           R+IA+D   D      +  T T+  TP Q  AL  AQS   LSL L  + D         
Sbjct: 181 RLIAVDQIDDQMNGARIARTVTVAATPEQVAALAQAQSTGNLSLSLVGVGDDEELDEIKV 240


>gi|145219385|ref|YP_001130094.1| SAF domain-containing protein [Prosthecochloris vibrioformis DSM
           265]
 gi|145205549|gb|ABP36592.1| SAF domain protein [Chlorobium phaeovibrioides DSM 265]
          Length = 262

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 61/239 (25%), Positives = 115/239 (48%), Gaps = 19/239 (7%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
           + + +   ++ +   +A   A R V+                   V+I    + +G  +T
Sbjct: 1   MKKPIIAAIALILGAMAAFTAARWVNISRHTGP-----------KVVIVAQPIELGKAIT 49

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGL 121
              ++ V +P  ++  G +          E+ G + RV ++ G+P+   KL  +G  GGL
Sbjct: 50  TEQIKTVNWPGADIPQGAVSKA------TEVVGRIARVSMMPGEPVLPGKLAPKGATGGL 103

Query: 122 SSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDH 181
           +S++  GKRA T+ ++   AV G   P   VD+++    + R+P    VLS ++V+A+  
Sbjct: 104 ASIISDGKRAITVKVNEVIAVAGFALPGSFVDILVSGKDANRQPFSRTVLSRVKVLAVAQ 163

Query: 182 NIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDV 239
              ++ ++  V +  TLELTP +++ L  A+S+  LSLVLR+  D    +S    + D+
Sbjct: 164 ETTAEPDKPKVVNAVTLELTPHESEKLDLARSIGALSLVLRNELDTGEVNSAGVRLSDL 222


>gi|83717368|ref|YP_440455.1| pilus assembly protein [Burkholderia thailandensis E264]
 gi|167617228|ref|ZP_02385859.1| pilus assembly protein [Burkholderia thailandensis Bt4]
 gi|257141103|ref|ZP_05589365.1| pilus assembly protein [Burkholderia thailandensis E264]
 gi|83651193|gb|ABC35257.1| pilus assembly protein [Burkholderia thailandensis E264]
          Length = 279

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 60/208 (28%), Positives = 106/208 (50%), Gaps = 12/208 (5%)

Query: 33  QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQE 92
            +  ++  + +    V ++  D+ +G  + PN L  V +P  +V  G   D      ++ 
Sbjct: 24  ASRWLVQTSSSAVTPVAVAATDVNLGEPLGPNQLRIVNWPTASVPPGAFTD------LKS 77

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDH 151
           L+G +VR  + +G+P+   KL   G  GGLS+++  G RA T+ ++    V G   P ++
Sbjct: 78  LEGRVVRTSLARGEPVLGTKLAPVGTKGGLSAVIAPGDRAITVRVNDVVGVAGFALPGNY 137

Query: 152 VDVVMVRSLSE----RKPTVTVVLSNIRVIAIDHNIDSDER-VLVGSTATLELTPMQAKA 206
           VDV++          ++    +VL  I V+A+   +  D+    V +  TLE+TP QA+ 
Sbjct: 138 VDVIVNTQEQSKADPQQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVTPDQAEK 197

Query: 207 LVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           L  A+SV  LSLVLR+  D +  ++E +
Sbjct: 198 LDLARSVGTLSLVLRNQVDKSALTTEGA 225


>gi|167579113|ref|ZP_02371987.1| pilus assembly protein [Burkholderia thailandensis TXDOH]
          Length = 279

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 60/208 (28%), Positives = 106/208 (50%), Gaps = 12/208 (5%)

Query: 33  QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQE 92
            +  ++  + +    V ++  D+ +G  + PN L  V +P  +V  G   D      ++ 
Sbjct: 24  ASRWLVQTSSSAVTPVAVAATDVNLGEPLGPNQLRIVNWPTASVPPGAFTD------LKS 77

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDH 151
           L+G +VR  + +G+P+   KL   G  GGLS+++  G RA T+ ++    V G   P ++
Sbjct: 78  LEGRVVRTSLARGEPVLGTKLAPVGTKGGLSAVIAPGDRAITVRVNDVVGVAGFALPGNY 137

Query: 152 VDVVMVRSLSE----RKPTVTVVLSNIRVIAIDHNIDSDER-VLVGSTATLELTPMQAKA 206
           VDV++          ++    +VL  I V+A+   +  D+    V +  TLE+TP QA+ 
Sbjct: 138 VDVIVNTQEQSKADPQQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVTPDQAEK 197

Query: 207 LVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           L  A+SV  LSLVLR+  D +  ++E +
Sbjct: 198 LDLARSVGTLSLVLRNQVDKSALTTEGA 225


>gi|167725246|ref|ZP_02408482.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           DM98]
          Length = 245

 Score =  189 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 59/208 (28%), Positives = 105/208 (50%), Gaps = 12/208 (5%)

Query: 33  QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQE 92
            +  ++  + +    V ++  D+++G  + PN L  V +P  +V  G   D+        
Sbjct: 24  ASRWLVQTSSSAVTPVAVAATDVSLGEPLGPNQLRIVNWPTASVPPGAFTDLKP------ 77

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDH 151
           L+G +VR  + +G+P+   KL   G  GGLS+++  G RA T+ ++    V G   P ++
Sbjct: 78  LEGRVVRTSLARGEPVLGTKLAPVGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNY 137

Query: 152 VDVVMVRSLSE----RKPTVTVVLSNIRVIAIDHNIDSDER-VLVGSTATLELTPMQAKA 206
           VDV++          ++    +VL  I V+A+   +  D+    V +  TLE++P QA+ 
Sbjct: 138 VDVIVNTQEQSKADPQQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVSPEQAEK 197

Query: 207 LVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           L  A+SV  LSLVLR+  D +  S+  +
Sbjct: 198 LDLARSVGTLSLVLRNQVDKDALSTGGA 225


>gi|113866745|ref|YP_725234.1| flp pilus assembly protein [Ralstonia eutropha H16]
 gi|113525521|emb|CAJ91866.1| flp pilus assembly protein [Ralstonia eutropha H16]
          Length = 280

 Score =  189 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 69/252 (27%), Positives = 123/252 (48%), Gaps = 23/252 (9%)

Query: 1   MKLTR-LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK TR ++ ++++ V  + A + A R +      +   +            +  DL +G 
Sbjct: 1   MKNTRAILMLLIALVAGVAAVVSASRWLVQQSSSSVRQVVV----------AANDLNLGQ 50

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
            +  + L  V++P  +V  G  +D      M+ L+G +VR  + +G+P+   KL   G  
Sbjct: 51  PLNGSQLRMVSWPTGSVPPGAFED------MKALEGRVVRTSLQRGEPVLDAKLAPVGTK 104

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS----ERKPTVTVVLSNI 174
           GGLS+++  GKRA T+ ++    V G   P ++VDV++  +      +      +VL  I
Sbjct: 105 GGLSAVINDGKRAITVRVNDVVGVAGFALPGNYVDVIVNTNEEAKTTQSGSISKIVLEKI 164

Query: 175 RVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
            V+A+   +  D+ +  V +  TLE+TP QA+ L  A+SV  LSLVLR+  D+   S+  
Sbjct: 165 LVLAVAQQVSRDDTQPKVVNAVTLEVTPEQAEKLDVARSVGTLSLVLRNQLDVADISTGG 224

Query: 234 SDVWDVQEEGKE 245
           +    +  +  E
Sbjct: 225 ATKGTLLGKTPE 236


>gi|212635454|ref|YP_002311979.1| Flp pilus assembly protein CpaB [Shewanella piezotolerans WP3]
 gi|212556938|gb|ACJ29392.1| Flp pilus assembly protein CpaB [Shewanella piezotolerans WP3]
          Length = 267

 Score =  189 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 61/229 (26%), Positives = 110/229 (48%), Gaps = 16/229 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M    L+ +V+S VF + A  +A   +  +         E  +    V+    ++ +G +
Sbjct: 1   MNNKTLLFVVLSLVFGVTAVYLAQNWLKSNTKD------EVISTTGTVITMATEVPLGAI 54

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +    L     PE  +  G + D      + E +G +V+  +  G+ +R E+L  +G G 
Sbjct: 55  LQRKHLSLTTLPESLIPKGAVLD------LAEAEGKVVKQKLYAGEVLRAERLTAKGEGS 108

Query: 121 -LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAI 179
            L+SL+    RA T+ ++    V G + P + VD++ +   S  K    +VLSN++++AI
Sbjct: 109 TLASLITPTMRAVTIRVNDVVGVAGFLLPGNRVDIINIFKSSGLK--TDIVLSNVKILAI 166

Query: 180 DHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLN 227
           D    +DE + ++    TLEL+  QA+ L+ A+S   L L LR+  D  
Sbjct: 167 DQRASNDENKPVLVRAVTLELSLDQAEILMIAKSRGSLQLALRNPNDKA 215


>gi|221067359|ref|ZP_03543464.1| Flp pilus assembly protein CpaB [Comamonas testosteroni KF-1]
 gi|220712382|gb|EED67750.1| Flp pilus assembly protein CpaB [Comamonas testosteroni KF-1]
          Length = 281

 Score =  189 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 65/208 (31%), Positives = 109/208 (52%), Gaps = 14/208 (6%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
            V+++  D+ +G  + PN+L  V +P  ++ DG   D      MQ+L   +V+V +L+G+
Sbjct: 38  KVVVAATDIPLGGKILPNMLNTVDWPRGSIPDGAFHD------MQQLQDRVVKVGVLRGE 91

Query: 107 PIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV------RS 159
            +   KL   G  GGL++++  GKRA T+ ++    V G   P ++VDVV+         
Sbjct: 92  AVLEGKLAPVGTKGGLAAVIAPGKRAMTVRVNDVVGVAGFALPGNYVDVVVNAQQEQAGK 151

Query: 160 LSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSL 218
           + + +     VL N+ V+A+    D DE +  V S  TLEL+P  A+ L  A+SV  LSL
Sbjct: 152 MEDSRQISKTVLENVLVLAVAQEADRDETKPKVVSAVTLELSPGDAEKLDLARSVGNLSL 211

Query: 219 VLRSIADLNPSSSEDSDVWDVQEEGKEI 246
           VLR+  D +P+S+       +    + +
Sbjct: 212 VLRNQIDKDPTSTVGITKHQLFGTPEPV 239


>gi|254229331|ref|ZP_04922748.1| Flp pilus assembly protein CpaB [Vibrio sp. Ex25]
 gi|262393416|ref|YP_003285270.1| flp pilus assembly protein RcpC/CpaB [Vibrio sp. Ex25]
 gi|151938139|gb|EDN56980.1| Flp pilus assembly protein CpaB [Vibrio sp. Ex25]
 gi|262337010|gb|ACY50805.1| flp pilus assembly protein RcpC/CpaB [Vibrio sp. Ex25]
          Length = 251

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 64/250 (25%), Positives = 114/250 (45%), Gaps = 17/250 (6%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNI 65
           +M +++S VF L A +IA + +   +  T E+      +   VL++  +L  G +++   
Sbjct: 7   IMLLLLSIVFGLAAVLIAKQWMDGRNQPTVEL---EEVERHPVLVAAMELEPGTILSEKH 63

Query: 66  LEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-GLSSL 124
           L       + +      D       ++  G +V   I  G+ +   +L   G G  L++L
Sbjct: 64  LSTKLMEVDWI------DDETLKVQEQALGRIVANTIYAGELVNSNRLALPGEGATLAAL 117

Query: 125 LPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK-PTVTVVLSNIRVIAIDHNI 183
           +P+ KRA T+ ++    V G + P + VDV+   S  + K  T   VL NI V+A+D   
Sbjct: 118 IPENKRAITIRVNDVIGVAGFLLPGNKVDVLNTVSYGQGKNATTKTVLKNINVLAVDQTA 177

Query: 184 DS-DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEE 242
            + D + ++    TLE+TP +A+ L++A S   + L LR+     P   +   V      
Sbjct: 178 KTNDNKPVIVRAVTLEVTPKEAEKLLSANSKGDIQLALRN-----PHEVDKPVVARKYTP 232

Query: 243 GKEIQIIKAG 252
              + IIK  
Sbjct: 233 RPSVTIIKGS 242


>gi|269962016|ref|ZP_06176371.1| hypothetical protein VME_27550 [Vibrio harveyi 1DA3]
 gi|269833339|gb|EEZ87443.1| hypothetical protein VME_27550 [Vibrio harveyi 1DA3]
          Length = 251

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 66/258 (25%), Positives = 117/258 (45%), Gaps = 17/258 (6%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVV 61
           K   +M +++S VF L A +IA + +   +  T E+      +   VL++  +L  GMV+
Sbjct: 3   KTQVVMLLLLSIVFGLAAVLIAKQWIDGQNQPTVEL---EEIERHPVLVAAMELEPGMVL 59

Query: 62  TPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-G 120
               L       + + +  +    Q        G +V   I  G+ +   +L   G G  
Sbjct: 60  EEKHLTTKLMEVDWIEEDTLKVSEQA------LGRIVANTIYSGEMVNPNRLALPGEGAT 113

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP-TVTVVLSNIRVIAI 179
           L++L+P+ KRA T+ ++    V G + P + VD++   S  + K  +   VL NI+V+A+
Sbjct: 114 LAALIPENKRAITIRVNDVIGVAGFLLPGNKVDILNTISSGKGKSASTKTVLKNIKVLAV 173

Query: 180 DHNIDS-DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWD 238
           D    + D + ++    TLE+TP +A+ L++  S  K+ L LR+     P   +   V  
Sbjct: 174 DQTAKTNDNKPVIVRAVTLEVTPKEAEKLLSENSKGKIQLALRN-----PHEVDKPPVAR 228

Query: 239 VQEEGKEIQIIKAGVIVN 256
                  + IIK     N
Sbjct: 229 KYTPRPSVTIIKGSQASN 246


>gi|296444396|ref|ZP_06886361.1| Flp pilus assembly protein CpaB [Methylosinus trichosporium OB3b]
 gi|296258043|gb|EFH05105.1| Flp pilus assembly protein CpaB [Methylosinus trichosporium OB3b]
          Length = 264

 Score =  188 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 75/259 (28%), Positives = 124/259 (47%), Gaps = 16/259 (6%)

Query: 10  VVSGVFALVAGIIAMRLVSPHHVQTEE---VITENPAKFINVLISKGDLAVGMVVTPNIL 66
           +     A+VAG  A  ++S      +    V    P     VL++  DL  G  +     
Sbjct: 6   IAVLGVAIVAGGGAFMMLSTEPTPPQPMHLVAPPPPRTTDQVLVAARDLPFGAALAEADT 65

Query: 67  EWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGL-SSLL 125
            W+ +P   V  G +     P   ++++G  VR P+  G+PIR E+L+     GL S+++
Sbjct: 66  SWIEWPISAVPPGVLRKSEAPEIKKDIEGAFVRTPLANGEPIRRERLIKGQTPGLMSTMI 125

Query: 126 PKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP------TVTVVLSNIRVIAI 179
             G+RA  +D+S ++  GG I PNDHVDV+ +    ++           V+L N+RV+A+
Sbjct: 126 SAGRRAVAIDVSPNTTAGGFILPNDHVDVIRLYRDPDQGGQIGSDMNSEVILRNVRVLAM 185

Query: 180 DH--NIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVW 237
                  + E  + G+TATL+L P QA+ ++ AQ   +L+L+LR IAD    +  D    
Sbjct: 186 GPVFQTKNGESSVTGATATLDLEPRQAELVILAQRSGQLALMLRPIAD----ALADEKPE 241

Query: 238 DVQEEGKEIQIIKAGVIVN 256
                   + I++ GV   
Sbjct: 242 SAAPGQDPLTIVRFGVTST 260


>gi|167821373|ref|ZP_02453053.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei 91]
          Length = 251

 Score =  188 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 59/208 (28%), Positives = 105/208 (50%), Gaps = 12/208 (5%)

Query: 33  QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQE 92
            +  ++  + +    V ++  D+++G  + PN L  V +P  +V  G   D+        
Sbjct: 24  ASRWLVQTSSSAVTPVAVAATDVSLGEPLGPNQLRIVNWPTASVPPGAFTDLKP------ 77

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDH 151
           L+G +VR  + +G+P+   KL   G  GGLS+++  G RA T+ ++    V G   P ++
Sbjct: 78  LEGRVVRTSLARGEPVLGTKLAPVGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNY 137

Query: 152 VDVVMVRSLSE----RKPTVTVVLSNIRVIAIDHNIDSDER-VLVGSTATLELTPMQAKA 206
           VDV++          ++    +VL  I V+A+   +  D+    V +  TLE++P QA+ 
Sbjct: 138 VDVIVNTQEQSKADPQQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVSPEQAEK 197

Query: 207 LVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           L  A+SV  LSLVLR+  D +  S+  +
Sbjct: 198 LDLARSVGTLSLVLRNQVDKDALSTGGA 225


>gi|153834044|ref|ZP_01986711.1| Flp pilus assembly protein CpaB [Vibrio harveyi HY01]
 gi|148869599|gb|EDL68589.1| Flp pilus assembly protein CpaB [Vibrio harveyi HY01]
          Length = 251

 Score =  188 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 63/258 (24%), Positives = 117/258 (45%), Gaps = 17/258 (6%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVV 61
           K   +M +++S VF L A +IA + +   +  T E+      +   VL++  +L  G ++
Sbjct: 3   KTQIVMLLLLSIVFGLAAVLIAKQWIDGQNQPTVEL---EEVERHPVLVAAMELEPGTIL 59

Query: 62  TPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-G 120
               L       + + +  +         ++  G +V   I  G+ +   +L   G G  
Sbjct: 60  EEKHLTTKLMEVDWIEESTLK------VSEQALGRIVANTIYSGEMVNPNRLALPGEGAT 113

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP-TVTVVLSNIRVIAI 179
           L++L+P+ KRA T+ ++    V G + P + VD++   S  + K  +   VL NI+V+A+
Sbjct: 114 LAALIPENKRAITIRVNDVIGVAGFLLPGNKVDILNTISSGKGKSASTKTVLKNIKVLAV 173

Query: 180 DHNIDS-DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWD 238
           D    + D + ++    TLE+TP +A+ L++  S  K+ L LR+     P   +   V  
Sbjct: 174 DQTAKTNDNKPVIVRAVTLEVTPKEAEKLLSENSKGKIQLALRN-----PHEVDKPVVAR 228

Query: 239 VQEEGKEIQIIKAGVIVN 256
                  + IIK     N
Sbjct: 229 RYTPRPSVTIIKGSQASN 246


>gi|260776716|ref|ZP_05885611.1| flp pilus assembly protein RcpC/CpaB [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607939|gb|EEX34204.1| flp pilus assembly protein RcpC/CpaB [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 247

 Score =  188 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 59/248 (23%), Positives = 109/248 (43%), Gaps = 19/248 (7%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNI 65
           ++  ++S  F L A   A + +        EV        +    +  ++  G V+    
Sbjct: 7   ILLFLLSIAFGLGAVFFAKQWMDRQLQPQTEVEVVEREPVVV---AAQEIPAGSVIGEQH 63

Query: 66  LEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSL 124
           L         + +    D  Q  + +EL G +V   I  G+ I   +L   G G  L++L
Sbjct: 64  LT------SKLLEKDWRDEFQFTSSEELIGQVVATSIFPGEIINQNRLTVPGEGSTLAAL 117

Query: 125 LPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNID 184
           +P+ KRA T+ ++    V G + P + VD++     SE   + + VL +I+V+A+D    
Sbjct: 118 IPENKRAVTIRVNDVIGVAGFLLPGNKVDILSTVKYSETSASTSTVLKDIKVLAVDQTAR 177

Query: 185 S-DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEG 243
           + D + ++    TLE+TP QA+ L+ A+S  ++ L LR+          + +    +   
Sbjct: 178 TKDNKPIIVRAVTLEVTPRQAEKLLTARSKGEIQLTLRNP--------HEEEKAVKRYVA 229

Query: 244 KEIQIIKA 251
             + IIK 
Sbjct: 230 PSVTIIKG 237


>gi|167566933|ref|ZP_02359849.1| putative pilus assembly protein CpaB [Burkholderia oklahomensis
           EO147]
          Length = 274

 Score =  188 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 60/208 (28%), Positives = 105/208 (50%), Gaps = 12/208 (5%)

Query: 33  QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQE 92
            +  ++  + +    V ++  D+ +G  + PN L  V +P  +V  G   DV      + 
Sbjct: 16  ASRWLVQTSSSAVTPVAVAAIDVNLGEPLVPNQLRVVNWPTASVPPGAFTDV------KS 69

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDH 151
           L+G +VR  + +G+P+   KL   G  GGLS+++  G RA T+ ++    V G   P ++
Sbjct: 70  LEGRVVRTSLARGEPVLGSKLAPVGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNY 129

Query: 152 VDVVMVRSLSE----RKPTVTVVLSNIRVIAIDHNIDSDER-VLVGSTATLELTPMQAKA 206
           VDV++          ++    +VL  I V+A+   +  D+    V +  TLE+TP QA+ 
Sbjct: 130 VDVIVNTQEQSKADPQQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVTPDQAEK 189

Query: 207 LVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           L  A+SV  LSLVLR+  D +  ++  +
Sbjct: 190 LDLARSVGTLSLVLRNQVDKDALNTGGA 217


>gi|167851181|ref|ZP_02476689.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           B7210]
          Length = 253

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 59/208 (28%), Positives = 105/208 (50%), Gaps = 12/208 (5%)

Query: 33  QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQE 92
            +  ++  + +    V ++  D+++G  + PN L  V +P  +V  G   D+        
Sbjct: 24  ASRWLVQTSSSAVTPVAVAATDVSLGEPLGPNQLRIVNWPTASVPPGAFTDLKP------ 77

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDH 151
           L+G +VR  + +G+P+   KL   G  GGLS+++  G RA T+ ++    V G   P ++
Sbjct: 78  LEGRVVRTSLARGEPVLGTKLAPVGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNY 137

Query: 152 VDVVMVRSLSE----RKPTVTVVLSNIRVIAIDHNIDSDER-VLVGSTATLELTPMQAKA 206
           VDV++          ++    +VL  I V+A+   +  D+    V +  TLE++P QA+ 
Sbjct: 138 VDVIVNTQEQSKADPQQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVSPEQAEK 197

Query: 207 LVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           L  A+SV  LSLVLR+  D +  S+  +
Sbjct: 198 LDLARSVGTLSLVLRNQVDKDTLSTGGA 225


>gi|149911410|ref|ZP_01900028.1| Flp pilus assembly protein CpaB [Moritella sp. PE36]
 gi|149805518|gb|EDM65523.1| Flp pilus assembly protein CpaB [Moritella sp. PE36]
          Length = 264

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 54/232 (23%), Positives = 107/232 (46%), Gaps = 15/232 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M    ++ + +S +F + A +IA   +  +           P   + +  S   + +G +
Sbjct: 1   MNKKTVISVAISIMFGIGAILIAQSWLDTNKPSA-------PENQVYIAFSTMVIPIGTI 53

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +    ++    PE    D  + D        E+ G++ +  I   D IRLE+L+ +G G 
Sbjct: 54  IEAKHIKLKILPESMSPDNTVTDP------DEIYGMIAKDTIYIDDIIRLERLLIKGQGS 107

Query: 121 -LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAI 179
            L+SL+ +  RA ++ +     V G + P + +D++   S +    +  V+L NI+++AI
Sbjct: 108 TLASLISENMRAVSIRVDDVVGVAGFLLPGNRIDILNTVSGNGGATSTEVILHNIKILAI 167

Query: 180 DHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           D     DE +  +    T+E+   QA+ L+ A++  +L L LR+  D +   
Sbjct: 168 DQRAAIDENKPQLVRAITVEVNLEQAEILMTARNQGRLQLALRNPTDSHAVD 219


>gi|193213116|ref|YP_001999069.1| Flp pilus assembly protein CpaB [Chlorobaculum parvum NCIB 8327]
 gi|193086593|gb|ACF11869.1| Flp pilus assembly protein CpaB [Chlorobaculum parvum NCIB 8327]
          Length = 263

 Score =  188 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 65/239 (27%), Positives = 119/239 (49%), Gaps = 18/239 (7%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
           + + + I ++ V   +A  IA R+ +     +E            V+I    +  G V+ 
Sbjct: 1   MKKPVIIAIALVLGAMAAYIAARMSTVQTDGSE----------AKVVIVAMPIDAGKVIA 50

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGL 121
           P+ ++ V +P   V               ++ G + RV ++ G+P+  +KL  +G  GGL
Sbjct: 51  PDQIKAVQWPSSAVPLNAFARTA------DVVGRVARVSMIAGEPVLPDKLALKGAKGGL 104

Query: 122 SSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDH 181
           +S LP+GKRA T+ ++   AV G   P  +VD+++      R+     VLS ++V+A+D 
Sbjct: 105 ASTLPEGKRAITVKVNEVIAVAGFALPGSYVDILVNGKDDNRRSFSRTVLSRVKVLAVDQ 164

Query: 182 NIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDV 239
               D ++  + +  T+EL+P +A+ L  A+++  LSLVLR+  D    +SE   + D+
Sbjct: 165 VTTGDPDKPKLVNAVTVELSPREAEKLDLARNIGNLSLVLRNELDTAEVNSEGVRLPDI 223


>gi|84387246|ref|ZP_00990267.1| Flp pilus assembly protein CpaB [Vibrio splendidus 12B01]
 gi|84377893|gb|EAP94755.1| Flp pilus assembly protein CpaB [Vibrio splendidus 12B01]
          Length = 249

 Score =  188 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 59/257 (22%), Positives = 109/257 (42%), Gaps = 17/257 (6%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVV 61
           K    +  ++S VF L A   A + +      T EV T    +   V+++  ++  G ++
Sbjct: 3   KSQVFLLFLLSVVFGLAAVFFAKQWMDDQVQPTVEVET---VERRPVVVASQEIEAGTII 59

Query: 62  TPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG- 120
               L       + + +    D        +L G +V   I  G+ +   +    G G  
Sbjct: 60  EDQFLTTRLMEVDWINENNYSDKA------DLIGKVVANTIYAGEVLHKLRFTVPGEGST 113

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
           L++L+P+ KRA T+ +     V G + P + VD++   S  +       VL +I+V+A+D
Sbjct: 114 LAALIPENKRAVTIRVDDVIGVAGFLLPGNKVDILNTISYGKNSAATQTVLKDIKVLAVD 173

Query: 181 HNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDV 239
               + E   ++    TLE+TP +A+ L+ A+S   + L LR+  ++      +  V   
Sbjct: 174 QTAKTKENSPIIVRAVTLEMTPKEAEKLLTAKSKGSIQLTLRNPHEV------EKKVVRR 227

Query: 240 QEEGKEIQIIKAGVIVN 256
                 + IIK     N
Sbjct: 228 YVPRPSVTIIKGTETSN 244


>gi|94309593|ref|YP_582803.1| Flp pilus assembly CpaB [Cupriavidus metallidurans CH34]
 gi|93353445|gb|ABF07534.1| Flp pilus assembly CpaB precursor [Cupriavidus metallidurans CH34]
          Length = 281

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 59/190 (31%), Positives = 101/190 (53%), Gaps = 12/190 (6%)

Query: 51  SKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRL 110
           +  DL +G  +  + L+ V++P  +V  G  +D       + LDG +VR  + +G+PI  
Sbjct: 42  AANDLDLGQPLNGSQLKLVSWPAGSVPPGAFEDP------KTLDGRVVRTSLQRGEPIID 95

Query: 111 EKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS----ERKP 165
            KL   G  GGLS+++  GKRA T+ ++    V G   P ++VDV++  +      +   
Sbjct: 96  AKLAPVGTKGGLSAVINDGKRAITVRVNDVVGVAGFALPGNYVDVIVNTNEDTKSAQNGS 155

Query: 166 TVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
              +VL  I V+A+   +  D+ +  V +  TLE++P QA+ L  A+SV  LSLVLR+  
Sbjct: 156 ISKIVLEKILVLAVAQQVSRDDTQPKVVNAVTLEVSPDQAEKLDVARSVGTLSLVLRNQM 215

Query: 225 DLNPSSSEDS 234
           D+   ++  +
Sbjct: 216 DVADINTGGA 225


>gi|150377241|ref|YP_001313836.1| SAF domain-containing protein [Sinorhizobium medicae WSM419]
 gi|150031788|gb|ABR63903.1| SAF domain protein [Sinorhizobium medicae WSM419]
          Length = 263

 Score =  188 bits (477), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 80/240 (33%), Positives = 123/240 (51%), Gaps = 11/240 (4%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
           + R++ ++++      A  +A   +      + EV     A    VL++  +L  G  + 
Sbjct: 1   MIRIVILLLALASGGAASWLA---LGMGDEPSVEVAEVEEAPAQEVLVAAAELKRGAAIE 57

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLS 122
            N L W  + E  +   FI    + +A  EL G L     + G+PIR +KL  RG G LS
Sbjct: 58  ENHLRWQPW-EGEIPPVFISRSSRADATTELKGSLALSDFVAGEPIREDKLAQRGTGYLS 116

Query: 123 SLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV-----RSLSERKPTVTVVLSNIRVI 177
           SLLP GKRA  + ++  S  GG I PNDHVDVV        +    K     +LSNIRV+
Sbjct: 117 SLLPSGKRAIAVRVTAESTAGGFILPNDHVDVVHTAVRPDAAGDAGKVVSRAILSNIRVL 176

Query: 178 AIDHNIDS--DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
           A+D  +    D   ++G TATLE+ P Q  A+ AA++   +SL LR+I+D + +S  +++
Sbjct: 177 AVDQTVSQAADGTSVIGKTATLEVNPEQIAAVAAAEASGTVSLALRAISDNHEASVVEAE 236


>gi|114705457|ref|ZP_01438365.1| pilus assembly protein cpaB [Fulvimarina pelagi HTCC2506]
 gi|114540242|gb|EAU43362.1| pilus assembly protein cpaB [Fulvimarina pelagi HTCC2506]
          Length = 282

 Score =  188 bits (477), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 94/267 (35%), Positives = 152/267 (56%), Gaps = 14/267 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQT---EEVITENPAKFINVLISKGDLAV 57
           M  ++++ + V+ + A+ AG++A+++ +P   +         + P K  +VLIS GD+ +
Sbjct: 10  MNRSQIIVVGVAALAAIGAGLLALKVSTPSQQEPVIITAAPAQPPVKLEDVLISSGDVPM 69

Query: 58  GMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG 117
           GM    N L W  +P + + +GFI    +P A+ EL+G + R     G+P+R  KL+   
Sbjct: 70  GMRFD-NGLSWQKWPVDGIGEGFILKNDRPEAIDELNGSIARQAFFAGEPVRSSKLIQSD 128

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT-----VTVVLS 172
           +G +S+LLP GKRA  + I+ ++A GG I PNDHVDV+M R +              VL 
Sbjct: 129 SGFMSALLPAGKRAVAVQIAAATAAGGFILPNDHVDVIMTRRVEGDGGANAKILTETVLR 188

Query: 173 NIRVIAIDHNID--SDERVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPS 229
           N+RV+AID  I+    +R +VGS ATLE+   QA+AL AAQ +A +  L LRS+AD  P 
Sbjct: 189 NLRVLAIDQTIEDAEGQRNVVGSVATLEVDGEQAEALTAAQQIADRFVLSLRSLADSIPG 248

Query: 230 SSEDSDVWDVQEEGKE--IQIIKAGVI 254
           S   +     +E+ +   ++I++ G +
Sbjct: 249 SPGYAAFLLAEEKARRGPVRIVRYGKV 275


>gi|28899194|ref|NP_798799.1| putative pilus assembly protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153836767|ref|ZP_01989434.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus AQ3810]
 gi|260361568|ref|ZP_05774595.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus K5030]
 gi|260876725|ref|ZP_05889080.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus AN-5034]
 gi|260898196|ref|ZP_05906692.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus Peru-466]
 gi|260900396|ref|ZP_05908791.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus AQ4037]
 gi|28807418|dbj|BAC60683.1| putative pilus assembly protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149749913|gb|EDM60658.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus AQ3810]
 gi|308089099|gb|EFO38794.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus Peru-466]
 gi|308091466|gb|EFO41161.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus AN-5034]
 gi|308109142|gb|EFO46682.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus AQ4037]
 gi|308114026|gb|EFO51566.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus K5030]
 gi|328474269|gb|EGF45074.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus 10329]
          Length = 251

 Score =  187 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 63/250 (25%), Positives = 114/250 (45%), Gaps = 17/250 (6%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNI 65
           +M +++S VF L A +IA + +   +  T E+      +   V+++  +L  G ++    
Sbjct: 7   IMLLLLSIVFGLAAVLIAKQWMDGRNQPTVEL---EEVERHPVVVATMELEPGTILDEKH 63

Query: 66  LEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-GLSSL 124
           L       + +      D       ++  G +V   I  G+ +   +L   G G  L++L
Sbjct: 64  LTTKLMEVDWI------DDETLKVPEQALGRIVANTIYAGELVNPNRLAQPGEGATLAAL 117

Query: 125 LPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT-VVLSNIRVIAIDHNI 183
           +P+ KRA T+ ++    V G + P + VDV+   S  + K   T  VL NI V+A+D   
Sbjct: 118 IPENKRAVTIRVNDVIGVAGFLLPGNKVDVLSTVSYGKGKQATTLTVLKNINVLAVDQTA 177

Query: 184 DS-DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEE 242
            + D + ++    TLE+TP +A+ L++A S  ++ L LR+     P   +   V      
Sbjct: 178 KTNDNKPVIVRAVTLEVTPKEAEKLLSANSKGEIQLALRN-----PHEVDKPVVAKKYTP 232

Query: 243 GKEIQIIKAG 252
              + IIK  
Sbjct: 233 RPSVTIIKGS 242


>gi|163751743|ref|ZP_02158961.1| hypothetical Flp pilus assembly protein [Shewanella benthica KT99]
 gi|161328395|gb|EDP99554.1| hypothetical Flp pilus assembly protein [Shewanella benthica KT99]
          Length = 270

 Score =  187 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 57/250 (22%), Positives = 117/250 (46%), Gaps = 20/250 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M    ++ +++S VF +VA  +A   +  +         +       V+     + +G +
Sbjct: 1   MNNKTMLFVLLSLVFGVVAVFLAQSWLESNSE------ADGLEATSTVITMATLVPLGAI 54

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +    L+    P   + +  I         +E +G++V+  +  G+ +R E+++ +G G 
Sbjct: 55  LERKHLKLTPMPNSVIPEAAIKT------FEEAEGMVVKHNLYSGEILRSERIIKKGEGS 108

Query: 121 -LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAI 179
            L+SL+    RA T+ ++    V G + P + VDV+ +           +VL+NI+++AI
Sbjct: 109 TLASLISPNMRAVTIRVNDVIGVAGFLLPGNRVDVLNLFKKDGSLH-TDIVLANIKILAI 167

Query: 180 DHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWD 238
           D    +DE +  +    TLE++  QA+ L+ A+   KL L LR+  D     S + ++  
Sbjct: 168 DQRSSNDENKPTLVRAVTLEMSLEQAETLLIAKGRGKLQLALRNPND-----SAEVELAL 222

Query: 239 VQEEGKEIQI 248
           + E+ +  +I
Sbjct: 223 INEKQQREEI 232


>gi|56697918|ref|YP_168289.1| CpaB family protein [Ruegeria pomeroyi DSS-3]
 gi|56679655|gb|AAV96321.1| CpaB family protein [Ruegeria pomeroyi DSS-3]
          Length = 305

 Score =  187 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 58/257 (22%), Positives = 105/257 (40%), Gaps = 14/257 (5%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMR----LVSPHHVQTEEVITENPAKFINVLISKGDLAV 57
           K+  + G+V+    AL  G + M         + +  E            V ++   L  
Sbjct: 17  KMRAVFGLVLIVGIALAGGAVMMARNYISAYQNELARERQARAQIVPTKTVYVASRPLRY 76

Query: 58  GMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG 117
           G  +T   +  V +PE  + +G   D       ++ +   V   + K + I   K+   G
Sbjct: 77  GERLTKEDVRAVNWPENAIPEGTFLDAAMLFPERQEENRYVLRAMEKDEAIMAIKVTKPG 136

Query: 118 -NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE--------RKPTVT 168
            + GL+S L +G RA  + + ++S V G ++P D VDV     LS         +     
Sbjct: 137 EDAGLTSQLARGMRAFAIKVDVTSGVSGFLRPGDRVDVYWTGGLSGATGPLEGMQGEITR 196

Query: 169 VVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLN 227
           ++ +NI+++AID     D     +  T T+   P Q  +L  AQ+  +L+L L    D  
Sbjct: 197 LIQTNIQIVAIDQISGGDVTGANIARTVTVAALPQQVASLAQAQTTGRLTLALVGADDDT 256

Query: 228 PSSSEDSDVWDVQEEGK 244
            +++ + D   +   G 
Sbjct: 257 IAAAVEVDQRMLLGLGA 273


>gi|167908128|ref|ZP_02495333.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           NCTC 13177]
          Length = 256

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 58/208 (27%), Positives = 104/208 (50%), Gaps = 12/208 (5%)

Query: 33  QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQE 92
            +  ++  + +    V ++  D+++G  + PN L  V +P  +V  G   D+        
Sbjct: 24  ASRWLVQTSSSAVTPVAVAATDVSLGEPLGPNQLRIVNWPTASVPPGAFTDLKP------ 77

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDH 151
           L+G + R  + +G+P+   KL   G  GGLS+++  G RA T+ ++    V G   P ++
Sbjct: 78  LEGRVARTSLARGEPVLGTKLAPVGTKGGLSAVIAPGHRAITVRVNDVVGVAGFALPGNY 137

Query: 152 VDVVMVRSLSE----RKPTVTVVLSNIRVIAIDHNIDSDER-VLVGSTATLELTPMQAKA 206
           VDV++          ++    +VL  I V+A+   +  D+    V +  TLE++P QA+ 
Sbjct: 138 VDVIVNTQEQSKADPQQSISKIVLEKILVLAVAQQVSRDDTAPKVVNAVTLEVSPEQAEK 197

Query: 207 LVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           L  A+SV  LSLVLR+  D +  S+  +
Sbjct: 198 LDLARSVGTLSLVLRNQVDKDALSTGGA 225


>gi|239908022|ref|YP_002954763.1| Flp pilus assembly CpaB domain protein [Desulfovibrio magneticus
           RS-1]
 gi|239797888|dbj|BAH76877.1| Flp pilus assembly CpaB domain protein [Desulfovibrio magneticus
           RS-1]
          Length = 300

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 64/252 (25%), Positives = 112/252 (44%), Gaps = 18/252 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK   +  I+++ + AL AG++ +R +        E   +  A  + V+++   +  G  
Sbjct: 1   MKTKAVPHIILAVILALTAGVLTIRWLGSVRAPKVE-QAKPAAPKVEVVVAARAIPKGGR 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG--N 118
           +  ++++   F  E    G + DV      QE  G +    I   DPI  +KL+ +G  +
Sbjct: 60  LDASMVKSKGFEAEAAPQGALRDV------QEAYGRISARDISPDDPITPDKLMPKGATS 113

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK---PTVTVVLSNIR 175
           GGL + +  GKRA T+  S     GG+I P   VDV++   +   K       ++L N+ 
Sbjct: 114 GGLDASVAPGKRAFTIKGSKIMGSGGLITPGCRVDVLVTYPVPNGKNDEKINKIILENVP 173

Query: 176 VIAIDHN----IDSDERVLVGST--ATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
           ++         I  D R  + +T   TL + P +A+ L  A     L L LR+  D +  
Sbjct: 174 ILTTGTERETKIGKDGREELANTDFYTLMVAPEEAERLALASDTGSLHLALRTPGDADIV 233

Query: 230 SSEDSDVWDVQE 241
           ++  +DV    E
Sbjct: 234 TTSGADVAKSLE 245


>gi|323491531|ref|ZP_08096710.1| Flp pilus assembly protein CpaB [Vibrio brasiliensis LMG 20546]
 gi|323314107|gb|EGA67192.1| Flp pilus assembly protein CpaB [Vibrio brasiliensis LMG 20546]
          Length = 247

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 53/224 (23%), Positives = 102/224 (45%), Gaps = 11/224 (4%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNI 65
           ++  ++S  F L A   A + +        EV        +   I+  ++  G V+    
Sbjct: 7   ILLFLLSIAFGLGAVFFAKQWMDNQLQPQTEVEVVEREPVV---IAAQEIPAGTVIEEQH 63

Query: 66  LEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSL 124
           +         + +       Q  A ++L G +V   +  G+ + + +L ++G G  L+SL
Sbjct: 64  IT------NKLLEKAWRSESQFTASEDLIGQVVASNVYPGEILHISRLANQGEGSTLASL 117

Query: 125 LPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNID 184
           +P+ KRA T+ ++    V G + P + VDV+      +       VL  I+V+A+D    
Sbjct: 118 IPENKRAVTIRVNDVIGVAGFLLPGNKVDVLNTIKYGKNSANTVTVLKEIKVLAVDQTAR 177

Query: 185 SDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLN 227
           + E + ++    TLE++P QA+ L++AQS   + L LR+  +  
Sbjct: 178 TKENKPIIVRAVTLEVSPRQAEKLLSAQSRGDIQLALRNPHEEE 221


>gi|99082185|ref|YP_614339.1| Flp pilus assembly CpaB [Ruegeria sp. TM1040]
 gi|99038465|gb|ABF65077.1| pilus assembly protein [Ruegeria sp. TM1040]
          Length = 287

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 60/254 (23%), Positives = 107/254 (42%), Gaps = 11/254 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVS--PHHVQTEEVITENPAKFINVLISKGDLAVG 58
           M+    + ++V    A  A ++A   +    H +  E    +     +NV ++   L  G
Sbjct: 1   MRAAFGLVLIVGVALAGGAVMMAKNYIEAYQHALAQERSNRDAAVPTVNVFVANKTLTYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQ-PNAMQELDGVLVRVPILKGDPIRLEKLVDRG 117
             +T   +  VA+PE  + +G   +  +   +    D   V   + K +P+   K+   G
Sbjct: 61  EELTKESVRSVAWPENALPEGVFHEEAELFPSDSPKDARFVLRTMEKNEPLLAVKVTAPG 120

Query: 118 -NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER------KPTVTVV 170
            + G++S L KG RA  + + ++S V G ++P D VDV        R           ++
Sbjct: 121 EDAGITSRLEKGMRAFAIRVDVASGVSGFLRPGDRVDVYWSGQPPARGGQELGGEVTRLI 180

Query: 171 LSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
            SNI +IA+D     D    ++  T T++  P +   L  AQ+  +LSL L    D   +
Sbjct: 181 QSNIELIAVDQMSGGDFSSAIIARTVTVKAQPEEVARLAQAQATGRLSLALVGAQDDTIA 240

Query: 230 SSEDSDVWDVQEEG 243
           S  + D   +   G
Sbjct: 241 SLVEVDQRALFGLG 254


>gi|218887828|ref|YP_002437149.1| Flp pilus assembly protein CpaB [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758782|gb|ACL09681.1| Flp pilus assembly protein CpaB [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 274

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 58/245 (23%), Positives = 111/245 (45%), Gaps = 17/245 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+ + L+ I ++ V ALVAG++  R +  +     ++      + + + ++  D+  G  
Sbjct: 1   MRASSLIQISLALVLALVAGVLVFRFMQVNRAAAPQMAA---PEQVELAVAAADVPRGAK 57

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-- 118
           +    ++   F + +   G       P       G ++   +  G+PI   +L+  G   
Sbjct: 58  LAAEQIKLAPFLKSSAPSGAFTKDTLP------VGRVLSSAVAAGEPITEARLLQDGASH 111

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT---VTVVLSNIR 175
           GG+S+L+  G RA  +  +    + G I+P + VDV++      R+ +     +VL N+R
Sbjct: 112 GGVSTLIAPGMRAVAVKGNKVLGLSGFIRPGNRVDVLVTLDDETREKSKSRTKLVLENVR 171

Query: 176 VIAIDHNIDSDERVLVGSTA---TLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSE 232
           V+A    +  +      S+    TLE++P QA+ L  A S  +L   LR+ AD     + 
Sbjct: 172 VLATGTELKQEGDDTSTSSVDVYTLEISPPQAEPLALAASRGELHFALRNPADDGTVLTP 231

Query: 233 DSDVW 237
            +DV 
Sbjct: 232 GTDVP 236


>gi|163742212|ref|ZP_02149600.1| CpaB family protein [Phaeobacter gallaeciensis 2.10]
 gi|161384542|gb|EDQ08923.1| CpaB family protein [Phaeobacter gallaeciensis 2.10]
          Length = 266

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 58/220 (26%), Positives = 96/220 (43%), Gaps = 8/220 (3%)

Query: 24  MRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDD 83
                 + +  E          ++V I+   L  G  +T   +  V +PE  + +G    
Sbjct: 6   YITAYQNELARERASRGENIPLVDVFIANTQLKYGERLTKEHIRSVRWPENAIPEGAFLT 65

Query: 84  VHQPNAMQELDG-VLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSA 141
           +      Q  D   +V   + K + I   K+   G + G++S L KG RA  + + +SS 
Sbjct: 66  MDALFPPQYPDDHRVVLRRMEKDEAILAVKVTKPGEDAGITSRLSKGMRAFAIRVDVSSG 125

Query: 142 VGGMIKPNDHVDVVMVRSLSER-----KPTVTVVLSNIRVIAIDHNIDSD-ERVLVGSTA 195
           V G ++P DHVDV    SL+++          ++ +NI +IA+D     D +  ++  T 
Sbjct: 126 VSGFLRPGDHVDVYWTGSLNDQNGGRNGEFTRLIQTNIELIAVDQTAGGDLDGAVIARTV 185

Query: 196 TLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
           T  + P Q  AL  AQS  +LSL L    D   +S  + D
Sbjct: 186 TAAVRPEQVAALAQAQSTGRLSLSLVGAGDDTVASVIEVD 225


>gi|89053489|ref|YP_508940.1| Flp pilus assembly CpaB [Jannaschia sp. CCS1]
 gi|88863038|gb|ABD53915.1| Flp pilus assembly CpaB [Jannaschia sp. CCS1]
          Length = 274

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 55/250 (22%), Positives = 103/250 (41%), Gaps = 3/250 (1%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M++  ++ + V    A  A  IA      +     E   +     + +++    L  G  
Sbjct: 1   MRIVFILVLAVGVGLAGFAVSIAKDRFDQYQTALAE-QRDAILPTVELIVVSRQLRYGEQ 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NG 119
           +TP+ ++ + +P E+V  G    + +     E     V   + + +PI L K+   G + 
Sbjct: 60  ITPDDVQLIRWPAEHVPFGAFTTMDELFPPDEEGARTVLRMMEQDEPILLVKVTAPGEDA 119

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAI 179
           G++S L  G RA  + + ++S V G ++P D VDV              ++ +N+++IAI
Sbjct: 120 GVASRLEAGMRAIALRVDVNSGVSGFLRPGDRVDVYWTGPGRNGDTVTRLIRANVQLIAI 179

Query: 180 DHNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWD 238
           D   D       +  T T+   P    AL  AQ    L+L L  + D       +     
Sbjct: 180 DQIADEQRNSPTIARTITVTARPEDVAALTQAQGSGSLTLALVGVGDETEQGEVEVSTSA 239

Query: 239 VQEEGKEIQI 248
           +  E +E+ +
Sbjct: 240 LLGEIEEVAV 249


>gi|197118221|ref|YP_002138648.1| Flp pilus assembly protein CpaB [Geobacter bemidjiensis Bem]
 gi|197087581|gb|ACH38852.1| Flp pilus assembly protein CpaB [Geobacter bemidjiensis Bem]
          Length = 289

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 58/253 (22%), Positives = 117/253 (46%), Gaps = 18/253 (7%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
           +TR   +    + AL+ G +A  + + +  +      + P + + +  +  DL +G  + 
Sbjct: 1   MTRPSAMTTVTIIALLLGGLATIMANNYLKKQ----ADKPYEGVPIASAAVDLPLGSKLN 56

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-- 120
              ++   +P++ +  G   D         L G +V  P+  G+ I   KL+   + G  
Sbjct: 57  ATQVKLATWPKDALPAGGYQDYKP------LVGRIVVRPLSAGEVITENKLMPLNSSGGI 110

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV----RSLSERKPTVTVVLSNIRV 176
           ++ ++P G RA T+ ++  + V G I PN  VDV++      S +ER     ++L N+ V
Sbjct: 111 MTYMVPDGHRAVTVSVNEVAGVAGFITPNSRVDVLLTIPRPGSTNERDNISKIILQNVPV 170

Query: 177 IAIDHNIDSDE--RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           +A     +  E  +  V  T TL++TP++A+ L+       L L+LR++ D+    ++ +
Sbjct: 171 LATGQVTEQKEGGKPGVVPTVTLDVTPIEAEKLIVGTKKGSLQLLLRNVIDVASVDTKGA 230

Query: 235 DVWDVQEEGKEIQ 247
            V       + +Q
Sbjct: 231 TVSRALGGTETLQ 243


>gi|254477805|ref|ZP_05091191.1| Flp pilus assembly protein CpaB [Ruegeria sp. R11]
 gi|214032048|gb|EEB72883.1| Flp pilus assembly protein CpaB [Ruegeria sp. R11]
          Length = 286

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 60/245 (24%), Positives = 106/245 (43%), Gaps = 10/245 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVS--PHHVQTEEVITENPAKFINVLISKGDLAVG 58
           M+    + ++V    A  A ++A   ++   + +  E          ++V I+   L  G
Sbjct: 1   MRAVFGLVLIVGIALAGGAVMMAKNYITAYQNALAEERASRGEVIPLVDVFIANEPLKYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFI-DDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG 117
             +TP  +  V +P+  + +G             E    +V   + K + I   K+   G
Sbjct: 61  ERLTPERVRAVRWPQNAIPEGAFLTAEELFPPQAEEKPRVVLRTMEKDEAILAIKVTKPG 120

Query: 118 -NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER-----KPTVTVVL 171
            + GL+S L +G RA  + + +SS V G ++P D VDV     + ++          ++ 
Sbjct: 121 EDAGLTSRLERGMRAFAIRVDVSSGVSGFLRPGDRVDVYWTGRVDDQTSERSGDFTRLIQ 180

Query: 172 SNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           +NI +IAID +  SD +   +  T T+   P Q  AL  AQS  +L+L L    D   +S
Sbjct: 181 ANIELIAIDQSAGSDLDGATIARTVTVSARPEQVAALAQAQSTGRLTLSLVGAEDDTVAS 240

Query: 231 SEDSD 235
             + D
Sbjct: 241 VIEVD 245


>gi|78186672|ref|YP_374715.1| pilus assembly protein CpaB [Chlorobium luteolum DSM 273]
 gi|78166574|gb|ABB23672.1| pilus assembly protein CpaB [Chlorobium luteolum DSM 273]
          Length = 266

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 65/232 (28%), Positives = 114/232 (49%), Gaps = 15/232 (6%)

Query: 10  VVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWV 69
            ++     +A  I  R +         V + +      V+I+   +  G  +  N L+ V
Sbjct: 8   AIALTLGAMAAFITARWMG-------VVQSRSEVSGPTVVIAARAIDAGTAIAENQLKAV 60

Query: 70  AFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD-RGNGGLSSLLPKG 128
            +P   V +G            ++ G + RV ++ G+P+   KL     +GGLSS++P G
Sbjct: 61  QWPRSTVPEGASART------DDVAGRIARVSMIAGEPVLPGKLAPTNASGGLSSIIPDG 114

Query: 129 KRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSD-E 187
           KRA T+ ++   AV G   P  +VD+++    +ER+P    VLS I+V+A+     ++ +
Sbjct: 115 KRAITVKVNEVIAVAGFALPGSYVDILVSGRDAERQPFSRTVLSRIKVLAVAQETTAEPD 174

Query: 188 RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDV 239
           +  V +  TLELTP +++ L  A+S+  LSLVLR+  D    +S    + D+
Sbjct: 175 KPKVVNAVTLELTPHESETLDLARSIGVLSLVLRNELDTGEINSAGVRLADI 226


>gi|94497253|ref|ZP_01303825.1| Flp pilus assembly CpaB [Sphingomonas sp. SKA58]
 gi|94423358|gb|EAT08387.1| Flp pilus assembly CpaB [Sphingomonas sp. SKA58]
          Length = 337

 Score =  185 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 68/266 (25%), Positives = 124/266 (46%), Gaps = 19/266 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVIT-ENPAKFINVLISKGDLAVGM 59
           M   +++ +V + + A+   ++A  ++S     +         A   +VL++   L VG 
Sbjct: 1   MDAKKIVLLVGALIIAVTTALLARNMLSSSSTPSVNAANMPVEADQPHVLVAVKALPVGT 60

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
           ++      +  +P++ V   +        A   L G ++R  I  G P+    LV  G+ 
Sbjct: 61  ILDAESFRFQPWPKDLVEQAYYLRGQADPA--RLAGSVIRTAITAGQPLTQGSLVKPGDR 118

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK-----PTVTVVLSN 173
           G L++ L  G RA T+ +S  ++V G + P D +D+V+ +S++             +L N
Sbjct: 119 GFLAAALAPGMRAVTVPVSAQTSVAGFVFPGDRIDLVLTQSVAGGGDGEPLKVSETILRN 178

Query: 174 IRVIAIDHNIDS---DERVLV--GSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD--- 225
           +RV+A D  +D+   D + +V   S  TLE+TP  A+ +  AQ+V  LS+ LRS+AD   
Sbjct: 179 LRVLATDQRMDALGPDGKPVVQTYSNVTLEVTPKIAEKIAVAQTVGSLSMSLRSMADTPS 238

Query: 226 --LNPSSSEDSDVWDVQEEGKEIQII 249
                 +  D D+ +      E  I+
Sbjct: 239 DLDAAIAGADVDLPEGASPAAEKAIL 264


>gi|329890997|ref|ZP_08269340.1| flp pilus assembly protein CpaB [Brevundimonas diminuta ATCC 11568]
 gi|328846298|gb|EGF95862.1| flp pilus assembly protein CpaB [Brevundimonas diminuta ATCC 11568]
          Length = 310

 Score =  185 bits (471), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 78/302 (25%), Positives = 127/302 (42%), Gaps = 50/302 (16%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  ++  I ++ + A+   ++   + S                   VL++  DL  G  
Sbjct: 1   MKPAKIAVICIAALAAIGLALVVRAMGSSGQPTATATAAVETRPMAKVLVAARDLEPGRR 60

Query: 61  VTPNILEWVAFPEENVFDGFIDD------------------------------------- 83
           +    L W  +P + +   FI D                                     
Sbjct: 61  LVDADLSWKDWPADELNPLFITDGPPPPSKAEGAAAENAAVEGAGDAKSTTVDKAMKAVA 120

Query: 84  -VHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSA 141
            ++ P A  +  G +VR PIL G+P+   K+V  G+ G +++ L  G RA  + +++ +A
Sbjct: 121 ELNTPGAKSDYIGAVVREPILAGEPLVARKIVRAGDSGYMAAYLEPGMRAMAIRVTVETA 180

Query: 142 VGGMIKPNDHVDVVMVR------SLSERKPTVTVVLSNIRVIAIDHNID--SDERVLVGS 193
            GG I P D VDV++ R           K +   V+ N++V+AID +     DE+ +VG+
Sbjct: 181 AGGFILPGDRVDVLLTREVKGSGDDGGTKYSAATVMRNVKVLAIDQSTRAAEDEQAVVGA 240

Query: 194 TATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS---SEDSDVWDVQEEGKEIQIIK 250
           TATLELT   A+ L  A+S  +LSLVLRS AD    S               G  +++ +
Sbjct: 241 TATLELTGRDAEVLALAKSEGELSLVLRSYADTAGPSGHVPGAVRGRATGGGGSVVRVYR 300

Query: 251 AG 252
            G
Sbjct: 301 EG 302


>gi|283852072|ref|ZP_06369346.1| Flp pilus assembly protein CpaB [Desulfovibrio sp. FW1012B]
 gi|283572462|gb|EFC20448.1| Flp pilus assembly protein CpaB [Desulfovibrio sp. FW1012B]
          Length = 300

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 64/252 (25%), Positives = 110/252 (43%), Gaps = 16/252 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK   +  ++++ + ALVAG++ +R +       E        K I VL++   LA G  
Sbjct: 1   MKSKAIPHMILAVILALVAGVLTIRWLGSVRGTGEPGKPAAETKKIEVLVAARPLAKGAR 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-- 118
           +   ++    +  E    G + D        E+ G +    I + DPI  +KL+ +G   
Sbjct: 61  LDTTMVRLKPYDPEAAPLGAMRDAS------EVVGRVTAREISQDDPITPDKLLPKGAAG 114

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV--RSLSERKPTVTVVLSNIRV 176
           GGL + +  GKRA T+  +     GG+I P   VDV+    +     +    V+L NI V
Sbjct: 115 GGLDASVEPGKRALTVKGTKVMGSGGLITPGCRVDVLSTYNQPGKADEKVTKVILENIPV 174

Query: 177 IAIDH----NIDSDERVLVGST--ATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           +         +  D R  + +T   TL +TP +A+ L  A  +  + L LR   D +  +
Sbjct: 175 LTTGTEREVRVGQDGREELANTDFFTLMVTPEEAERLALASDLGNMHLALRKPGDDDVVA 234

Query: 231 SEDSDVWDVQEE 242
           +  +DV    + 
Sbjct: 235 TAGADVARSLDA 246


>gi|114799072|ref|YP_761692.1| pilus assembly protein CpaB [Hyphomonas neptunium ATCC 15444]
 gi|114739246|gb|ABI77371.1| pilus assembly protein CpaB [Hyphomonas neptunium ATCC 15444]
          Length = 281

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 83/269 (30%), Positives = 135/269 (50%), Gaps = 19/269 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTE-----EVITENPAKFINVLISKGDL 55
           M   R++ ++++ V A  A ++  R+  P  V         +I +     I VL +  DL
Sbjct: 1   MSPIRIIILLLALVAAGGAALLVSRMSQPQVVTETVTRDNNIIEKEQVSEIKVLTASRDL 60

Query: 56  AVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD 115
            +G  +    L+W  +PE  V +G   +   P A++EL G +V++PI K +PI  +++V 
Sbjct: 61  TIGEQIKAEDLQWSIWPELGVAEGQYTETAAPGAVEELTGAVVKMPIYKLEPIMPQRVVK 120

Query: 116 RGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL--------SERKPT 166
           RG  G L  L+ +  RA ++ IS  SA GG I PND VD+++            +  +  
Sbjct: 121 RGEAGLLPVLMGEDMRAVSIGISPESASGGFILPNDRVDLILTYEQTPSATNGLTSARTV 180

Query: 167 VTVVLSNIRVIAIDHNI---DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSI 223
              VL N+RV+AID      + +E   +G TATLE+ P +A+ +  +QS  +LSL LR +
Sbjct: 181 SMTVLQNVRVLAIDQTYAPGEPEESTRIGQTATLEVLPSEAELVALSQSKGQLSLALRPL 240

Query: 224 ADLNPSSS--EDSDVWDVQEEGKEIQIIK 250
            DL  SS      ++    E    + II+
Sbjct: 241 NDLAVSSPRKPRLELNGGDEGEGAVMIIR 269


>gi|254293213|ref|YP_003059236.1| Flp pilus assembly protein CpaB [Hirschia baltica ATCC 49814]
 gi|254041744|gb|ACT58539.1| Flp pilus assembly protein CpaB [Hirschia baltica ATCC 49814]
          Length = 321

 Score =  185 bits (470), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 79/237 (33%), Positives = 125/237 (52%), Gaps = 16/237 (6%)

Query: 35  EEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELD 94
            EV        + VL++  DL VG  V    L W ++PEE+    F  +   P+A++ + 
Sbjct: 43  SEVGQAEQIPVLKVLVATTDLKVGQFVKEGQLSWQSWPEESNTSSFFTEEMSPDAIEAMQ 102

Query: 95  GVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVD 153
           G +VR  ++ G+P+  EK+V  G  G ++++L  G RA  ++IS  +A GG I PNDHVD
Sbjct: 103 GAVVRTNMMAGEPLTSEKVVHPGEAGFMAAVLTPGMRAVAVEISAETAAGGFIFPNDHVD 162

Query: 154 VVMVRSLSERKPT-------VTVVLSNIRVIAIDHNI----DSDERVLVGSTATLELTPM 202
           V++   +   +PT       +  +L+N+RV+AID       +     +VG  ATLEL+  
Sbjct: 163 VLLTFEVDVERPTGITEETAIDTILNNVRVLAIDGYYRPVEEEAGDAVVGHRATLELSKQ 222

Query: 203 QAKALVAAQSVAKLSLVLRSIAD-LNPSSSEDSDVWDVQEEGK---EIQIIKAGVIV 255
            A  L+AAQ    LSLVLRSI++   PS +  + +      G     +++ + GV V
Sbjct: 223 DAMVLMAAQERGDLSLVLRSISELSGPSGATANGLAMASRRGAGSDGVRVFQKGVSV 279


>gi|260462608|ref|ZP_05810814.1| Flp pilus assembly protein CpaB [Mesorhizobium opportunistum
           WSM2075]
 gi|259031514|gb|EEW32784.1| Flp pilus assembly protein CpaB [Mesorhizobium opportunistum
           WSM2075]
          Length = 351

 Score =  185 bits (469), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 60/254 (23%), Positives = 115/254 (45%), Gaps = 12/254 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+   ++ IV++GVF ++A ++A   ++    Q   +   N  +   V+++   L  G +
Sbjct: 1   MRANTIIMIVLAGVFGVLAVVLANIWLAN---QRGAIAQTNEVQRDTVVVAAVALKFGDI 57

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDG---VLVRVPILKGDPIRLEKLVDRG 117
           ++ + L  VA+P   V  G      +        G         I   +P+   K+   G
Sbjct: 58  LSADKLREVAWPAGAVPAGAFKTTEELLTKDLPVGGGTKQALQSIGVNEPVLATKITGPG 117

Query: 118 N-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT----VTVVLS 172
               LS++L +G +A ++ ++    V G + P D VD+++ R++ +   T    V V+L 
Sbjct: 118 QRATLSAVLGEGMKAVSIRVNDVLGVAGFVFPGDRVDILLTRTVRDDDGTDKSFVDVLLQ 177

Query: 173 NIRVIAIDHNIDS-DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSS 231
           +++V+A+D   D   +   V  + TLE +   A+ L  A    +LSL LR  A     ++
Sbjct: 178 SMKVLAVDQVADESKDSPTVVKSVTLEASTKDAQKLTLAAGAGQLSLALRQAAASKGETT 237

Query: 232 EDSDVWDVQEEGKE 245
           E   + D+  E   
Sbjct: 238 ERITLSDLTGETPA 251


>gi|78186538|ref|YP_374581.1| pilus assembly protein CpaB [Chlorobium luteolum DSM 273]
 gi|78166440|gb|ABB23538.1| pilus assembly protein CpaB [Chlorobium luteolum DSM 273]
          Length = 262

 Score =  185 bits (469), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 60/239 (25%), Positives = 117/239 (48%), Gaps = 19/239 (7%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
           + + +   ++ +   +A   A R V+         + ++      V+I    + +G  +T
Sbjct: 1   MKKPIIAAIALILGAMAAFTAARWVN---------VAQHTGP--KVVIVALPIELGKAIT 49

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGL 121
              ++ V +P  +   G   +        ++   + RV ++ G+P+   KL  +G  GGL
Sbjct: 50  AEQIKAVNWPGTDAPQGAYANTA------DVVSRIARVSMMPGEPVLPGKLAPKGATGGL 103

Query: 122 SSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDH 181
           +S++P GKRA T+ ++   AV G   P  +VDV++    +  +P    VL+ ++V+AI  
Sbjct: 104 ASIIPDGKRAITVKVNEVIAVAGFALPGSYVDVLVSGKDASHQPFARTVLNRVKVLAIAQ 163

Query: 182 NIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDV 239
              ++ ++  V +  TLELTP +++ L  A+S+  LSLVLR+  D    +S    + D+
Sbjct: 164 ETTAEPDKPKVVNAVTLELTPHESEKLDLARSIGSLSLVLRNELDTGEENSAGVRMSDL 222


>gi|194335912|ref|YP_002017706.1| Flp pilus assembly protein CpaB [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194308389|gb|ACF43089.1| Flp pilus assembly protein CpaB [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 263

 Score =  184 bits (468), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 61/241 (25%), Positives = 113/241 (46%), Gaps = 20/241 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  + + + ++ +   +A  +A R +S                   V++ +  +  G  
Sbjct: 1   MKPQQFV-LAIALILGAMAAFLAARWMS-----------VAQTSMSRVVVVEQPIEAGKA 48

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR-GNG 119
           +  + +  + +P   V       +        + G +  V ++ G+P+   KL      G
Sbjct: 49  IKAHQIRSIDWPGSAVPRDASTRIAS------VVGRIALVSMMPGEPVLPGKLAPTTATG 102

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAI 179
           GLSS++PKGKRA T+ ++   AV G   P  +VDV++    + ++P    VL  ++V+AI
Sbjct: 103 GLSSIIPKGKRAITVKVNEVIAVAGFALPGSYVDVLVSSKDANQQPFSVTVLLRVKVLAI 162

Query: 180 DHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWD 238
                +D ++  V +  TLELTP +A+ L  A+++  LSLVLR+  D    +S    + D
Sbjct: 163 AQETTADRDKPKVVNAVTLELTPHEAEKLDLARNIGALSLVLRNEFDTGKINSAGVRLSD 222

Query: 239 V 239
           +
Sbjct: 223 I 223


>gi|85859140|ref|YP_461342.1| flp pilus assembly protein [Syntrophus aciditrophicus SB]
 gi|85722231|gb|ABC77174.1| flp pilus assembly protein [Syntrophus aciditrophicus SB]
          Length = 295

 Score =  184 bits (468), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 55/246 (22%), Positives = 108/246 (43%), Gaps = 19/246 (7%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVV 61
           K   L+ +  +   AL+  ++A   +     Q        P +   V+++  D+    V+
Sbjct: 3   KKKHLIFLGGAVFLALIVTLLAYNWI-----QKTATAKAKPQEMQKVVVAAFDVPWSTVL 57

Query: 62  TPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG--NG 119
           T +++    F +E++ +G+  D  Q      + G  V  PI   +PI   +L       G
Sbjct: 58  TKDMVRTATFLKESLPNGYYLDPAQ------IVGRTVIQPIRTNEPITEARLAPTSIRTG 111

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK---PTVTVVLSNIRV 176
           G+++++   KRA ++ +     V G I P + VDV++  +    +   P   +VL NI V
Sbjct: 112 GVAAVITPSKRAMSVKVDKVVGVSGYIHPGNRVDVLVTLNEQRGEVTAPVTKIVLENILV 171

Query: 177 IAID---HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
           +A     +     E+       TLE+TP + + L  A +  K+ L LR+  D    ++  
Sbjct: 172 LASGPEFNETKKGEKPANVDVITLEVTPEEGEKLALASTEGKIQLALRNFGDNEAVATRG 231

Query: 234 SDVWDV 239
           + + ++
Sbjct: 232 AKIPNL 237


>gi|90411207|ref|ZP_01219220.1| hypothetical Flp pilus assembly protein [Photobacterium profundum
           3TCK]
 gi|90328053|gb|EAS44374.1| hypothetical Flp pilus assembly protein [Photobacterium profundum
           3TCK]
          Length = 266

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 64/267 (23%), Positives = 117/267 (43%), Gaps = 30/267 (11%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVS------PHHVQTEEVITENPAKFINV------- 48
           K    + + +S +  L A I+A   +           +  E +T+   +   V       
Sbjct: 3   KGKIFLTLFISIMMGLGALILANNWLQSKQANLNSQTKPSEPVTQVEVQIKEVMKEEPKV 62

Query: 49  --LISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
             + ++  + +G  +    L    +P + V              +++ G+L R  I +GD
Sbjct: 63  PRVTAQQRIPLGTKIEAKHLSIEYYPTDLVS------TKGYETPEQVVGMLARNEIFEGD 116

Query: 107 PIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP 165
            +R E+LV  G G  L++L+    RA T+ ++    V G + P D VDV+  +  S    
Sbjct: 117 LLRKERLVTPGEGTTLAALISPNMRAVTIRVNDVIGVAGFLLPGDFVDVIYTKEKSNN-- 174

Query: 166 TVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
               VL  I+++A+D    +D+ + ++    TLELTP QA++LV A+S  +L L LR+  
Sbjct: 175 -AVTVLKKIKILAVDQTARTDDSKPVIVRAVTLELTPKQAESLVTAKSKGELQLSLRNPN 233

Query: 225 DLNPSSSEDSDVWDVQEEGKEIQIIKA 251
           D+    ++       +     + IIK 
Sbjct: 234 DIEKIKTKRVY----RRTTDAVTIIKG 256


>gi|258405292|ref|YP_003198034.1| Flp pilus assembly protein CpaB [Desulfohalobium retbaense DSM
           5692]
 gi|257797519|gb|ACV68456.1| Flp pilus assembly protein CpaB [Desulfohalobium retbaense DSM
           5692]
          Length = 295

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 54/245 (22%), Positives = 104/245 (42%), Gaps = 13/245 (5%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPH--HVQTEEVITENPAKFINVLISKGDLAVGM 59
           +L  L+ I ++ V A+   +     +        T E   E       V+++  D++ G 
Sbjct: 3   RLRALIPIALALVIAIAGSVFIYNWMQEQTTRQDTVEKAREKAPSTQEVVVAALDISAGS 62

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-- 117
            +T  +L+   + ++N+  G   D  Q      L G +   P  K +PI   +L      
Sbjct: 63  QLTEEMLQTGQYLKKNLPPGSFTDPDQ------LLGRVALAPFKKNEPIVDHRLAPTDIK 116

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV-RSLSERKPTVTVVLSNIRV 176
           +GG+S+L+ KG RA ++  +    + G + P   VDV++        +     +L N+++
Sbjct: 117 SGGVSALISKGNRAVSLGGNKVLGISGFVLPGSRVDVMVTWNDPDSGEQITKRILDNVKI 176

Query: 177 IAIDHNIDSDER--VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           +A    +   E          TLE+TP +A+ L   ++   L + LR+  D  P  ++ +
Sbjct: 177 LATSTKMQETESGGTAPVDVYTLEVTPEEAEILTHIRNQGSLQMALRNPTDNEPVMTDGA 236

Query: 235 DVWDV 239
              D 
Sbjct: 237 TAKDS 241


>gi|13475418|ref|NP_106982.1| pilus assembly protein [Mesorhizobium loti MAFF303099]
 gi|14026170|dbj|BAB52768.1| pilus assembly protein [Mesorhizobium loti MAFF303099]
          Length = 354

 Score =  183 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 61/254 (24%), Positives = 112/254 (44%), Gaps = 12/254 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+   ++ IV++GVF ++A ++A   ++    Q   +   N  +   V+++   L  G  
Sbjct: 1   MRANTVIMIVLAGVFGVLAVVLANIWLAN---QRSAIAQTNDIQRDTVVVAAVALKFGDT 57

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILK---GDPIRLEKLVDRG 117
           ++ + L  VA+P   V  G      +      L G   +  +      +P+   K+   G
Sbjct: 58  LSADKLREVAWPAGAVPAGAFKTTEELLTKDVLPGAAPKQALQAIGVNEPVLATKITGPG 117

Query: 118 NG-GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVR----SLSERKPTVTVVLS 172
               LS++L +G +A ++ ++    V G + P D VDV++ R         +  V V+L 
Sbjct: 118 QRATLSAVLGEGMKAVSIRVNDVLGVAGFVFPGDRVDVLLTRTVRSDDGADQSFVDVLLQ 177

Query: 173 NIRVIAIDHNIDS-DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSS 231
            +RV+A+D   D   +   V  + TLE +   A+ L  A    +LSL LR  A     ++
Sbjct: 178 GMRVLAVDQVADESKDSPTVVKSVTLEASTKDAQKLTLAAGAGQLSLALRQAAASKGETT 237

Query: 232 EDSDVWDVQEEGKE 245
           E   + D+  E   
Sbjct: 238 ERVTLSDLTGEMPA 251


>gi|167648153|ref|YP_001685816.1| Flp pilus assembly protein CpaB [Caulobacter sp. K31]
 gi|167350583|gb|ABZ73318.1| Flp pilus assembly protein CpaB [Caulobacter sp. K31]
          Length = 296

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 78/295 (26%), Positives = 135/295 (45%), Gaps = 43/295 (14%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPA--KFINVLISKGDLAVG 58
           M   R+M ++++ V A+   ++  +++S             P       VL++K DLA+G
Sbjct: 1   MNPLRVMIVLIAAVSAIGLAVVMQKMMSGKAPSAPIAQASAPVGKPMTQVLVAKRDLAIG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQP-------------------------NAMQEL 93
             +T   + W  +P + +   FI +                                + +
Sbjct: 61  QRLTAADVTWQPWPSDTINAAFITNGAADPVPAKATAKAAKAVGDVAEGMIGGVTPEKAV 120

Query: 94  DGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHV 152
           +G +VR PIL G+PI   K+V  G GG LS +L  GKRA  + ++  +AVGG + P D V
Sbjct: 121 EGAIVRDPILAGEPITSRKIVRGGEGGYLSVVLSPGKRAMAVPVTSETAVGGFVLPGDRV 180

Query: 153 DVVMVRS---------LSERKPTVTVVLSNIRVIAIDH--NIDSDERVLVGSTATLELTP 201
           DV+  R           S +      ++ N+RV+A+D     + D + +V +TATLE+ P
Sbjct: 181 DVIQTREAQSVGEGEGASGKHTIAETIVQNVRVLALDQATAAEKDAKTIVATTATLEVGP 240

Query: 202 MQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAGVIVN 256
           ++A+AL  A++   ++L LR+  DL   S     +    +E   ++I + G   N
Sbjct: 241 IEAEALTRAKAAGPVTLTLRAYTDLGGPSG----LAVRSQEASVVRINRGGETSN 291


>gi|254506783|ref|ZP_05118923.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus 16]
 gi|219550364|gb|EED27349.1| Flp pilus assembly protein CpaB [Vibrio parahaemolyticus 16]
          Length = 233

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 51/215 (23%), Positives = 94/215 (43%), Gaps = 11/215 (5%)

Query: 15  FALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEE 74
           F L A   A + +        E+      +   V+I+  ++  G  +    +       E
Sbjct: 2   FGLGAVFFAKQWMDRQLQPQTEL---EVVEREPVIIASQEIPAGTPIEEQHITTKLLEVE 58

Query: 75  NVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAAT 133
              +G   D +       + G +V   I  G+ +   +L   G G  L+SL+P+ KRA T
Sbjct: 59  WRNEGQFTDQN------AILGQVVATTIFPGEVLHQNRLTVPGEGSTLASLIPENKRAVT 112

Query: 134 MDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVG 192
           + ++    V G + P + VDV+     S        VL +I+V+A+D    + E + ++ 
Sbjct: 113 IRVNDVIGVAGFLLPGNRVDVLNTIKYSATSANTVTVLKDIKVLAVDQTARTKENKPIIV 172

Query: 193 STATLELTPMQAKALVAAQSVAKLSLVLRSIADLN 227
              TLE++P  A+ L+ A+S  ++ L LR+  +  
Sbjct: 173 RAVTLEVSPKDAEKLLTARSKGEIQLTLRNPHEEE 207


>gi|294012240|ref|YP_003545700.1| Flp pilus assembly protein CpaB [Sphingobium japonicum UT26S]
 gi|292675570|dbj|BAI97088.1| Flp pilus assembly protein CpaB [Sphingobium japonicum UT26S]
          Length = 295

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 68/228 (29%), Positives = 110/228 (48%), Gaps = 9/228 (3%)

Query: 22  IAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFI 81
           +A   V+  ++   E +         V+++   L  G  VT   +  V +P  +V  G  
Sbjct: 4   LAAVFVANSYLSRAEKVPPPEGGMAKVVVATVSLPFGSAVTAEKIRVVDWPANSVPPGAF 63

Query: 82  DDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISS 140
            D  Q  ++    G +V   I  G+PI   KL   G    +S++L    RA  + +S  +
Sbjct: 64  RDPIQLTSLG--KGRVVLRQIEPGEPILASKLSGEGGRATMSAVLAPEMRAVAVRVSDVA 121

Query: 141 AVGGMIKPNDHVDVVMVRSLSE-----RKPTVTVVLSNIRVIAIDHNI-DSDERVLVGST 194
           A GG + P D VDV + R+L +      +    V+L   RVIAID N  D+ +   VG T
Sbjct: 122 AAGGFVLPGDTVDVFVTRTLQDPMGGASQQITDVLLQGTRVIAIDQNANDTSKDPAVGKT 181

Query: 195 ATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEE 242
           ATLE+  + A+ LV AQ V +L+LVLR++ D    + +   + D+++ 
Sbjct: 182 ATLEVNQVDAQKLVLAQQVGQLTLVLRNLTDKPNPAVQTVGIEDLRDG 229


>gi|304320646|ref|YP_003854289.1| CtpC protein [Parvularcula bermudensis HTCC2503]
 gi|303299548|gb|ADM09147.1| CtpC protein [Parvularcula bermudensis HTCC2503]
          Length = 253

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 75/259 (28%), Positives = 122/259 (47%), Gaps = 15/259 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAK----FINVLISKGDLA 56
           MK  RL+ ++V+      A  +   L           +   P +       V+ S  D+ 
Sbjct: 1   MKAARLLILLVAIAAGGAAFFM---LAGNDEPAVTTAVPTAPIQPRMAMAEVMFSAKDIP 57

Query: 57  VGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR 116
            G +++  +++WV +P  NV + FI    Q + +  L     R+ I    PI     V  
Sbjct: 58  QGAILSEGMVKWVKWPSANVPEFFITKDDQ-DFIDNLGLRRARLRIDANQPIYGVNTVAH 116

Query: 117 GNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIR 175
           G+ G L+S+L  G RA T  + +    GG I P D VD+       + +   + +L NIR
Sbjct: 117 GDRGMLASILTPGMRAVTARMGLEETSGGFILPGDRVDIFATGIGDDGQMETSAILRNIR 176

Query: 176 VIAIDH--NIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
           V+AID   N+  ++  L GST T EL+P Q  + + A+   +L+LVLRS+ DL+P +   
Sbjct: 177 VLAIDQVTNVTDEQTALNGSTVTFELSPAQVPSFIGARDNKQLTLVLRSVYDLSPET--G 234

Query: 234 SDVWDVQEEGKEIQIIKAG 252
             + D   E  E+ +I+ G
Sbjct: 235 MPIVDTSPE--EVVVIRFG 251


>gi|259417281|ref|ZP_05741200.1| Flp pilus assembly protein CpaB [Silicibacter sp. TrichCH4B]
 gi|259346187|gb|EEW58001.1| Flp pilus assembly protein CpaB [Silicibacter sp. TrichCH4B]
          Length = 267

 Score =  182 bits (463), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 56/226 (24%), Positives = 95/226 (42%), Gaps = 9/226 (3%)

Query: 27  VSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFI-DDVH 85
              + +  E    E     +NV ++   L  G  +T   +  VA+PE  + +G   ++  
Sbjct: 9   AYQNALAHERSNREAAVPTVNVFVANKTLTYGEELTKENVRAVAWPENALPEGIFSEESD 68

Query: 86  QPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGG 144
              +    D   V   + K +P+   K+   G + G++S L KG RA  + + ++S V G
Sbjct: 69  LFPSDSPKDARYVLRTMEKNEPLLAVKITAPGEDAGITSRLEKGMRAFAIRVDVASGVSG 128

Query: 145 MIKPNDHVDVVMVRSLSER------KPTVTVVLSNIRVIAIDHNIDSD-ERVLVGSTATL 197
            ++P D VDV        R           ++ SNI +IA+D     D    ++  T T+
Sbjct: 129 FLRPGDRVDVYWSGQPPARSGQERSGEVTRLIQSNIELIAVDQMSGGDFSNAIIARTVTV 188

Query: 198 ELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEG 243
           +  P +   L  AQS  +LSL L    D   +S  + D   +   G
Sbjct: 189 KAQPEEVARLAQAQSTGRLSLALVGAQDDTIASLVEVDQRSLFGLG 234


>gi|296284551|ref|ZP_06862549.1| Flp pilus assembly protein CpaB [Citromicrobium bathyomarinum
           JL354]
          Length = 353

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 77/270 (28%), Positives = 130/270 (48%), Gaps = 15/270 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFIN-VLISKGDLAVGM 59
           M   +L+ ++ + V A     IA  + +          T         VL+++  L VG 
Sbjct: 1   MDRKKLVLLLAALVIAAGTAFIARSMFAGASAPEVAAATGPVEPTGPRVLVAQRSLPVGT 60

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
           ++T + + + A+P+E V D +  D      + +L G +VR  I  G+P+    LV  G+ 
Sbjct: 61  IITQDAISYQAWPQELVRDAYFIDGEA--DVSKLLGTVVRYQITAGEPVTQGALVAPGDR 118

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIA 178
           G L++ L  G RA T+ ++  ++V G + P D VD++M    +E       +L N+RV+A
Sbjct: 119 GFLAAALGPGMRAITVPVNAQTSVAGFVFPGDRVDLMMTHE-TEGVKATETILRNLRVLA 177

Query: 179 IDHNIDS---DERVLV--GSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLN-----P 228
            D +      D + +V   ST TLE+TP  A+ +  AQ+V  LSL LRSIAD +      
Sbjct: 178 TDQSTSQNTVDGQTVVNGFSTVTLEVTPKIAEKIAVAQTVGTLSLSLRSIADNSTDLERA 237

Query: 229 SSSEDSDVWDVQEEGKEIQIIKAGVIVNKD 258
            +S D  + D     +E +++     +  D
Sbjct: 238 LASGDIAIPDDATPEEEARLLARARNMPSD 267


>gi|260574617|ref|ZP_05842620.1| Flp pilus assembly protein CpaB [Rhodobacter sp. SW2]
 gi|259023034|gb|EEW26327.1| Flp pilus assembly protein CpaB [Rhodobacter sp. SW2]
          Length = 284

 Score =  182 bits (462), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 54/243 (22%), Positives = 103/243 (42%), Gaps = 8/243 (3%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHV--QTEEVITENPAKFINVLISKGDLAVG 58
           M++   + +VV    A  A  +A   +S        E          + V +    L  G
Sbjct: 1   MRMVFGLVLVVGLALAGFAVYMAQGFISQTQAELAQERAARAKAGPLVEVYVVNKPLNYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG- 117
             +T   ++ + +P+  + +    D         +    V   + K +P+   K+ + G 
Sbjct: 61  DPLTKEDVQKIYWPQNALPETIFTDEALLFPANAVGQRFVLRQMEKFEPLLAVKVTEPGQ 120

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE---RKPTVTVVLSNI 174
           + GL++ L KG RA  + +  +S V G + P D+VDV    + ++         ++ S I
Sbjct: 121 DAGLTARLAKGMRAFAIKVDATSGVSGFLHPGDNVDVYWTGTANDAGVGGEMTRLIESTI 180

Query: 175 RVIAIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSE 232
           ++IA+D   + D     +V +T T+E +P +   L  AQ+  KL+L L    D + +   
Sbjct: 181 KIIAVDQMANDDRSGSAVVAATVTVEASPEEVARLAQAQATGKLALSLVGANDASVAGLV 240

Query: 233 DSD 235
           + D
Sbjct: 241 EVD 243


>gi|86137992|ref|ZP_01056568.1| CpaB family protein [Roseobacter sp. MED193]
 gi|85825584|gb|EAQ45783.1| CpaB family protein [Roseobacter sp. MED193]
          Length = 286

 Score =  182 bits (461), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 57/257 (22%), Positives = 112/257 (43%), Gaps = 14/257 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHH--VQTEEVITENPAKFINVLISKGDLAVG 58
           M+    + ++V    A  A ++A   +S +   +  E           +V ++   L  G
Sbjct: 1   MRAVFGLVLIVGVALAGGAVMMAKNYISAYQTELARERANRGEVIPTTDVFVATKQLKYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVH---QPNAMQELDGVLVRVPILKGDPIRLEKLVD 115
             +T + +  V +P + + +G    +     P    +L   +V   + K + +   KL +
Sbjct: 61  ERLTEDAVRKVRWPSDAIPEGAFTTLETLFPPANPGDL--RVVLRTMEKDEALLEAKLTN 118

Query: 116 RG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV-----RSLSERKPTVTV 169
            G + G++S L +G RA  + + +SS V G ++P DHVDV         S    +    +
Sbjct: 119 PGQDAGITSQLQRGMRAFAISVDVSSGVSGFLRPGDHVDVYWTGGVRDGSGGRGQEITRL 178

Query: 170 VLSNIRVIAIDHNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNP 228
           +  +I +IA+D +  ++     +  T T+ + P Q  AL  AQ+  +LSL L    D   
Sbjct: 179 IEPSIELIAVDQSASTETNGATIARTVTVAVQPEQVAALAQAQTTGRLSLSLVGAGDDTV 238

Query: 229 SSSEDSDVWDVQEEGKE 245
           +S  + +   +   G++
Sbjct: 239 ASVIEVNQRSLLGLGEQ 255


>gi|197106458|ref|YP_002131835.1| pilus assembly protein CpaB [Phenylobacterium zucineum HLK1]
 gi|196479878|gb|ACG79406.1| pilus assembly protein CpaB [Phenylobacterium zucineum HLK1]
          Length = 287

 Score =  182 bits (461), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 64/227 (28%), Positives = 113/227 (49%), Gaps = 7/227 (3%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFI---NVLISKGDLAVGM 59
             R+M +  + + +  A  +  + +     Q         A       VL++   L  G 
Sbjct: 4   SRRMMYLGAAALLSSGAVFLTQQWLQGQLSQATASARAGAAPAAAEAQVLVAAQALPPGT 63

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG 119
           ++ P+ + W A+P +    G++       A  ++ G +VR  +  G P+    +V  G+ 
Sbjct: 64  ILKPSHVRWQAWPADAPTAGYLTSAASGPA--QIAGAVVRGELQPGQPLTTTGVVQPGDR 121

Query: 120 -GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIA 178
             L+++L  G RA T+++S +S V G I P D VD+V+ R + + +     VL+++RV+ 
Sbjct: 122 SFLAAVLKPGHRAVTVNVSAASGVAGFIFPGDRVDLVLSRRIGDDRHVSETVLTDVRVVG 181

Query: 179 IDHN-IDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
           ID    +  + V+V  TATLE+TP QA+ +     + KLSL LRS+A
Sbjct: 182 IDQRVANEKQEVVVPQTATLEVTPKQAEIVALMPELGKLSLSLRSLA 228


>gi|319782174|ref|YP_004141650.1| Flp pilus assembly protein CpaB [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168062|gb|ADV11600.1| Flp pilus assembly protein CpaB [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 344

 Score =  181 bits (460), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 61/251 (24%), Positives = 108/251 (43%), Gaps = 11/251 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+   L+ IV++GVF ++A ++    ++    Q   +      +   V+++   L  G  
Sbjct: 1   MRANTLIMIVLAGVFGVLAVVLVNIWLAG---QRSAMAQTGVVQGSTVVVAAMPLKFGDA 57

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG- 119
           ++ + L  VA+P   V  G         A            I   +PI   K+   G   
Sbjct: 58  LSADKLREVAWPAGAVPAGAFKSTKDLLAGD--GAKQALQSIGVNEPILATKITGPGQRA 115

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVR----SLSERKPTVTVVLSNIR 175
            LS++L +G +A ++ ++    V G + P D VD+++ R         K  V V+L +++
Sbjct: 116 TLSAVLGEGMKAVSIRVNDVLGVAGFVFPGDRVDILLTRTARGDDGADKSFVDVLLQSMK 175

Query: 176 VIAIDHNIDS-DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           V+AID   D   +   V  + TLE +   A+ L  A    +LSL LR  A     ++E  
Sbjct: 176 VLAIDQVADESKDSPTVVKSVTLEASTRDAQKLTLAAGAGQLSLALRQAAASKGETTERV 235

Query: 235 DVWDVQEEGKE 245
            + D+  E   
Sbjct: 236 TLSDLTGETPA 246


>gi|258621446|ref|ZP_05716480.1| Pilus assembly protein [Vibrio mimicus VM573]
 gi|262165920|ref|ZP_06033657.1| flp pilus assembly protein RcpC/CpaB [Vibrio mimicus VM223]
 gi|258586834|gb|EEW11549.1| Pilus assembly protein [Vibrio mimicus VM573]
 gi|262025636|gb|EEY44304.1| flp pilus assembly protein RcpC/CpaB [Vibrio mimicus VM223]
          Length = 250

 Score =  181 bits (460), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 61/236 (25%), Positives = 107/236 (45%), Gaps = 16/236 (6%)

Query: 18  VAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVF 77
            A   A + +       + V        +   I+  D+  G V+    L         + 
Sbjct: 19  AAVFFAKQWMDKQMTPQQAVEVVEREPVV---IAAIDIPAGSVIEQQHLTTK------LL 69

Query: 78  DGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDI 136
           +    ++ Q +  + L G +V  PI +G+ I +++L   G G  L+SL+P+  RA T+ +
Sbjct: 70  EKSWRNISQFSDTKVLVGQIVTGPIFQGEIIYVQRLTVPGEGSTLASLIPEKMRAITIRV 129

Query: 137 SISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTA 195
           +    V G + P + VDV+   S S+       VL +I+V+A+D    S E + ++    
Sbjct: 130 NDVIGVAGFLLPGNRVDVLNTVSYSKGSAVTNTVLKDIKVLAVDQTARSKENKPIIVRAV 189

Query: 196 TLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKA 251
           TLE+TP QA+ L++AQS  ++ L LR+     P   E+      +     + IIK 
Sbjct: 190 TLEVTPEQAEKLLSAQSKGEIQLTLRN-----PHEPEEKVAVTRRYVAPSVTIIKG 240


>gi|262171231|ref|ZP_06038909.1| flp pilus assembly protein RcpC/CpaB [Vibrio mimicus MB-451]
 gi|261892307|gb|EEY38293.1| flp pilus assembly protein RcpC/CpaB [Vibrio mimicus MB-451]
          Length = 250

 Score =  181 bits (460), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 61/236 (25%), Positives = 107/236 (45%), Gaps = 16/236 (6%)

Query: 18  VAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVF 77
            A   A + +       + V        +   I+  D+  G V+    L         + 
Sbjct: 19  AAVFFAKQWMDKQMTPQQAVEVVEREPVV---IAAIDIPAGSVIEQQHLTTK------LL 69

Query: 78  DGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDI 136
           +    ++ Q +  + L G +V  PI +G+ I +++L   G G  L+SL+P+  RA T+ +
Sbjct: 70  EKSWRNISQFSDPKVLVGQIVTGPIFQGEIIYVQRLTVPGEGSTLASLIPEKMRAITIRV 129

Query: 137 SISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTA 195
           +    V G + P + VDV+   S S+       VL +I+V+A+D    S E + ++    
Sbjct: 130 NDVIGVAGFLLPGNRVDVLNTVSYSKGSAVTNTVLKDIKVLAVDQTARSKENKPIIVRAV 189

Query: 196 TLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKA 251
           TLE+TP QA+ L++AQS  ++ L LR+     P   E+      +     + IIK 
Sbjct: 190 TLEVTPEQAEKLLSAQSKGEIQLTLRN-----PHEPEEKVAVTRRYVAPSVTIIKG 240


>gi|16127176|ref|NP_421740.1| pilus assembly protein CpaB [Caulobacter crescentus CB15]
 gi|221235977|ref|YP_002518414.1| pilus assembly protein CpaB [Caulobacter crescentus NA1000]
 gi|7208424|gb|AAF40191.1|AF229646_3 CpaB [Caulobacter crescentus CB15]
 gi|13424572|gb|AAK24908.1| pilus assembly protein CpaB [Caulobacter crescentus CB15]
 gi|220965150|gb|ACL96506.1| pilus assembly protein CpaB [Caulobacter crescentus NA1000]
          Length = 297

 Score =  181 bits (460), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 79/294 (26%), Positives = 133/294 (45%), Gaps = 42/294 (14%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVI------TENPAKFINVLISKGD 54
           M   RL+ ++++ V A+   ++  R +     +   ++               VL++K D
Sbjct: 1   MSPVRLLIVLIAAVSAIGLAVVLQRALGGAPAKPTGLVEAPGGPAAPGKPMTQVLVAKRD 60

Query: 55  LAVGMVVTPNILEWVAFPEENVFDGFIDDVHQP------------------------NAM 90
           L VG  +    + W A+P +++   FI +   P                        +  
Sbjct: 61  LPVGTRLVATDVGWQAWPSDSINAAFITNGSAPVTPDGKVEAAKAVVAATADQMIGGDPA 120

Query: 91  QELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPN 149
           + ++G +VR PIL G+PI   K+V  G GG LS +L  GKRA ++ ++  +AVGG I P 
Sbjct: 121 KIVEGAIVRDPILIGEPITPRKIVRGGEGGYLSVVLTPGKRAMSVPVTSDTAVGGFILPG 180

Query: 150 DHVDVVMVRSLSERKP------TVTVVLSNIRVIAIDH--NIDSDERVLVGSTATLELTP 201
           D VDV+  R                 VL NIRV+A+D     + D + +V +TATLE+ P
Sbjct: 181 DRVDVLSTRDAPAAGDQGGKVMIAETVLQNIRVLALDQATAAEKDAKSIVAATATLEVGP 240

Query: 202 MQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAGVIV 255
           ++A+AL  A++   ++L LR+  D+   S     V         ++I + G   
Sbjct: 241 VEAEALARAKAGGPITLALRAYTDMGGPSGVTHAVAGDDS---TVRINRGGQTT 291


>gi|54302291|ref|YP_132284.1| Flp pilus assembly protein [Photobacterium profundum SS9]
 gi|46915713|emb|CAG22484.1| hypothetical Flp pilus assembly protein [Photobacterium profundum
           SS9]
          Length = 264

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 61/243 (25%), Positives = 112/243 (46%), Gaps = 26/243 (10%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHV------QTEEVITENPAKFINV------- 48
           K    + + +S +  L A I+A   +           +  E +T+   +   V       
Sbjct: 3   KGKIFLTLFISIMMGLGALILANNWLQSKQANLNAQTKPSEPVTQVEVQIKEVMKEEPKV 62

Query: 49  --LISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
             ++++  + +G  +    L    +P + V              +++ G+L R  I +GD
Sbjct: 63  PRVMAQQRIPLGTKIEAKHLSIEYYPTDLV------KSKGYETPEQVVGMLARNEIFEGD 116

Query: 107 PIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP 165
            +R E+LV  G G  L++L+    RA T+ ++    V G + P D VDV+ ++  S    
Sbjct: 117 LLRKERLVTPGEGTTLAALISPNMRAVTIRVNDVIGVAGFLLPGDFVDVIYIKEKSNN-- 174

Query: 166 TVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
               VL  I+++A+D    +D+ + ++    TLELTP QA++LV A+S  +L L LR+  
Sbjct: 175 -AITVLKKIKILAVDQTARTDDSKPVIVRAVTLELTPKQAESLVTAKSKGELQLSLRNPN 233

Query: 225 DLN 227
           D+ 
Sbjct: 234 DIE 236


>gi|307294423|ref|ZP_07574267.1| Flp pilus assembly protein CpaB [Sphingobium chlorophenolicum L-1]
 gi|306880574|gb|EFN11791.1| Flp pilus assembly protein CpaB [Sphingobium chlorophenolicum L-1]
          Length = 307

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 66/223 (29%), Positives = 110/223 (49%), Gaps = 8/223 (3%)

Query: 26  LVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVH 85
            ++  ++ + E   +       V+++   L  G  VT   +  V +P  +V  G   D  
Sbjct: 22  FIANSYLSSAEKAPQADGGMAKVVVATVSLPFGSAVTAEKIRTVDWPANSVPPGAFRDPI 81

Query: 86  QPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGG 144
           Q  ++    G +V   I  G+PI   KL   G    +S++L    RA  + +S  +A GG
Sbjct: 82  QLTSLG--KGRVVLRQIEPGEPILASKLSGEGGRATMSAVLAPEMRAVAVRVSDVAAAGG 139

Query: 145 MIKPNDHVDVVMVRSLSE----RKPTVTVVLSNIRVIAIDHNI-DSDERVLVGSTATLEL 199
            + P D VDV + R+L++     +    V+L   RVIAID N  D+ +   VG TATLE+
Sbjct: 140 FVLPGDTVDVFVTRTLTDPVAGSQQITDVLLQGTRVIAIDQNANDTSKDPAVGKTATLEV 199

Query: 200 TPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEE 242
             + A+ LV AQ V +L+LVLR++ D    + +   + D+++ 
Sbjct: 200 NQVDAQKLVLAQQVGQLTLVLRNLTDKPNPAVQTVGIEDLRDG 242


>gi|126729099|ref|ZP_01744913.1| CpaB family protein [Sagittula stellata E-37]
 gi|126710089|gb|EBA09141.1| CpaB family protein [Sagittula stellata E-37]
          Length = 288

 Score =  180 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 56/245 (22%), Positives = 104/245 (42%), Gaps = 11/245 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITEN--PAKFINVLISKGDLAVG 58
           M+L   + ++     A  A  +A   +  +     +   +         + +S   +A G
Sbjct: 1   MRLVFGLVLLAGIGLAGFAVYMAQNYIGAYETALVQARQQTHVSVPTKQIYVSARPIAYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG- 117
             +T   +    +PEE + +G  D+   P   + ++  +    I   + I   K+   G 
Sbjct: 61  QEITEEDIRLAPWPEEIMPEGIFDE-ETPLLTENMEPRVALRAIDAFEAIVPSKVSQPGG 119

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP------TVTVVL 171
           + GL+  L  G+ A  + + ++S V G ++P D VDV     +  R P         ++L
Sbjct: 120 SAGLTHYLKPGESAFAIRVDVASGVSGFLRPGDRVDVYWTGRVDSRDPNMPRGEVTKMIL 179

Query: 172 SNIRVIAIDHNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           + IR+IAID N ++D     +  T T+  T  Q   L  AQS  +L+L L S  +   + 
Sbjct: 180 AGIRLIAIDQNSEADTSGTSIARTVTVAATREQTLVLTHAQSTGQLTLSLISQNEDGEAI 239

Query: 231 SEDSD 235
           + + D
Sbjct: 240 TTEVD 244


>gi|209515950|ref|ZP_03264811.1| Flp pilus assembly protein CpaB [Burkholderia sp. H160]
 gi|209503608|gb|EEA03603.1| Flp pilus assembly protein CpaB [Burkholderia sp. H160]
          Length = 375

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 64/257 (24%), Positives = 108/257 (42%), Gaps = 22/257 (8%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
           + R++ IV+  + A V  II   L     V   +     P     V ++  DL  GM++ 
Sbjct: 1   MPRILKIVILVILASVGAIIFRALF----VAASQPGQARPPAMDRVRVAAADLPEGMLLR 56

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNA-MQELDGVLVRVPILKGDPIRLEKLVDRGN-GG 120
            + L W   P + V  G +      +A   +L G ++R  +  G  +    ++     G 
Sbjct: 57  ESDLAWKEVPHKQVLQGALVKGDAESAEATDLKGDVLRHAVTAGTMLGTADVIPPNAPGF 116

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE---------RKPTVTVVL 171
           L++ L  G RA ++ I   S   G+I+P D+VDV++ + L           R      V+
Sbjct: 117 LAAALKPGMRAISVAIDDVSGNAGLIQPGDYVDVLLTQQLDGPVHAPQNTARSVESETVV 176

Query: 172 SNIRVIAIDH-----NIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA-- 224
           + +RV+A+         D+ +      T T E+TP  A+ +  A  +  LSL LRS A  
Sbjct: 177 NRVRVLAVGSIFQRPKADAADANTRARTVTFEVTPHTAQVIAVATHLGSLSLALRSFATS 236

Query: 225 DLNPSSSEDSDVWDVQE 241
           D NP    +  +     
Sbjct: 237 DRNPPVIANETLPQTPP 253


>gi|157375509|ref|YP_001474109.1| Flp pilus assembly protein CpaB-like protein [Shewanella sediminis
           HAW-EB3]
 gi|157317883|gb|ABV36981.1| Flp pilus assembly protein CpaB-like protein [Shewanella sediminis
           HAW-EB3]
          Length = 274

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 58/248 (23%), Positives = 111/248 (44%), Gaps = 20/248 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M    ++ +++S +F + A  +A   +  +          NP    +V+     + +G +
Sbjct: 1   MNNKTILFVLLSLIFGVAAVFLAQSWLKTN------TEAVNPQVSTSVITMATLVPLGTI 54

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +    L     P   + +  I         +  +G++V+  +  G+ +R E++  +G G 
Sbjct: 55  LERKHLILTPMPNTVIPETAIKT------FEGAEGMVVKQNLYAGEVLRSERITVKGEGS 108

Query: 121 -LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAI 179
            L+SL+    RA T+ ++    V G + P + VDV+ +     R     VVL+N++++AI
Sbjct: 109 TLASLISPQMRAVTIRVNDVVGVAGFLLPGNRVDVLNLFKRGGRLQ-TDVVLANVKILAI 167

Query: 180 DHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWD 238
           D    +DE +  +    TLEL   QA+ L+ A+   KL L LR+  D     S   ++  
Sbjct: 168 DQRSSNDENKPKLVRAVTLELNLEQAEVLMIAKGRGKLQLALRNPND-----STKVELAL 222

Query: 239 VQEEGKEI 246
           + E    I
Sbjct: 223 INEAKDTI 230


>gi|83943940|ref|ZP_00956397.1| CpaB family protein [Sulfitobacter sp. EE-36]
 gi|83845187|gb|EAP83067.1| CpaB family protein [Sulfitobacter sp. EE-36]
          Length = 287

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 56/246 (22%), Positives = 104/246 (42%), Gaps = 11/246 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHH--VQTEEVITENPAKFINVLISKGDLAVG 58
           M++   + ++     A  A  +A   +S +    Q  +         + V ++ G L  G
Sbjct: 1   MRMVFGLVLLAGIALAGGAVYLAKGRISEYQRANQQAQEALAQIVPTVGVYVANGPLKYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG- 117
             +T   +  V +PE  + +G   +          D  +V   + K + I   K+ + G 
Sbjct: 61  QRLTREDVRQVNWPENAIPEGTFIEEAALFPENSDDLRVVLRAMEKDEAIMAVKVTEPGA 120

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS-------ERKPTVTVV 170
           + GL+S L +G RA  + + +SS V G ++P D VDV     ++       +      ++
Sbjct: 121 DTGLTSQLERGSRAFAIRVDVSSGVSGFLRPGDRVDVYWTGRINRGGNDRADTGDVTKLI 180

Query: 171 LSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
            + +++IAID +   +     + +T T+ + P Q  AL  AQS   LSL L    D   +
Sbjct: 181 EAGVKIIAIDQSAGGERSEAAIANTVTVAVQPYQVAALAQAQSTGDLSLSLVGAEDDTVA 240

Query: 230 SSEDSD 235
              + D
Sbjct: 241 GEIEVD 246


>gi|116748929|ref|YP_845616.1| SAF domain-containing protein [Syntrophobacter fumaroxidans MPOB]
 gi|116697993|gb|ABK17181.1| SAF domain [Syntrophobacter fumaroxidans MPOB]
          Length = 292

 Score =  180 bits (456), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 64/267 (23%), Positives = 125/267 (46%), Gaps = 14/267 (5%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPH-HVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +   +  + ++ V ALVA ++  + V     VQT  V  +     + V ++  DL  G  
Sbjct: 3   RFRAIFPLALAIVLALVASVVVYKWVQMKTGVQTTVVTEKAEPGGVQVALASADLPWGTK 62

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG--N 118
           +T  +++   +P +++  G+  D        +++G ++  P+ +G+ +   KL       
Sbjct: 63  LTREMVKMAEYPPKHLPAGYFSDPA------KIEGRVLITPVKQGEQLLESKLAPLSVTT 116

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK--PTVTVVLSNIRV 176
           GG+S+++  GKRA  +       + G I+P + VDV++    ++ K   T  VVL N++V
Sbjct: 117 GGVSAVVSVGKRAIAVAGDKVIGLAGFIQPGNFVDVLVTIRDTQEKTPSTSKVVLENVKV 176

Query: 177 IAIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           +A    ID             TLE+TP +A+ L  A S+ KL   LR++ D     +  +
Sbjct: 177 LATGTVIDKKAGTEPGPVDVFTLEVTPEEAERLAFAASLGKLHFALRNVTDTEVVYTMGT 236

Query: 235 DVWDVQEE-GKEIQIIKAGVIVNKDGE 260
            + D  +     ++++ A  +V  + E
Sbjct: 237 TIADALDAYRPRMKMVSAQPVVKSEPE 263


>gi|83954513|ref|ZP_00963224.1| CpaB family protein [Sulfitobacter sp. NAS-14.1]
 gi|83840797|gb|EAP79968.1| CpaB family protein [Sulfitobacter sp. NAS-14.1]
          Length = 287

 Score =  179 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 55/246 (22%), Positives = 104/246 (42%), Gaps = 11/246 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHH--VQTEEVITENPAKFINVLISKGDLAVG 58
           M++   + ++     A  A  +A   +  +    Q  +         + V ++ G L  G
Sbjct: 1   MRMVFGLVLLAGIALAGGAVYLAKGRIGEYQRANQQAQEALAQIVPTVGVYVANGPLKYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG- 117
             +T   +  V +PE+ + +G   +          D  +V   + K + I   K+ + G 
Sbjct: 61  QRLTREDVRQVKWPEDAIPEGTFIEEAALFPENSDDLRVVLRAMEKDEAIMAAKVTEPGA 120

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS-------ERKPTVTVV 170
           + GL+S L +G RA  + + +SS V G ++P D VDV     ++       +      ++
Sbjct: 121 DTGLTSQLERGSRAFAIRVDVSSGVSGFLRPGDRVDVYWTGRINRGGNDRADTGDVTKLI 180

Query: 171 LSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
            + +++IAID +   +     + +T T+ + P Q  AL  AQS   LSL L    D   +
Sbjct: 181 EAGVKIIAIDQSAGGERSEAAIANTVTVAVQPYQVAALAQAQSTGDLSLSLVGAEDDTVA 240

Query: 230 SSEDSD 235
              + D
Sbjct: 241 GEIEVD 246


>gi|255262747|ref|ZP_05342089.1| Flp pilus assembly protein CpaB [Thalassiobium sp. R2A62]
 gi|255105082|gb|EET47756.1| Flp pilus assembly protein CpaB [Thalassiobium sp. R2A62]
          Length = 282

 Score =  179 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 55/246 (22%), Positives = 110/246 (44%), Gaps = 7/246 (2%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQ--TEEVITENPAKFINVLISKGDLAVG 58
           M+    + +V+    A  A  +A   +S + ++    E         +++  +K  L  G
Sbjct: 1   MRAVFGLVLVLGVALAGFAVYMAKGYISDNQLRLAQAEAARAAMVPTVDIFAAKNPLVYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG- 117
            ++T   +  + +PE ++  G    + +     +    +V  PI   + I   K+   G 
Sbjct: 61  QMLTIEDVHHIRYPEASLPPGAFRTIEELFPNGDEKLRVVLRPIEPNEVILPVKVTSPGE 120

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS---ERKPTVTVVLSNI 174
           + GL+  L +G RA  + + +SS V G ++P D VDV      +    R+    ++ S++
Sbjct: 121 DAGLTQRLAQGMRAFAIRVDVSSGVSGFVRPGDRVDVYWSGVANVGQRRQDLTRLIQSSV 180

Query: 175 RVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
           ++IAID + D ++    +  T T+E++ ++  AL  AQ+   LSL L    D       +
Sbjct: 181 KIIAIDQSADGNQSEARIARTVTVEVSQVEVAALAQAQATGNLSLALVGYGDNTDVGIVE 240

Query: 234 SDVWDV 239
            D  ++
Sbjct: 241 IDTQEL 246


>gi|77462454|ref|YP_351958.1| putative Flp pilus assembly protein CpaB [Rhodobacter sphaeroides
           2.4.1]
 gi|221638317|ref|YP_002524579.1| Flp pilus assembly protein CpaB [Rhodobacter sphaeroides KD131]
 gi|332560338|ref|ZP_08414660.1| Flp pilus assembly protein CpaB [Rhodobacter sphaeroides WS8N]
 gi|77386872|gb|ABA78057.1| Putative Flp pilus assembly protein CpaB [Rhodobacter sphaeroides
           2.4.1]
 gi|221159098|gb|ACM00078.1| Flp pilus assembly protein CpaB precursor [Rhodobacter sphaeroides
           KD131]
 gi|332278050|gb|EGJ23365.1| Flp pilus assembly protein CpaB [Rhodobacter sphaeroides WS8N]
          Length = 274

 Score =  179 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 52/251 (20%), Positives = 102/251 (40%), Gaps = 9/251 (3%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQ--TEEVITENPAKFINVLISKGDLAVG 58
           M+L     +++    A  A  +A   +S   +    E    +     + V ++   L  G
Sbjct: 1   MRLVFAFVLLIGIALAGFAVYMAQGYISQTQIALEKERAARKKLGPMVEVFVTNKPLNYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG- 117
             +T   +  + +P   + +                   V   + K +P+   K+   G 
Sbjct: 61  APLTRADVRTIMWPANALPETIFQK-ESDLFPDPAKPRYVLRQMEKFEPVLGVKVTAPGI 119

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVI 177
             G+   L  G RA  + + ++S V G ++P D VDV    S S  + T  ++   I ++
Sbjct: 120 EAGI--RLASGMRAFAIKVDVASGVSGFLQPGDRVDVYWTGSASSGE-TTRLIEKTIPIV 176

Query: 178 AIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
           A+D   ++D     ++  T T+E++P Q   L  AQ+  +LSL L    D   +++   D
Sbjct: 177 AVDQTANADLATSAIIARTVTVEVSPQQVARLAQAQATGRLSLSLVGRDDTTEATATPVD 236

Query: 236 VWDVQEEGKEI 246
             ++  E  ++
Sbjct: 237 TRNLIGEPDKV 247


>gi|126461332|ref|YP_001042446.1| putative Flp pilus assembly protein CpaB [Rhodobacter sphaeroides
           ATCC 17029]
 gi|126102996|gb|ABN75674.1| putative Flp pilus assembly protein CpaB [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 274

 Score =  179 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 52/251 (20%), Positives = 102/251 (40%), Gaps = 9/251 (3%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQ--TEEVITENPAKFINVLISKGDLAVG 58
           M+L     +++    A  A  +A   +S   +    E    +     + V ++   L  G
Sbjct: 1   MRLVFAFVLLIGIALAGFAVYMAQGYISQTQIALEKERAARKKLGPMVEVFVTNKPLNYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG- 117
             +T   +  + +P   + +                   V   + K +P+   K+   G 
Sbjct: 61  APLTRADVRTIMWPANALPETIFQKESDL-FPDPAKPRYVLRQMEKFEPVLGVKVTAPGI 119

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVI 177
             G+   L  G RA  + + ++S V G ++P D VDV    S S  + T  ++   I ++
Sbjct: 120 EAGI--RLASGMRAFAIKVDVASGVSGFLQPGDRVDVYWTGSASSGE-TTRLIEKTIPIV 176

Query: 178 AIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
           A+D   ++D     ++  T T+E++P Q   L  AQ+  +LSL L    D   +++   D
Sbjct: 177 AVDQTANADLATSAIIARTVTVEVSPQQVARLAQAQATGRLSLSLVGRDDTTEATATPVD 236

Query: 236 VWDVQEEGKEI 246
             ++  E  ++
Sbjct: 237 TRNLIGEPDKV 247


>gi|46580523|ref|YP_011331.1| hypothetical protein DVU2118 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46449942|gb|AAS96591.1| conserved hypothetical protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311234262|gb|ADP87116.1| Flp pilus assembly protein CpaB [Desulfovibrio vulgaris RCH1]
          Length = 272

 Score =  179 bits (454), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 59/252 (23%), Positives = 113/252 (44%), Gaps = 18/252 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+ T ++ ++ + V ALVAG++  R V  + V  +          + ++++  D+  G  
Sbjct: 1   MRRTAVIQVIAALVLALVAGVLVFRFVQVNRVAQQT----QQPPGVVLVVAAVDMEKGAK 56

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG--N 118
           +  + L+   F   +   G   D       + L G ++  P+  G+ I   +L+     +
Sbjct: 57  IRADQLKTSTFLSASAPPGGFTDA------KSLVGRVLATPVTTGEVITETRLLPADATS 110

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT---VTVVLSNIR 175
           GG+S+++  G RA  +  +    + G I+P + VD+++      R+       V+L+ I+
Sbjct: 111 GGVSTMIAPGMRAVAVKGNKVMGLAGFIRPGNRVDIMVTIDDETREKAKARTKVILAGIK 170

Query: 176 VIAIDHNIDS---DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSE 232
           V+A    +     D         TLE+TP QA+ L  A S  +L   LR+ AD  P  + 
Sbjct: 171 VLATGTELRQEGDDTATSPVEVYTLEVTPEQAELLSLAASRGELHFALRNPADDLPVRTA 230

Query: 233 DSDVWDVQEEGK 244
            +DV     + +
Sbjct: 231 GTDVPATLRQLQ 242


>gi|126737255|ref|ZP_01752990.1| CpaB family protein [Roseobacter sp. SK209-2-6]
 gi|126721840|gb|EBA18543.1| CpaB family protein [Roseobacter sp. SK209-2-6]
          Length = 285

 Score =  179 bits (454), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 56/244 (22%), Positives = 108/244 (44%), Gaps = 9/244 (3%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQT--EEVITENPAKFINVLISKGDLAVG 58
           M+    + ++V    A  A ++A + +S H      E            + ++   L  G
Sbjct: 1   MRAVFGLVLIVGVALAGGAVMMAKKYISAHQAALAHERANRAEVIPTTEIYVAVKQLKYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFID-DVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG 117
             +T   ++ V +P E++ +G  + +       +  D  +V   I   + I   K+   G
Sbjct: 61  ERLTAEAVKKVRWPTESLPEGAFEMEAELFPTAKPSDQRVVLRMIEPNEAILAVKVTKPG 120

Query: 118 -NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV----RSLSERKPTVTVVLS 172
            + G++S L +G RA  + + ++S V G ++P D VDV        +  +      ++ S
Sbjct: 121 EDAGITSQLQRGMRAFAIKVDVTSGVSGFLRPGDRVDVYWTGVARGASGQDGEMTRLIES 180

Query: 173 NIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSS 231
           +I +IA+D +  +D    ++  T T+ + P Q  AL  AQ+  +LSL L    D   +S+
Sbjct: 181 SIELIAVDQSASTDVNGAMIARTVTVAVQPEQVAALAQAQTTGRLSLSLVGAGDDTVASA 240

Query: 232 EDSD 235
            + D
Sbjct: 241 IEVD 244


>gi|260771479|ref|ZP_05880404.1| flp pilus assembly protein RcpC/CpaB [Vibrio furnissii CIP 102972]
 gi|260613605|gb|EEX38799.1| flp pilus assembly protein RcpC/CpaB [Vibrio furnissii CIP 102972]
 gi|315181061|gb|ADT87975.1| Flp pilus assembly protein CpaB [Vibrio furnissii NCTC 11218]
          Length = 249

 Score =  179 bits (454), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 57/248 (22%), Positives = 108/248 (43%), Gaps = 17/248 (6%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNI 65
           ++  ++S +F L A   A + +        EV        +    +  D+    V+    
Sbjct: 7   ILLFLLSVLFGLGAVFFAKQWMDRQVQPQTEVEVVERVPVVV---ASRDIPASTVIEEQY 63

Query: 66  LEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-GLSSL 124
           L      +  + +    +        E+ G +    I   + I  ++L   G G  L++L
Sbjct: 64  LTTRLLEKSWMTENQFSEP------TEVIGKIAESDIYPNEIIVAQRLSIPGEGATLAAL 117

Query: 125 LPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNID 184
           +P+ KRA T+ ++    V G + P + VDV+     S+     T +L +IRV+A+D    
Sbjct: 118 IPEDKRAVTIRVNDVIGVAGFLLPGNKVDVLNTIQYSKTSANTTTILKDIRVLAVDQTAK 177

Query: 185 SDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEG 243
           + E + ++    TLE++P +A+ L++A+S   + LVLR+     P + E+  V       
Sbjct: 178 TQENKPIIVRAVTLEVSPKEAEKLLSAKSKGDIQLVLRN-----PHAVEEKVVRRYVPP- 231

Query: 244 KEIQIIKA 251
             + IIK 
Sbjct: 232 PSVTIIKG 239


>gi|261252086|ref|ZP_05944659.1| flp pilus assembly protein RcpC/CpaB [Vibrio orientalis CIP 102891]
 gi|260935477|gb|EEX91466.1| flp pilus assembly protein RcpC/CpaB [Vibrio orientalis CIP 102891]
          Length = 247

 Score =  178 bits (453), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 57/218 (26%), Positives = 96/218 (44%), Gaps = 11/218 (5%)

Query: 12  SGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAF 71
           S VF L A   A + +        EV        I    +  ++  G V+    +     
Sbjct: 13  SIVFGLGAVFFAKQWMDRQLQPQVEVEVVEREPVIV---AAQEIFAGSVIEEQHVT---- 65

Query: 72  PEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKR 130
               + +    D  Q    +EL G +    I  G+ I   +L   G G  L+SL+P+ KR
Sbjct: 66  --SRLLEKDWRDELQFTKAEELVGQVAATTIYPGEIIHPNRLSSSGEGSTLASLIPENKR 123

Query: 131 AATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RV 189
           A T+ ++    V G + P + VD++      +   + + VL  I+V+A+D    S E + 
Sbjct: 124 AVTIRVNDVIGVAGFLLPGNKVDILNTVKYGKNSASTSTVLKEIKVLAVDQTARSKENKP 183

Query: 190 LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLN 227
           ++    TLE+TP QA+ L++AQS   + L LR+  +  
Sbjct: 184 VIVRAVTLEVTPRQAEKLLSAQSRGNIQLTLRNPHEEE 221


>gi|320155488|ref|YP_004187867.1| flp pilus assembly protein RcpC/CpaB [Vibrio vulnificus MO6-24/O]
 gi|319930800|gb|ADV85664.1| flp pilus assembly protein RcpC/CpaB [Vibrio vulnificus MO6-24/O]
          Length = 248

 Score =  178 bits (452), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 54/213 (25%), Positives = 100/213 (46%), Gaps = 11/213 (5%)

Query: 18  VAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVF 77
            A   A + +       ++V        +   I+  ++  G V+ P  L         + 
Sbjct: 19  AAVFFAKQWMDKQLTPQQDVEVVEREPVV---IAAIEIPAGSVIEPQHLTTK------LL 69

Query: 78  DGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDI 136
           +    ++ Q    +EL G +V   I  G+ I  ++L   G G  L++L+P+ KRA T+ +
Sbjct: 70  EKSWRELSQYTDPKELVGQIVAGAIYPGEIIIEQRLTVPGEGSTLAALIPENKRAITIRV 129

Query: 137 SISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTA 195
           +    V G + P + VDV+   S S+       VL +I+V+A+D    + E + ++    
Sbjct: 130 NDVIGVAGFLLPGNRVDVLNTISYSKGSAVTKTVLKDIKVLAVDQTARTKENKPIIVRAV 189

Query: 196 TLELTPMQAKALVAAQSVAKLSLVLRSIADLNP 228
           TLE+TP QA+ L++A+S  ++ L LR+  +   
Sbjct: 190 TLEVTPDQAEKLLSAKSKGEIQLTLRNPHEPEE 222


>gi|120602160|ref|YP_966560.1| SAF domain-containing protein [Desulfovibrio vulgaris DP4]
 gi|120562389|gb|ABM28133.1| SAF domain [Desulfovibrio vulgaris DP4]
          Length = 272

 Score =  178 bits (452), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 61/252 (24%), Positives = 113/252 (44%), Gaps = 18/252 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+ T ++ ++ + V ALVAGI+  R V  + V  +          + +++S  D+  G  
Sbjct: 1   MRRTAVIQVIAALVLALVAGILVFRFVQVNRVAQQT----QQPPGVVLVVSAVDMEKGAK 56

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG--N 118
           +  + L+   F   +   G   D       + L G ++  P+  G+ I   +L+     +
Sbjct: 57  IRADQLKTSTFLSASAPPGGFTDA------KSLVGRVLATPVTTGEVITETRLLPADATS 110

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT---VTVVLSNIR 175
           GG+S+++  G RA  +  +    + G I+P + VD+++      R+       V+L+ I+
Sbjct: 111 GGVSTMIAPGMRAVAVKGNKVMGLAGFIRPGNRVDIMVTIDDETREKAKARTKVILAGIK 170

Query: 176 VIAIDHNIDS---DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSE 232
           V+A    +     D         TLE+TP QA+ L  A S  +L   LR+ AD  P  + 
Sbjct: 171 VLATGTELRQEGDDTATSPVEVYTLEVTPEQAELLSLAASRGELHFALRNPADDLPVRTA 230

Query: 233 DSDVWDVQEEGK 244
            +DV     + +
Sbjct: 231 GTDVPATLRQLQ 242


>gi|239814525|ref|YP_002943435.1| Flp pilus assembly protein CpaB [Variovorax paradoxus S110]
 gi|239801102|gb|ACS18169.1| Flp pilus assembly protein CpaB [Variovorax paradoxus S110]
          Length = 280

 Score =  178 bits (452), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 58/203 (28%), Positives = 99/203 (48%), Gaps = 13/203 (6%)

Query: 47  NVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGD 106
            V+++  D+ +G  V P +L  V +P  ++  G   D       + L+  +V+V +L+G+
Sbjct: 38  KVVVAAVDIELGSRVNPQMLSLVDWPSGSLPAGSFKDA------KSLEDRVVKVGVLRGE 91

Query: 107 PIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS---- 161
            I   KL   G  GGLS+++  GKRA T+ ++    V G   P ++VDV++         
Sbjct: 92  AILEGKLAPVGTQGGLSAVIASGKRAMTVRVNDVVGVAGFALPGNYVDVMVNAQQDKNRG 151

Query: 162 -ERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLV 219
            E +     VL  + V+A+    + D+ +  V S  TLEL+   ++ L  A+SV  LSLV
Sbjct: 152 EEGRQISKTVLEKVLVLAVAQEANRDDTKPKVVSAVTLELSLEDSEKLDLARSVGTLSLV 211

Query: 220 LRSIADLNPSSSEDSDVWDVQEE 242
           LR+  D    ++       +  E
Sbjct: 212 LRNQMDKTTVATAGITKGQLFGE 234


>gi|118581114|ref|YP_902364.1| SAF domain-containing protein [Pelobacter propionicus DSM 2379]
 gi|118503824|gb|ABL00307.1| SAF domain protein [Pelobacter propionicus DSM 2379]
          Length = 291

 Score =  178 bits (452), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 54/220 (24%), Positives = 100/220 (45%), Gaps = 15/220 (6%)

Query: 34  TEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQEL 93
           +++       K   ++++  D+ VG  +    L+ +A+P  ++  G   D       + L
Sbjct: 30  SKKSKETEAGKGKGIVVASADIPVGSKLNTTHLKMMAWPATSIPPGSFTDT------KAL 83

Query: 94  DGVLVRVPILKGDPIRLEKLVD----RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPN 149
              +   PI  G+P+   KL+      G G ++ ++P G RA T+ ++  + V G + P+
Sbjct: 84  IDRISIRPIGPGEPLTEAKLMPRDGAPGAGIMTYIIPDGHRAVTVAVNEVAGVAGFLSPH 143

Query: 150 DHVDVVMV----RSLSERKPTVTVVLSNIRVIAIDHNIDS-DERVLVGSTATLELTPMQA 204
           + VDVV+      S         +VL N+ ++A     +  D + +V  T T++LTP  A
Sbjct: 144 NKVDVVLTTIPPGSNDPNATISKIVLQNVPILATGQITEQKDGKPVVVPTVTIDLTPEDA 203

Query: 205 KALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGK 244
           + LV A S   L ++LR I D     S  + +  V    +
Sbjct: 204 EKLVVASSKGSLQMLLRGIRDSALVESRGATIAKVLGAVR 243


>gi|27365105|ref|NP_760633.1| Flp pilus assembly protein CpaB [Vibrio vulnificus CMCP6]
 gi|27361251|gb|AAO10160.1| Flp pilus assembly protein CpaB [Vibrio vulnificus CMCP6]
          Length = 248

 Score =  178 bits (451), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 54/213 (25%), Positives = 100/213 (46%), Gaps = 11/213 (5%)

Query: 18  VAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVF 77
            A   A + +       ++V        +   I+  ++  G V+ P  L         + 
Sbjct: 19  AAVFFAKQWMDKQLTPQQDVEVVEREPVV---IAAIEIPAGSVIEPQHLTTK------LL 69

Query: 78  DGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDI 136
           +    ++ Q    +EL G +V   I  G+ I  ++L   G G  L++L+P+ KRA T+ +
Sbjct: 70  EKSWRELSQYTDPKELVGQIVAGAIYPGEIIIEQRLTVPGEGSTLAALIPENKRAITIRV 129

Query: 137 SISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTA 195
           +    V G + P + VDV+   S S+       VL +I+V+A+D    + E + ++    
Sbjct: 130 NDVIGVAGFLLPGNRVDVLNTVSYSKGSAVTKTVLKDIKVLAVDQTARTKENKPIIVRAV 189

Query: 196 TLELTPMQAKALVAAQSVAKLSLVLRSIADLNP 228
           TLE+TP QA+ L++A+S  ++ L LR+  +   
Sbjct: 190 TLEVTPDQAEKLLSAKSKGEIQLTLRNPHEPEE 222


>gi|322419945|ref|YP_004199168.1| Flp pilus assembly protein CpaB [Geobacter sp. M18]
 gi|320126332|gb|ADW13892.1| Flp pilus assembly protein CpaB [Geobacter sp. M18]
          Length = 308

 Score =  178 bits (451), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 60/221 (27%), Positives = 114/221 (51%), Gaps = 13/221 (5%)

Query: 34  TEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQEL 93
            +E+      +   ++++  D+ +G  ++   L+  ++P++++  G   DV      + L
Sbjct: 30  QKEMDMTKAVQPQTLVVAAADIPIGGTISEPQLKTTSWPKDSIPPGSAADV------KSL 83

Query: 94  DGVLVRVPILKGDPIRLEKLVDR----GNGGLSSLLPKGKRAATMDISISSAVGGMIKPN 149
            G +   PI  GD +  +KL  +    G+G ++ ++P G RA T+ ++  + V G I PN
Sbjct: 84  VGRVAIRPISNGDAVTEQKLKPKAGAAGSGFMTYIVPLGHRATTVAVNEVAGVAGFITPN 143

Query: 150 DHVDVVMVRSL--SERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKA 206
           D +DVV+   L  S+++    ++L N+ V+A     +  E + +V  T TL+LTP  A+ 
Sbjct: 144 DRIDVVLTTQLPGSQKENISKIILQNVPVLATGQITEQKEGKPVVVPTVTLDLTPEDAEK 203

Query: 207 LVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQ 247
           LV A S   L L+LR+IAD  P +++ + +  V       +
Sbjct: 204 LVLAGSKGSLQLLLRNIADSAPLNAKGATIAKVLAGTPPPE 244


>gi|37680845|ref|NP_935454.1| Flp pilus assembly protein CpaB [Vibrio vulnificus YJ016]
 gi|37199594|dbj|BAC95425.1| Flp pilus assembly protein CpaB [Vibrio vulnificus YJ016]
          Length = 248

 Score =  178 bits (451), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 54/213 (25%), Positives = 101/213 (47%), Gaps = 11/213 (5%)

Query: 18  VAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVF 77
            A   A + +       ++V        +   I+  ++  G V+ P  L         + 
Sbjct: 19  AAVFFAKQWMDKQLTPQQDVEVVEREPVV---IAAIEIPAGSVIEPQHLTTK------LL 69

Query: 78  DGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDI 136
           +    ++ Q    +EL G +V   I  G+ I  ++L   G G  L++L+P+ KRA T+ +
Sbjct: 70  EKSWRELSQYTDPKELVGQIVAGAIYPGEIIIEQRLTVPGEGSTLAALIPENKRAITIRV 129

Query: 137 SISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTA 195
           +    V G + P + VDV+   S S+   +   VL +I+V+A+D    + E + ++    
Sbjct: 130 NDVIGVAGFLLPGNRVDVLNTVSYSKGSASTKTVLKDIKVLAVDQTARTKENKPIIVRAV 189

Query: 196 TLELTPMQAKALVAAQSVAKLSLVLRSIADLNP 228
           TLE+TP QA+ L++A+S  ++ L LR+  +   
Sbjct: 190 TLEVTPDQAEKLLSAKSKGEIQLTLRNPHEPEE 222


>gi|21673268|ref|NP_661333.1| hypothetical protein CT0429 [Chlorobium tepidum TLS]
 gi|21646356|gb|AAM71675.1| conserved hypothetical protein [Chlorobium tepidum TLS]
          Length = 278

 Score =  177 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 58/246 (23%), Positives = 115/246 (46%), Gaps = 19/246 (7%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
           + R + +V++     +   IA R +S                  +V+I +  +A G  + 
Sbjct: 1   MKRPIFVVIALTLGAMTAFIAARWMSGPKASGP-----------SVVIVEQPIAAGRPIL 49

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGL 121
              ++ +++    V               ++ G +  VP++ G+P+   KL   G  GGL
Sbjct: 50  AGQIKAISWSGSVVPQEAFSRTA------DVVGRIALVPMIPGEPVLPGKLAPIGATGGL 103

Query: 122 SSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDH 181
           SS++P GKRA ++ ++    V G   P  +VD+++       +P   +VLS ++V+A++ 
Sbjct: 104 SSIIPAGKRAISVRVNDVVGVAGFALPGSYVDILVSGRDVSGQPFSRIVLSKVKVLAVEQ 163

Query: 182 -NIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQ 240
             +   ++  V +  TLEL+P +++ L  A+++  LSLVLR+  D    +S    + DV 
Sbjct: 164 DTVAEKDKPKVVNAVTLELSPQESEKLDLARNIGALSLVLRNELDTTVVNSVGVRLSDVV 223

Query: 241 EEGKEI 246
              + +
Sbjct: 224 YPQRGV 229


>gi|253701799|ref|YP_003022988.1| Flp pilus assembly protein CpaB [Geobacter sp. M21]
 gi|251776649|gb|ACT19230.1| Flp pilus assembly protein CpaB [Geobacter sp. M21]
          Length = 291

 Score =  177 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 54/210 (25%), Positives = 108/210 (51%), Gaps = 13/210 (6%)

Query: 34  TEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQEL 93
            +EV +    +   ++++  D+ +G  +TP  L+  ++P++++  G   D+      + +
Sbjct: 30  QQEVKSAKAIQPQRIVVAAADIPIGTAITPAQLKVTSWPKDSIPPGSARDI------EAV 83

Query: 94  DGVLVRVPILKGDPIRLEKLVD----RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPN 149
              +   PI  GD +   KL       G G ++ ++P+G RA T+ ++  + V G + P+
Sbjct: 84  ANRVAIRPITGGDAVTEAKLKPRSGAPGAGFMTYVVPQGHRAVTVAVNEVAGVAGFLTPS 143

Query: 150 DHVDVVMVR--SLSERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKA 206
           D VDV++      +E++    +VL N+ ++A     D  E + +V  T TL+L P  A+ 
Sbjct: 144 DRVDVIVTTPLPGNEKENISKIVLENVPILATGQVTDQKEGKPVVVPTVTLDLVPDDAEK 203

Query: 207 LVAAQSVAKLSLVLRSIADLNPSSSEDSDV 236
           LV + S   L L+LR+I+D++   S  + +
Sbjct: 204 LVLSASKGSLQLLLRNISDISHVDSRGATI 233


>gi|197117447|ref|YP_002137874.1| Flp pilus assembly protein CpaB [Geobacter bemidjiensis Bem]
 gi|197086807|gb|ACH38078.1| Flp pilus assembly protein CpaB [Geobacter bemidjiensis Bem]
          Length = 291

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 54/210 (25%), Positives = 109/210 (51%), Gaps = 13/210 (6%)

Query: 34  TEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQEL 93
            +EV +   A+   ++++  D+ +G  +TP  L+  ++P++++  G          ++ +
Sbjct: 30  QQEVKSAKAAQPQRIVVAAVDIPIGTAITPAQLKVASWPKDSIPPG------SARGIEAV 83

Query: 94  DGVLVRVPILKGDPIRLEKLVD----RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPN 149
              +   PI  GD +   KL       G G ++ ++P+G RA T+ ++  + V G + P+
Sbjct: 84  ANRVAIRPITGGDAVTEAKLKPRSGAPGAGFMTYVVPQGHRAVTVAVNEVAGVAGFLTPS 143

Query: 150 DHVDVVMVRSL--SERKPTVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKA 206
           D VDV++   +  +E++    +VL N+ ++A     D  E + +V  T TL+L P  A+ 
Sbjct: 144 DRVDVIVTTPVPGNEKENISKIVLENVPILATGQVTDQKEGKPVVVPTVTLDLVPDDAEK 203

Query: 207 LVAAQSVAKLSLVLRSIADLNPSSSEDSDV 236
           LV + S   L L+LR+I+D +   S+ + +
Sbjct: 204 LVLSASKGSLQLLLRNISDSSHVDSKGATI 233


>gi|114568969|ref|YP_755649.1| Flp pilus assembly CpaB [Maricaulis maris MCS10]
 gi|114339431|gb|ABI64711.1| Flp pilus assembly CpaB [Maricaulis maris MCS10]
          Length = 278

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 69/231 (29%), Positives = 120/231 (51%), Gaps = 19/231 (8%)

Query: 44  KFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPIL 103
             + +L ++ D+ +G  ++     W A+P+E +  G+I + ++   + +  G +VR PI 
Sbjct: 42  PAVRILAARRDVEIGERISAADFYWQAWPDEALAPGYIVE-NRGQTIADFAGSVVRAPIS 100

Query: 104 KGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV----- 157
           +G+PI   +LV  G+ G ++++L  G RA  + IS  +  GG I PND VDV++      
Sbjct: 101 QGEPITGRRLVQPGDAGFMAAVLTPGMRAVAVPISAETGAGGFILPNDRVDVIVSFEEET 160

Query: 158 --RSLSERKPTVTVVLSNIRVIAIDH--NIDSDERVLVGSTATLELTPMQAKALVAAQSV 213
             R  + R      ++ N RV+AID   + ++D+ V VG TATLELTP QA+A+  A + 
Sbjct: 161 EGRRGAGRAFVARTIVENARVLAIDQSFSSEADDEVAVGETATLELTPDQARAVSVAVAR 220

Query: 214 AKLSLVLRSIADLNPSS--------SEDSDVWDVQEEGKEIQIIKAGVIVN 256
            +++LVLRS+ D + +          E       +     + +I+ G    
Sbjct: 221 GEIALVLRSLTDNSGAPVLVSGGELPEAPSQSFQERRSSSVTLIRYGRAQQ 271


>gi|146276365|ref|YP_001166524.1| Flp pilus assembly protein CpaB-like protein [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145554606|gb|ABP69219.1| Flp pilus assembly protein CpaB-like protein [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 274

 Score =  175 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 53/255 (20%), Positives = 107/255 (41%), Gaps = 9/255 (3%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENP--AKFINVLISKGDLAVG 58
           M+   ++ +++    A  A  +A   +S   V  E+           + V ++   L  G
Sbjct: 1   MRFVFVLVLLLGLGLAGSAVYMAQGYISQTQVALEKEREARKRLGPMVEVFVTNKPLNYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG- 117
             ++   ++ + +P   + +    D       +      V   + K +P+   K+ + G 
Sbjct: 61  APLSREDVQKILWPANALPETIFKD-ETALFPETGKPRYVLRQMEKFEPVLAVKVTEPGV 119

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVI 177
             GL   L  G RA  + + ++S V G ++P D VDV    + +  + T  ++   I ++
Sbjct: 120 EAGL--RLASGMRAFAIKVDVASGVSGFLQPGDRVDVYWTGAGANGE-TTRLIEKTIPIV 176

Query: 178 AIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
           A+D   ++D     ++  T T+E++P Q   L  AQ+  +LSL L    D   + +   D
Sbjct: 177 AVDQTANADLATSAIIARTVTVEVSPQQVARLAQAQATGRLSLSLVGRDDTTEADAAPVD 236

Query: 236 VWDVQEEGKEIQIIK 250
              +  E   I +I+
Sbjct: 237 TRILIGEPDRIVVIE 251


>gi|78357402|ref|YP_388851.1| putative pilus assembly protein CpaB [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78219807|gb|ABB39156.1| putative pilus assembly protein CpaB [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 272

 Score =  175 bits (444), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 110/247 (44%), Gaps = 22/247 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVL--ISKGDLAVG 58
           MK + L+ I V+ V AL AG +  R++           T  P K  +V+  ++  D+  G
Sbjct: 1   MKKSSLIQIAVALVLALGAGALVFRMM------QAPARTAQPPKVASVMLAVAAADMTKG 54

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG- 117
             +    +    F  +    G        ++  EL G ++   +  G+PI   +LV+   
Sbjct: 55  TRIRAEQITMAEFLLQTAPAGAF------SSADELTGRVLASAVTAGEPITPARLVEDTV 108

Query: 118 -NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER---KPTVTVVLSN 173
             GG+S+++  GKRA  +  +    + G I+P +HVDV++    + R   K     VL N
Sbjct: 109 RYGGVSTMISPGKRAVAVKGNNVLGMAGFIRPGNHVDVLVTIDDNRRPQDKAVTKTVLEN 168

Query: 174 IRVIAIDHNIDS---DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           IRV+A    ++    D         TLE+ P + + L  A S  ++   LR+ AD +   
Sbjct: 169 IRVLATGTELEQQGDDTATSPVDIYTLEMLPREVEVLSLAASRGEVHFSLRNPADTDSVK 228

Query: 231 SEDSDVW 237
           +  +DV 
Sbjct: 229 TAGTDVP 235


>gi|134299960|ref|YP_001113456.1| SAF domain-containing protein [Desulfotomaculum reducens MI-1]
 gi|134052660|gb|ABO50631.1| SAF domain protein [Desulfotomaculum reducens MI-1]
          Length = 234

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 57/236 (24%), Positives = 109/236 (46%), Gaps = 19/236 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+    +  +++ +F LVA     + +             +   F  V++    L    +
Sbjct: 1   MRNK--LIFILAIIFGLVAAFGVYQYLGHLKQSY-----RSSGNFKQVVVPTQPLGPKTL 53

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG--N 118
           +T  +++    P E +  G         A Q++ G + R  +   +PI L ++      +
Sbjct: 54  ITDKMVKVKDIPVELIQPG------TAIAPQDVVGKITRSELYPEEPIMLNRIYKDSNTD 107

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS-LSERKPTVTVVLSNIRVI 177
           G L+ L+P+G+RA T+ +   S V G+++P DHVD+++      E+    T++L NI+V+
Sbjct: 108 GDLALLIPEGQRALTVAVDDVSGVAGLLQPGDHVDIIVTFDYEGEQTSLSTLLLQNIQVL 167

Query: 178 AIDHNIDSD---ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           A+  ++D+    E+     T TL + P QA  L  A     + L+LRS  D   ++
Sbjct: 168 AVGQSLDNTPKAEKKTSSQTVTLSVQPGQATPLTLATERGSIRLMLRSPKDAGTAN 223


>gi|116626780|ref|YP_828936.1| SAF domain-containing protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116229942|gb|ABJ88651.1| SAF domain [Candidatus Solibacter usitatus Ellin6076]
          Length = 309

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 63/246 (25%), Positives = 119/246 (48%), Gaps = 21/246 (8%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVV 61
           +  + +    + V AL+                   +     K + V+++  D+A+G ++
Sbjct: 3   RQKKFLLFGAAWVSALLLTWFYY----------ANAVAPKQEKTLRVVVASRDMAIGTLL 52

Query: 62  TPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-G 120
             + L+ V +PE+++  G +        +Q  +  +V VP+   +P+   KL D     G
Sbjct: 53  KKSDLKVVNYPEKDIPKGAV------FTLQGAENRVVMVPMNTNEPVLQGKLSDTTTVEG 106

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
           ++S + KG RA ++ ++  + V G+I+P  HVDV+  R  S  + T + +L N+RVI+  
Sbjct: 107 VASTIEKGYRAVSVQVTDVTGVAGLIQPGSHVDVLFTRPGSMAEATTSTILQNVRVISTG 166

Query: 181 HNIDS----DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDV 236
            +I +    D R     T TL LTP +A+ L  A++  ++ L LR+  DLN  +S +   
Sbjct: 167 RSITAGQVVDPRAPKSPTVTLVLTPDEAQKLELAKNQGRIGLSLRNPLDLNRDASTEPLT 226

Query: 237 WDVQEE 242
            +V + 
Sbjct: 227 TEVLDP 232


>gi|294012432|ref|YP_003545892.1| Flp pilus assembly protein CpaB [Sphingobium japonicum UT26S]
 gi|292675762|dbj|BAI97280.1| Flp pilus assembly protein CpaB [Sphingobium japonicum UT26S]
          Length = 338

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 56/226 (24%), Positives = 109/226 (48%), Gaps = 14/226 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVIT-ENPAKFINVLISKGDLAVGM 59
           M   +++ +V + + A+   ++A  ++S          +    A   +VL++   L VG 
Sbjct: 1   MDAKKIVLLVGALIIAVTTALLARNMLSSSSAPPAGASSMPVEADQPHVLVATKALPVGT 60

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
           ++      +  +P++ V   +   +      Q+L G ++R  I  G P+ L  ++  G  
Sbjct: 61  ILDAESFRFQPWPKDLVEQAYY--IKGQADPQKLVGSVIRTAISAGQPMTLGSVIKPGER 118

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK-----PTVTVVLSN 173
           G L++ L  G RA T+ +S  ++V G + P D VD+V+ +S+S             +L N
Sbjct: 119 GFLAAALGPGMRAVTVPVSAQNSVAGFVFPGDRVDLVLTQSVSGGGEGEPLKVSETILRN 178

Query: 174 IRVIAIDHNIDS---DERVLV--GSTATLELTPMQAKALVAAQSVA 214
           +RV+A D  +D+   D + +V   S  T+E+TP  A+ +  AQ++ 
Sbjct: 179 LRVLATDQRMDALGDDGKPVVQTYSNVTIEVTPKIAEKIAVAQTIG 224


>gi|89068016|ref|ZP_01155433.1| CpaB family protein [Oceanicola granulosus HTCC2516]
 gi|89046255|gb|EAR52312.1| CpaB family protein [Oceanicola granulosus HTCC2516]
          Length = 281

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 60/256 (23%), Positives = 113/256 (44%), Gaps = 5/256 (1%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQ--TEEVITENPAKFINVLISKGDLAVG 58
           M+    + ++V    A  A  +A   +     Q   E  +       + V      +  G
Sbjct: 1   MRAVFGLVLIVGVGLAGFAVYMAQGYLQDTQAQLARERAVAAQATPTVEVYAVTRQIGYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG- 117
             +TP+ +  V + E  + DG      +     +    +V  P+   +P+   K+ + G 
Sbjct: 61  EQLTPDDVTLVKYAEPFLPDGVFRAEEELFPEGDTQLRVVLRPMEVNEPVLAVKVTEPGE 120

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV-RSLSERKPTVTVVLSNIRV 176
           + G++S L +G RA  + + ++S V G ++P D VD+    R+    +    ++ SN+ +
Sbjct: 121 DAGITSRLGRGMRAFAIRVDVASGVSGFLRPGDKVDIYWTGRNSRGGEEVTKLIESNVNL 180

Query: 177 IAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
           IAID + D       +  T T+E+TP Q  AL  AQS  +LSL L    D   + + + D
Sbjct: 181 IAIDQSADGSALNTTIARTVTVEITPQQVAALAQAQSTGRLSLSLVGTNDDTVAEAIEVD 240

Query: 236 VWDVQEEGKEIQIIKA 251
              +    ++ Q+++A
Sbjct: 241 QRRLLGIPEQQQVVEA 256


>gi|159043679|ref|YP_001532473.1| SAF domain-containing protein [Dinoroseobacter shibae DFL 12]
 gi|157911439|gb|ABV92872.1| SAF domain protein [Dinoroseobacter shibae DFL 12]
          Length = 280

 Score =  172 bits (437), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 55/231 (23%), Positives = 99/231 (42%), Gaps = 5/231 (2%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHH--VQTEEVITENPAKFINVLISKGDLAVG 58
           M+L   + +++    A  A ++A      +   V  ++         + V +    +  G
Sbjct: 1   MRLVFGLVLLLGVGLAGFAVMMAKDRFDQYQTVVAKQQQKLAAAVDVVEVYVMDTPIRYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG- 117
             +  + +  V +P + + +G            E         +   +P+   K+ + G 
Sbjct: 61  EKIGKDDVRKVRWPADALPEGAFQTEEGLFPDAEGRLRTATRAMEANEPVLAVKVTEPGQ 120

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVI 177
           + G+SS L KG RA  + ++++S V G ++P D VDV    S S+ +    ++ S++++I
Sbjct: 121 DAGVSSRLGKGMRAFAISVTVTSGVSGFLRPGDRVDVYWSGS-SKGQDVTKLIQSSMQII 179

Query: 178 AIDHNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLN 227
            ID N D D     +  T T+E TP Q   L  AQ    LSL L   AD  
Sbjct: 180 GIDQNADMDRTAPTIARTVTVEATPQQVAGLAQAQRTGSLSLSLVGAADDA 230


>gi|307293449|ref|ZP_07573295.1| Flp pilus assembly protein CpaB [Sphingobium chlorophenolicum L-1]
 gi|306881515|gb|EFN12731.1| Flp pilus assembly protein CpaB [Sphingobium chlorophenolicum L-1]
          Length = 338

 Score =  172 bits (436), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 56/226 (24%), Positives = 109/226 (48%), Gaps = 14/226 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVIT-ENPAKFINVLISKGDLAVGM 59
           M   +++ +V + + A+   ++A  ++S          +    A   +VL++   L VG 
Sbjct: 1   MDAKKIVLLVGALIIAVTTALLARNMLSSSSAPQASASSMPVEADQPHVLVATKALPVGT 60

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
           ++      +  +P+E V   +       +  Q+L G ++R  I  G P+ L  ++  G  
Sbjct: 61  ILDAESFRFQPWPKELVEQAYYLKGQ--SDPQKLVGSVIRTAISAGQPMTLGSVIKPGER 118

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK-----PTVTVVLSN 173
           G L++ L  G RA T+ +S  ++V G + P D VD+++ +S+S             +L N
Sbjct: 119 GFLAAALGPGMRAVTVPVSAQNSVAGFVFPGDRVDLMLTQSVSGGGDGEPLKVSETILRN 178

Query: 174 IRVIAIDHNIDS---DERVLV--GSTATLELTPMQAKALVAAQSVA 214
           +RV+A D  +D+   D + +V   S  T+E+TP  A+ +  AQ++ 
Sbjct: 179 LRVLATDQRMDALGDDGKPVVQTYSNVTIEVTPKIAEKIAVAQTIG 224


>gi|308050060|ref|YP_003913626.1| Flp pilus assembly protein CpaB [Ferrimonas balearica DSM 9799]
 gi|307632250|gb|ADN76552.1| Flp pilus assembly protein CpaB [Ferrimonas balearica DSM 9799]
          Length = 288

 Score =  172 bits (436), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 56/249 (22%), Positives = 113/249 (45%), Gaps = 17/249 (6%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
           +  L  +++S  F + A ++A   +           ++       V+     +  G ++ 
Sbjct: 1   MRSLFFVLISIGFGIGAVLLAQNWLKQGQP------SDIDDNRQPVMTMAISVPSGTIIQ 54

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-L 121
              L   + P   V D  +         +++ G++ + P+++GD +  +KLV +G G  L
Sbjct: 55  EKHLVLKSVPPGLVPDEVLSKP------EQVVGMVAKFPLVEGDFLSRQKLVPKGEGSVL 108

Query: 122 SSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV---RSLSERKPTVTVVLSNIRVIA 178
           +SL+    RA T+ ++    V G + P + VDV++    R  ++      VVLSN++V+A
Sbjct: 109 ASLIAPNMRAVTIRVNDVVGVAGFLLPGNRVDVLVTLAKRRSADETAQTEVVLSNLKVLA 168

Query: 179 IDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVW 237
           +D   + D  + ++    TLE+T  QA+ L++A+S   + L LR+  D    +    +  
Sbjct: 169 VDQRANQDSNQPVLVRAVTLEVTLEQAEELMSARSRGNIQLALRNPNDDVEVAVASDEAA 228

Query: 238 DVQEEGKEI 246
              +   E 
Sbjct: 229 QTAQVAPEP 237


>gi|83312839|ref|YP_423103.1| Flp pilus assembly protein CpaB [Magnetospirillum magneticum AMB-1]
 gi|82947680|dbj|BAE52544.1| Flp pilus assembly protein CpaB [Magnetospirillum magneticum AMB-1]
          Length = 300

 Score =  172 bits (436), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 118/270 (43%), Gaps = 24/270 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+   ++ +VV+ + A    ++A   +     +  +    +    + +LI   D+  G  
Sbjct: 1   MRPI-VIIVVVAALAAGGTAMLAKSWLDRQEARRAK--AADEPATVEILIINRDVPSGAA 57

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR-GNG 119
           +  + L + ++P+  V    +      ++     G++ R P+ +G+P+          +G
Sbjct: 58  LAGDDLRYESWPKAAVSPRLVTRKPGEDSKAAFVGMIARRPLAEGEPVSAATTFRPEASG 117

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP-------------- 165
            ++ LL  G RA ++ I+  +AV G + P D VDVV+   + + +               
Sbjct: 118 VMAGLLAPGMRAISIAITNPTAVSGFVTPGDRVDVVLASDIKKSEEGINAEAGSGLLLRY 177

Query: 166 TVTVVLSNIRVIAIDHNI--DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSI 223
               VL+++RV+AID  I    D   + G TATLE+TP QA+ L  A  +  L L LR  
Sbjct: 178 GAETVLADLRVLAIDQQITRGRDGAPIQGKTATLEVTPKQAEILTVAGMMGTLQLSLRPQ 237

Query: 224 ----ADLNPSSSEDSDVWDVQEEGKEIQII 249
                   P+  E  D     E GK +Q +
Sbjct: 238 RGEDGAAKPAMGEVLDFTADLEAGKVLQAV 267


>gi|332188388|ref|ZP_08390113.1| flp pilus assembly protein CpaB [Sphingomonas sp. S17]
 gi|332011617|gb|EGI53697.1| flp pilus assembly protein CpaB [Sphingomonas sp. S17]
          Length = 329

 Score =  172 bits (436), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 68/258 (26%), Positives = 116/258 (44%), Gaps = 22/258 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEV---ITENPAKFINVLISKGDLAV 57
           M   +L+ +V + + A +  + A  L +            +   P     VL++   L V
Sbjct: 1   MDSRKLLLLVGALLVAGMTAVFARTLTAGSGAPQAGAAVIVAPPPETGPEVLVATRALPV 60

Query: 58  GMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG 117
           G ++    L++  +P+E V   +         + +L G +VR  I  G P+    +V  G
Sbjct: 61  GTIIDATALKFQPWPKEMVGGAYYLKGQA--DLAKLQGTVVRYAITAGQPLTQGAVVQPG 118

Query: 118 N-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK-----PTVTVVL 171
           + G L++ L  G RA T+ +S  + V G + P D +D+V+ + ++             +L
Sbjct: 119 DRGFLAAALTPGMRAVTVPVSAQTGVAGFVFPGDRIDMVLTQDVAGGGDGPPLKVSETIL 178

Query: 172 SNIRVIAIDHNIDS------DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
            N+RV+A D   DS         +   +T T+E TP  A+ L  AQ+V  LSL LR++AD
Sbjct: 179 RNVRVLATDQRTDSQSGEDGKTPIQTFTTVTVEATPKMAEQLAVAQTVGTLSLSLRALAD 238

Query: 226 -----LNPSSSEDSDVWD 238
                 NP++     V D
Sbjct: 239 RPDDLQNPAAVNAGPVAD 256


>gi|323702114|ref|ZP_08113782.1| Flp pilus assembly protein CpaB [Desulfotomaculum nigrificans DSM
           574]
 gi|323532996|gb|EGB22867.1| Flp pilus assembly protein CpaB [Desulfotomaculum nigrificans DSM
           574]
          Length = 234

 Score =  172 bits (435), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 57/245 (23%), Positives = 111/245 (45%), Gaps = 19/245 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+    + ++++ +F L A     + +             +   F  V++ K  +    +
Sbjct: 1   MRNK--LILILAILFGLAAAFGVFKYLDGLKKSY-----RSSGNFKQVVVPKQTIGPNTM 53

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL--VDRGN 118
           +T  +++    P E +  G   D       +++ G + R  +   +PI L +L       
Sbjct: 54  LTAQMVKVKDIPVEMIQPGTAMDT------KDVVGKVTRSDLYPEEPILLSRLHQDKDST 107

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT-VTVVLSNIRVI 177
           G L+  +P G+RA T+++   S V GM+KP DHVD+++       K T  +++L NI+V+
Sbjct: 108 GELALAIPTGQRALTVEVDAVSGVAGMLKPGDHVDILVTFDYEVEKTTLTSLLLQNIKVL 167

Query: 178 AIDH---NIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           A+     +    ++ +   T TL +TP QA  L       K+ L+LRS  D   ++   S
Sbjct: 168 AVGQSLVSAQKGDQKVNTQTVTLAVTPEQAPPLTLGSERGKIRLMLRSPKDEGTANLPSS 227

Query: 235 DVWDV 239
            + ++
Sbjct: 228 RMQNL 232


>gi|149176582|ref|ZP_01855195.1| Flp pilus assembly CpaB [Planctomyces maris DSM 8797]
 gi|148844695|gb|EDL59045.1| Flp pilus assembly CpaB [Planctomyces maris DSM 8797]
          Length = 349

 Score =  171 bits (434), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 57/256 (22%), Positives = 118/256 (46%), Gaps = 21/256 (8%)

Query: 13  GVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFP 72
            V A+  G++AM  V     + ++   +   K  NVL++  ++  G  +  + +++ ++P
Sbjct: 3   LVIAVGCGLVAMLGVRQVLNKDDQ---QAEVKTANVLMTIAEIPPGTPLNESNVKFKSWP 59

Query: 73  EENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAA 132
            + V +G +        +++     ++   + G+ +   KL ++G  G S  +P GKR  
Sbjct: 60  IDQVPEGAVTK------LEQYKDRSIKTRAVPGEIVMKAKLSEQGVRGASVEIPDGKRVF 113

Query: 133 TMDISISSAVGGMIKPNDHVDVVMVRSLSERKP----TVTVVLSNIRVIAIDHNID---S 185
           T  + ++    G+I P D VDV +  +  + +        V+L  +++ A DH  D   +
Sbjct: 114 TTSVDMTKTHSGLILPGDFVDVYVTFTARKPEGGMSTITKVILERVKIFATDHLTDVGGT 173

Query: 186 DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKE 245
           +   +     +L L+P +   L  A+   ++ L LR+ +D    S++  DV    +E  E
Sbjct: 174 ESNQVKSKNISLLLSPREGAMLKLAEKKGEVHLALRAQSD----STDSEDVQFDDDELAE 229

Query: 246 IQIIKAGVIVNKDGEG 261
           +  I+    + KDGE 
Sbjct: 230 VFSIEGSEYL-KDGEE 244


>gi|327189766|gb|EGE56910.1| putative cpaB pilus assembly protein [Rhizobium etli CNPAF512]
          Length = 304

 Score =  171 bits (434), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 52/248 (20%), Positives = 103/248 (41%), Gaps = 8/248 (3%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+ + ++ +V++ V A  A       +S    +   +      +   V ++   +  G  
Sbjct: 1   MRSSTILSLVIAFVLAAAAVFGMREYLSDQKARLLAMNGMKAEERTLV-VAAKPMRFGDR 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG- 119
           +    L+ + +P      G    +       +         I  G+P+   K+   G   
Sbjct: 60  IRSENLKAIPWPSNETPAGSFVSIETVVGNDD-QPRYAMAAIDPGEPVLSSKITGAGERA 118

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVR----SLSERKPTVTVVLSNIR 175
            LS+ L +G +A ++ ++    V G ++P+D VDV++ R         +  V V+L  ++
Sbjct: 119 TLSAALDQGMKAVSIRVNDVLGVAGFVRPSDRVDVLLTRVVRGPEGNDQTFVDVLLQGVK 178

Query: 176 VIAIDHNID-SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           V+A+D   D   +   V  T T E+T  +A+ L    S+  LSL LR++A  +   +   
Sbjct: 179 VLAVDQTADERKDEPSVVKTVTFEVTTDEAQRLTLGSSIGTLSLALRNVASSSIEQTRPI 238

Query: 235 DVWDVQEE 242
            V D+   
Sbjct: 239 TVADLGGG 246


>gi|23016178|ref|ZP_00055937.1| COG3745: Flp pilus assembly protein CpaB [Magnetospirillum
           magnetotacticum MS-1]
          Length = 296

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 75/282 (26%), Positives = 119/282 (42%), Gaps = 33/282 (11%)

Query: 11  VSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVA 70
           ++ + A   G++A   +     Q       + A  + VL+   D+  G  ++ + L + +
Sbjct: 1   MASLAAGGTGMLANAWLDR---QESRHAKADDAPVVEVLVINRDVPSGAALSVDDLRYES 57

Query: 71  FPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGK 129
           +P        +      +A     G++ R  + +G+P+         + G L+ LL  GK
Sbjct: 58  WPRSAATARLVVRRPGEDAKAAFVGMIARRALTEGEPVSAATTFKPDSSGVLAGLLGPGK 117

Query: 130 RAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT----------------------V 167
           RA ++ I+  +AV G I P D VDVVM+  L + +                         
Sbjct: 118 RAISITITNPTAVSGFITPGDRVDVVMLTDLKKIEDAQGRESKQEEGRFGGETLLVRFGA 177

Query: 168 TVVLSNIRVIAIDHNI--DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
             VLS+IRV+AID  I    D   + G TATLE+TP QA+ LV A+++  L L LR    
Sbjct: 178 ETVLSDIRVLAIDQQITRGRDGAAIQGKTATLEVTPKQAEILVLAETMGMLQLSLRPQQG 237

Query: 226 LNPSSSEDS----DVWDVQEEGKEIQIIKAGVIVNKDGEGIS 263
             P+ +       D     E GK +Q    G    K G   S
Sbjct: 238 DGPAVAPQPGEMLDFTADLEAGKALQ-ASVGFAAKKKGTKAS 278


>gi|209546484|ref|YP_002278402.1| Flp pilus assembly protein CpaB [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537728|gb|ACI57662.1| Flp pilus assembly protein CpaB [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 305

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 53/248 (21%), Positives = 102/248 (41%), Gaps = 8/248 (3%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+ + ++ +V++ V A  A       +S    +   +      +   + ++   +  G  
Sbjct: 1   MRSSTILSLVIAFVLAAAAVFGMREYLSDQKARLLAMNGVKAEERTLI-VAAKPMRFGDR 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG- 119
           + P  L  + +P      G    +                 I  G+P+   K+   G   
Sbjct: 60  IRPENLRAIPWPSNETPAGSFVSIETVVGSDA-QPRYAMAAIDPGEPVLSSKITGAGERA 118

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVR----SLSERKPTVTVVLSNIR 175
            LS+ L +G +A ++ ++    V G ++P+D VDV++ R         +  V V+L  ++
Sbjct: 119 TLSAALDQGMKAVSIRVNDVLGVAGFVRPSDRVDVLLTRVVRGPAGNDQTFVDVLLQGVK 178

Query: 176 VIAIDHNID-SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           V+A+D   D   +   V  T T E+T  +A+ L    S+  LSL LR+IA  +   +   
Sbjct: 179 VLAVDQTADERKDEPSVVKTVTFEVTTDEAQRLTLGSSIGTLSLALRNIASASVEQTRPI 238

Query: 235 DVWDVQEE 242
            V D+   
Sbjct: 239 TVADLGGG 246


>gi|260426594|ref|ZP_05780573.1| Flp pilus assembly protein CpaB [Citreicella sp. SE45]
 gi|260421086|gb|EEX14337.1| Flp pilus assembly protein CpaB [Citreicella sp. SE45]
          Length = 286

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 52/245 (21%), Positives = 110/245 (44%), Gaps = 11/245 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVS--PHHVQTEEVITENPAKFINVLISKGDLAVG 58
           M+L   + ++     A  A  +A +      + +Q E            + ++   +  G
Sbjct: 1   MRLVFGLVLIAGLGLAGFAVHLAQKQFGAYQNALQLERAKAVKAVPTRMIYVTTQAVPTG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG- 117
            V+    ++   +P+E + +G  D+ + P A  E    +V   + K + +   ++ + G 
Sbjct: 61  EVLRKEYVKLAPWPQEILPEGVFDETNPPFADGEAP-RVVTRAMDKFEAVLTTRISEPGG 119

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE------RKPTVTVVL 171
           + GL++ L +G+RA  + + ++S V G ++P D VDV     +        R     ++ 
Sbjct: 120 DAGLTTRLERGQRAFAIKVDVTSGVSGFLRPGDRVDVYWTGKMPGTDANLPRGEVTKLIE 179

Query: 172 SNIRVIAIDHNID-SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           + +++IAID   +  +    +  T T+ ++P Q   L  AQS  +LSL L +  D + + 
Sbjct: 180 TAVKLIAIDQTAEVENSDATIARTVTVAVSPQQVAGLAQAQSTGRLSLSLLAANDDSIAE 239

Query: 231 SEDSD 235
           + + D
Sbjct: 240 AIEVD 244


>gi|225872753|ref|YP_002754210.1| putative flp pilus assembly protein CpaB [Acidobacterium capsulatum
           ATCC 51196]
 gi|225791215|gb|ACO31305.1| putative flp pilus assembly protein CpaB [Acidobacterium capsulatum
           ATCC 51196]
          Length = 271

 Score =  170 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 56/251 (22%), Positives = 102/251 (40%), Gaps = 18/251 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  +L  ++ + V +    ++  R ++              A     + +   +AVG V
Sbjct: 1   MKSRQLTALLAALVISGGFTLLLGRKLTHS--------AHRAAPQKQYMAAARPIAVGEV 52

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG- 119
           +    ++ + +P      G +         +++ G     P+  G PI    L   G+  
Sbjct: 53  IQAADVKTILWPANLPLQGGMATT------KDVIGRAAIFPVTVGQPILSTDLAAPGSSL 106

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV-RSLSERKPTVTVVLSNIRVIA 178
           G+++ +P G RA  +      AVGG I P  HVDV++  R+    +P    VL N  V+A
Sbjct: 107 GITTRIPNGMRAIALHTDDVIAVGGFIFPGSHVDVLVTYRNPGSPQPITATVLQNALVLA 166

Query: 179 IDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDV 236
             H    D   +    +  TL L+P  A+  V A +   +  VLR+ AD        +D+
Sbjct: 167 TGHQTQPDPQGKPTTVNIVTLLLSPEDAERAVLASTQGTIHFVLRNGADQQKGMPPPADL 226

Query: 237 WDVQEEGKEIQ 247
            ++     + +
Sbjct: 227 AELDGYSPQPR 237


>gi|317154606|ref|YP_004122654.1| Flp pilus assembly protein CpaB [Desulfovibrio aespoeensis Aspo-2]
 gi|316944857|gb|ADU63908.1| Flp pilus assembly protein CpaB [Desulfovibrio aespoeensis Aspo-2]
          Length = 273

 Score =  170 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 62/275 (22%), Positives = 120/275 (43%), Gaps = 30/275 (10%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
              L+ I +S + AL  G++     S     T++ +    A+ + V+++  DL  G+ +T
Sbjct: 5   ARALIQIGISLILALGTGVLIFMWTSGV---TQQPVAAPRAETVPVVVALTDLRPGIKLT 61

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG--NGG 120
           P +LE   F  ++   G   +         LDG ++ V +   + +   KL D     GG
Sbjct: 62  PAMLETRQFTPDSRPSGAFGEPGL------LDGRVLGVAVGANEAVTEAKLADASVIGGG 115

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV---RSLSERKPTVTVVLSNIRVI 177
           +S+L+  GKRA ++  +    + G ++P D VDV++       ++ +P   +VL  ++V+
Sbjct: 116 VSALIEPGKRAMSVKGNAVMGLAGFVRPGDRVDVIVSLVQGRGNQEEPVTKLVLERVKVL 175

Query: 178 AID---HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           A        D++ +       TLELTP +++ L  A +   L+  LR+  D +   ++  
Sbjct: 176 ATGTELQAPDTEGKAASVDVYTLELTPDESERLALAATQGTLNFALRNATDTDKVLTDGV 235

Query: 235 DV-------------WDVQEEGKEIQIIKAGVIVN 256
            V               V+     +++I  G    
Sbjct: 236 TVNKALAALRPAPKPAPVRRNQVSVEVITGGETTT 270


>gi|114764945|ref|ZP_01444118.1| CpaB family protein [Pelagibaca bermudensis HTCC2601]
 gi|114542657|gb|EAU45681.1| CpaB family protein [Roseovarius sp. HTCC2601]
          Length = 286

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 53/238 (22%), Positives = 106/238 (44%), Gaps = 10/238 (4%)

Query: 27  VSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQ 86
              + +Q E            + +    +A G ++TP+ ++   +P E + +G   +  +
Sbjct: 29  AYQNALQEERQKAVEAVPTGRIYVMTRPIARGEILTPDAVKLAPWPMEIMPEGIFTE-KR 87

Query: 87  PNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGM 145
           P  ++     +V   + K D +   ++ + G + GL+S L +G+RA  + + +++ V G 
Sbjct: 88  PLFVEGDAPRVVVNAMDKFDAVLDGRVSEPGGDAGLTSRLERGERAFAIKVDVATGVSGF 147

Query: 146 IKPNDHVDVVMVRSLSERKP------TVTVVLSNIRVIAIDHNIDSD--ERVLVGSTATL 197
           ++P D VDV     +    P         ++ + IR+IA+D   +S+      +  T T+
Sbjct: 148 LRPGDRVDVYWTGRVPGNDPNLPQGDVTKLIETGIRLIAVDQTAESETANPTTIARTVTV 207

Query: 198 ELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAGVIV 255
            +TP Q   L  AQS  +LSL L +  D   + + + D   +    K  Q ++   I 
Sbjct: 208 AITPQQVAGLAQAQSTGRLSLSLMAANDETVADAIEVDQRALLGLTKREQQVEKKSIQ 265


>gi|84386798|ref|ZP_00989823.1| Flp pilus assembly protein CpaB [Vibrio splendidus 12B01]
 gi|84378326|gb|EAP95184.1| Flp pilus assembly protein CpaB [Vibrio splendidus 12B01]
          Length = 293

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 59/271 (21%), Positives = 116/271 (42%), Gaps = 29/271 (10%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   RLM + +   F  V GI  + L   ++        +   + + VL+    + +G  
Sbjct: 1   MTAKRLMLLSL---FCSVLGISVLLLSQTNNESASTSSKQAVKQTVKVLVPTRTIEIGQA 57

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELD-GVLVRVPILKGDPIRLEKLVDRGNG 119
            TPN   W   P++ + + +ID V   +   +     L R  ++K   +    + +   G
Sbjct: 58  YTPNSFRWKEVPQQEL-ENYIDHVTPEDISADHTMSGLARTKLVKDSILSKADITEPEGG 116

Query: 120 -GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE---------RKPTVTV 169
             LS  L  G RA ++ +   ++  G I+P D VD++++ S            +   VT 
Sbjct: 117 YSLSLKLQPGYRAISVPVDQVTSNSGFIEPGDRVDILLLGSQDGELLRYGNSSQGLYVTT 176

Query: 170 VLSNIRVIAID--HNIDSDERVLVGS----------TATLELTPMQAKALVAAQSVAKLS 217
           ++ + RV+A +     +S ++    +          + +LE+TP QA  +V A+ + KL+
Sbjct: 177 IVHDARVLAFNDKQTAESYQKARESNQHKKVVPDDSSVSLEVTPEQANQVVLAKQLGKLT 236

Query: 218 LVLR--SIADLNPSSSEDSDVWDVQEEGKEI 246
           LVLR  + A   P  +    +  +  +  ++
Sbjct: 237 LVLRGQNEAQDQPQHANAVTLKVISPDTTQV 267


>gi|84501677|ref|ZP_00999849.1| CpaB family protein [Oceanicola batsensis HTCC2597]
 gi|84390298|gb|EAQ02857.1| CpaB family protein [Oceanicola batsensis HTCC2597]
          Length = 265

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 45/213 (21%), Positives = 89/213 (41%), Gaps = 7/213 (3%)

Query: 43  AKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPI 102
                V +    L  G  ++   +  + +P   + +G   + +      +     V   +
Sbjct: 23  VPTKMVYVVNRQLKYGEQLSRADVRQIEWPAAAIPEGVFHEENTLFPENDPRPRFVLRTM 82

Query: 103 LKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS 161
            + + +   K+   G + GL+S L KG RA  + + ++S V G ++P D VD+     +S
Sbjct: 83  ERNEAVLTGKVTAPGEDAGLTSRLEKGMRAFAIKVDVASGVSGFLRPGDKVDIYWTGRVS 142

Query: 162 E-----RKPTVTVVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAK 215
                       ++ + I++IA+D   + D    ++  T T+ + P Q  AL  AQS  +
Sbjct: 143 GMDRNASGEVTKLIETGIQLIAVDQMANGDHSEAMIARTVTVAVNPQQVGALAQAQSTGR 202

Query: 216 LSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQI 248
           L+L L    D   + + + D   +    +  QI
Sbjct: 203 LALSLVGNLDDTVAEAIEVDQRSLLGLSEAPQI 235


>gi|220922531|ref|YP_002497833.1| Flp pilus assembly protein CpaB [Methylobacterium nodulans ORS
           2060]
 gi|219947138|gb|ACL57530.1| Flp pilus assembly protein CpaB [Methylobacterium nodulans ORS
           2060]
          Length = 307

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 55/223 (24%), Positives = 99/223 (44%), Gaps = 7/223 (3%)

Query: 24  MRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDD 83
              ++  ++ +   +   P     ++++   L  G  +TP     + +P E   +G    
Sbjct: 19  AAFLARSYLMSVSSVGPAPLPAHTIVVATQPLPFGTQLTPENTTEIDWPSETRLEGSF-- 76

Query: 84  VHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-GLSSLLPKGKRAATMDISISSAV 142
               + +   +  +V   I + + +   K+   G    LS+L+ +G RA  + +     V
Sbjct: 77  -ATRDELLRGERRVVLSSIARNEVVLAGKITGPGQRATLSTLIEEGMRAVAVRVDDVRGV 135

Query: 143 GGMIKPNDHVDVVMVRSLS--ERKPTVTVVLSNIRVIAIDHNI-DSDERVLVGSTATLEL 199
            G I PND VDVV+ R     E K    ++L N++V+AID    D  ++  V    TLEL
Sbjct: 136 AGFILPNDRVDVVLTRDEEARESKGFADILLQNVKVLAIDQLANDHADKPTVARAVTLEL 195

Query: 200 TPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEE 242
            P+QA+ ++ AQ V +LSL+L    +    +     V D+   
Sbjct: 196 NPVQAQKIILAQGVGRLSLILNKAGNATSDTPSRVTVADLGRP 238


>gi|90406751|ref|ZP_01214944.1| Flp pilus assembly protein CpaB [Psychromonas sp. CNPT3]
 gi|90312204|gb|EAS40296.1| Flp pilus assembly protein CpaB [Psychromonas sp. CNPT3]
          Length = 286

 Score =  169 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 62/267 (23%), Positives = 112/267 (41%), Gaps = 25/267 (9%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   RLM   V      + G+            T   + +   K + +L+S  ++  G +
Sbjct: 1   MTAKRLMYFSVFISLIGLLGLFM-----SVSSPTAPALIKEENKTLTILVSSQEIKSGRL 55

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEK-LVDRGNG 119
            + +I  W   PE ++ +            +     +V   +  G  +     L      
Sbjct: 56  YSASIFAWKKVPESDLAEQIDYIQKIDFNNKAYKKSIVTGDLPAGHIMSQSDFLTLEDGA 115

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE---------RKPTVTVV 170
            LS LL  G RA ++ +   +A  G+I+P DHVDV+++ S  +         R   V  +
Sbjct: 116 FLSVLLRPGYRAVSVGVDHITANSGLIRPGDHVDVLLLASKEKELRSTGNETRSLYVKTI 175

Query: 171 LSNIRVIA------IDHNIDSDERVL----VGSTATLELTPMQAKALVAAQSVAKLSLVL 220
           + N+RV+A      ID   +  +R        S  TLE+ P QA  ++ A  +  LS++L
Sbjct: 176 VQNVRVLALNDALQIDRYQEEKKRNKGMLPEKSAVTLEVLPAQANTVILANQLGTLSMLL 235

Query: 221 RSIADLNPSSSEDSDVWDVQEEGKEIQ 247
           R+ +D +  ++   D+ D+  E K++Q
Sbjct: 236 RNSSDNSILANTQVDIGDIFPEIKQVQ 262


>gi|163745847|ref|ZP_02153206.1| CpaB family protein [Oceanibulbus indolifex HEL-45]
 gi|161380592|gb|EDQ05002.1| CpaB family protein [Oceanibulbus indolifex HEL-45]
          Length = 286

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 62/245 (25%), Positives = 104/245 (42%), Gaps = 10/245 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENP--AKFINVLISKGDLAVG 58
           M+    + ++V    A  A  +A   +S +     +             V +++  L  G
Sbjct: 1   MRAVFGLVLLVGIALAGGAVYLAKDRISQYQAANAQAQAALAQVVPTQTVWVAEKPLKYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG- 117
             +T   +  V +PE  + +G   +          D  +V   I K + I   K+ + G 
Sbjct: 61  QPLTREDVRAVNWPENAIPEGSFIEETLLFPENTKDHRIVLRNIEKDEAIMAVKVTEPGE 120

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS-----LSERKPTVTVVLS 172
           + GL+S L +G RA T+ + +SS V G ++P D VDV           S       ++ S
Sbjct: 121 DSGLTSRLARGMRAFTIKVDVSSGVSGFLRPGDRVDVYWTGRVNVGNQSSNGDVTKLIES 180

Query: 173 NIRVIAIDHNIDS--DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
            +++IAID + D+   E   +  T T+ + P Q  AL  AQS  KLSL L    D   + 
Sbjct: 181 AVQLIAIDQSADALVMEEASIAKTVTVAVKPQQVAALAQAQSTGKLSLSLVGTNDDTVAE 240

Query: 231 SEDSD 235
           + + D
Sbjct: 241 AIEVD 245


>gi|254466356|ref|ZP_05079767.1| Flp pilus assembly protein CpaB [Rhodobacterales bacterium Y4I]
 gi|206687264|gb|EDZ47746.1| Flp pilus assembly protein CpaB [Rhodobacterales bacterium Y4I]
          Length = 285

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 55/246 (22%), Positives = 108/246 (43%), Gaps = 13/246 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVS--PHHVQTEEVITENPAKFINVLISKGDLAVG 58
           M+    + ++V    A  A ++A   +S   + +  E          ++V ++   L  G
Sbjct: 1   MRAVFGLVLIVGVALAGGAVMMAKNYISAYQNELARERAARAETVPTVDVFVATKPLKYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVH---QPNAMQELDGVLVRVPILKGDPIRLEKLVD 115
             ++ + +  V +PE  + +G    +     P +  +L   +V   + K + +   K+  
Sbjct: 61  ERLSQDAVRAVRWPENAIPEGAYTTLDALFPPQSGDKL--RVVLRAMEKDEAVMAVKVTA 118

Query: 116 RG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV----RSLSERKPTVTVV 170
            G + G++S L +G RA  + + +SS V G ++P D VDV        +   R     ++
Sbjct: 119 PGEDAGITSRLQRGMRAFAIKVDVSSGVSGFLRPGDKVDVYWTGMMPGAGGSRGEVTRLI 178

Query: 171 LSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
            +N+ ++A+D +   D    ++  T T+   P Q  AL  AQ+  +LSL L    D   +
Sbjct: 179 ETNVELVAVDQSAGGDINEAIIARTVTVAAKPAQVAALAQAQTTGRLSLALVGAGDDTIA 238

Query: 230 SSEDSD 235
           S  + D
Sbjct: 239 SVVEVD 244


>gi|86360579|ref|YP_472467.1| putative cpaB pilus assembly protein [Rhizobium etli CFN 42]
 gi|86284681|gb|ABC93740.1| putative cpaB pilus assembly protein [Rhizobium etli CFN 42]
          Length = 304

 Score =  169 bits (428), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 52/248 (20%), Positives = 102/248 (41%), Gaps = 8/248 (3%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+ + ++ +V++ V A  A       +S    +   +      +   V ++   +  G  
Sbjct: 1   MRSSTILSLVIAFVLAAAAVFGMRAYLSDQKARLLAMNGVKTEERTLV-VAATPMRFGDR 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG- 119
           +    L  + +P      G    +       +         I  G+P+   K+   G   
Sbjct: 60  IRSENLRAIPWPSNETPTGSFVSIDLVVG-NDAQPRYAMAAIDPGEPVLSSKITGAGERA 118

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVR----SLSERKPTVTVVLSNIR 175
            LS+ L +G +A ++ ++    V G ++P+D VDV++ R         +  V V+L  ++
Sbjct: 119 TLSAALDQGMKAVSIRVNDVLGVAGFVRPSDRVDVLLTRVVRGPAGNDQTFVDVLLQGVK 178

Query: 176 VIAIDHNID-SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           V+A+D   D   +   V  T T E+T  +A+ L    S+  LSL LR++A  +   +   
Sbjct: 179 VLAVDQTADERKDEPSVVKTVTFEVTTDEAQRLTLGSSIGTLSLALRNVASSSVEQTRPI 238

Query: 235 DVWDVQEE 242
            V D+   
Sbjct: 239 TVADLGGG 246


>gi|126725968|ref|ZP_01741810.1| CpaB family protein [Rhodobacterales bacterium HTCC2150]
 gi|126705172|gb|EBA04263.1| CpaB family protein [Rhodobacterales bacterium HTCC2150]
          Length = 284

 Score =  168 bits (425), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 50/257 (19%), Positives = 107/257 (41%), Gaps = 9/257 (3%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHH--VQTEEVITENPAKFINVLISKGDLAVG 58
           M+L     +V     A  A  +A   +  +   +   +   +N  +   V ++   L  G
Sbjct: 1   MRLVFGAVLVAGVGLAGFAVNMAQDRIGQYQSALAASQANAQNKVELKTVFVASKTLDYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN 118
            ++T   +     P +++ +G                  +   + + + +   K+   G 
Sbjct: 61  DMLTEEDVREAMVPVDSIPEGAFMAKADLFDENPNKPRQILRLMTENEILLAYKVTKPGE 120

Query: 119 -GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER-----KPTVTVVLS 172
             G+++LL  G RA ++ +  ++ V G++  +DHVDV      ++           ++ +
Sbjct: 121 EAGVATLLTPGMRAFSIRVDDTTGVAGLLNADDHVDVYWTGGKADGLGNRDGGVTKLIQA 180

Query: 173 NIRVIAIDHNIDSDERVLV-GSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSS 231
           N++++AID + D          T T+E++P Q  +L  AQ+  KLSL L  I+D   +  
Sbjct: 181 NVKLVAIDDSADKQRSSSRSARTVTVEVSPQQVASLAQAQNSGKLSLSLVGISDDIVALV 240

Query: 232 EDSDVWDVQEEGKEIQI 248
           E+ D   +    + + +
Sbjct: 241 EEVDQNRLLGVQETVVV 257


>gi|153006806|ref|YP_001381131.1| SAF domain-containing protein [Anaeromyxobacter sp. Fw109-5]
 gi|152030379|gb|ABS28147.1| SAF domain protein [Anaeromyxobacter sp. Fw109-5]
          Length = 322

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 96/221 (43%), Gaps = 14/221 (6%)

Query: 35  EEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELD 94
           E   +        V+++  D+    ++    L  + +P  +   G   D         L 
Sbjct: 52  EAKASAAKVPTTKVVVASVDIPSATMLRTESLSVIDWPSASTPQGTFADPAT------LV 105

Query: 95  GVLVRVPILKGDPIRLEKLVDRGNG-GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVD 153
             +V   + KG+PI   +L   G   GL+++LP G RA  + ++    V G + P D VD
Sbjct: 106 ERVVTSAVSKGEPILESRLAAPGTAAGLAAVLPAGMRAVAVRVNDVVGVAGFLHPGDAVD 165

Query: 154 VVMVRSLSERK---PTVTVVLSNIRVIAIDHNIDSD----ERVLVGSTATLELTPMQAKA 206
           V++  S S      P   ++L N+RV+A+   ++      ++ +  + ATL +   Q++ 
Sbjct: 166 VIVTMSPSGGGGQAPMSKIILQNVRVLAVGKEVERADRAFDKAIPATVATLMVDSEQSEK 225

Query: 207 LVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQ 247
           L  A +  ++ L LRS AD    ++       +   G+E +
Sbjct: 226 LALAATKGQILLSLRSGADEEMLATPGITPPVLLASGREPE 266


>gi|288956968|ref|YP_003447309.1| pilus assembly protein [Azospirillum sp. B510]
 gi|288909276|dbj|BAI70765.1| pilus assembly protein [Azospirillum sp. B510]
          Length = 288

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 65/235 (27%), Positives = 113/235 (48%), Gaps = 18/235 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MKL  +   + +   A+V G++    V          I +       + ++  DL  G  
Sbjct: 1   MKLGTVFLGIAAVSMAVVGGLMVQAAVGARGAPAAVEIPQR-----RIAVAAADLPAGSF 55

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL-VDRGNG 119
           + P  + W AFPE  +    +  V   + +  L G +VR  +  G+ I  ++L   R  G
Sbjct: 56  LQPMSVRWEAFPENALRPETL--VEGKDNIDSLVGAVVRDAVKAGEIISRDRLLSPRERG 113

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE----RKPTVTVVLSNIR 175
            L+++L  G RAA++ ++  S   G+I P DHVD+++ +  ++    R+     +L N+R
Sbjct: 114 FLAAVLAPGMRAASVAVNEVSGTAGLIFPGDHVDLLLTQEANDEGAARRLATETILDNLR 173

Query: 176 VIAIDHNID------SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
           V+A+D   D        +   V  T TLE+T  QA+ +  A ++ KL+L LRS+A
Sbjct: 174 VLAVDQRTDFPKGEEPGQTARVARTVTLEVTAKQAQVISVAANLGKLTLSLRSLA 228


>gi|218661134|ref|ZP_03517064.1| pilus assembly protein [Rhizobium etli IE4771]
          Length = 205

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 90/205 (43%), Positives = 130/205 (63%), Gaps = 4/205 (1%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  RL+ + V+ V A +AG++AMR+     V T+          +NVL+S G+LAVG  
Sbjct: 1   MKPARLIILAVAVVAAGLAGLLAMRMAGSGGVVTQVQSVIEKEPTVNVLVSSGNLAVGQR 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +    + W+A+P+  V  G I +  +P+A+++L G +VR+PI +G+PIR EK+ D  +  
Sbjct: 61  LEEGSVHWMAWPQGGVVPGLITEAEKPDAIKDLQGAVVRLPIFEGEPIRPEKVADSSSRI 120

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE-RKPTVTVVLSNIRVIAI 179
           LSSLLP GKRA   +IS+++  GG I PND VDV+MVR  +E  K     VLSN+RV+AI
Sbjct: 121 LSSLLPAGKRAVATEISVATGAGGFILPNDRVDVIMVRKGTEANKLITETVLSNVRVLAI 180

Query: 180 DHNIDSDE---RVLVGSTATLELTP 201
           D  I   +   + +VG+TATLELTP
Sbjct: 181 DQQIQEKDDGSKAVVGTTATLELTP 205


>gi|149200846|ref|ZP_01877821.1| Flp pilus assembly CpaB [Roseovarius sp. TM1035]
 gi|149145179|gb|EDM33205.1| Flp pilus assembly CpaB [Roseovarius sp. TM1035]
          Length = 289

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 51/248 (20%), Positives = 103/248 (41%), Gaps = 13/248 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPA--KFINVLISKGDLAVG 58
           M+    + ++V    A  A  +A   +  +  Q E    +     + +++ ++   L  G
Sbjct: 1   MRAVFGLVLIVGLGLAGFAVYMAKNYIDGYQRQLEAERQQRAPVIETVDIFVATRALQYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG- 117
             +  + +   AFP+ ++ +G      +     E         +   +PI   K+ + G 
Sbjct: 61  EALDKDAVRLTAFPKTSLPEGVFKATEELFPKGETVARRALRRMEMNEPILAVKVTEPGA 120

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER---------KPTVT 168
             G++S L +G RA  + + ++S V G ++P D +D+    S+                 
Sbjct: 121 EVGITSQLERGMRAFAIKVDVTSGVSGFLRPGDTIDIYWTGSVGAGNMRTEGNSMGEVTK 180

Query: 169 VVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLN 227
           ++ + +++IA+D   D D    ++  T T+ + P Q  AL  AQS  +LSL L    D  
Sbjct: 181 LIENGVKLIAVDQVADMDTSETVIARTVTVAVKPQQVAALAQAQSTGRLSLSLVGALDDT 240

Query: 228 PSSSEDSD 235
            +   + D
Sbjct: 241 VAEVIEVD 248


>gi|315497466|ref|YP_004086270.1| flp pilus assembly protein cpab [Asticcacaulis excentricus CB 48]
 gi|315415478|gb|ADU12119.1| Flp pilus assembly protein CpaB [Asticcacaulis excentricus CB 48]
          Length = 304

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 73/297 (24%), Positives = 131/297 (44%), Gaps = 47/297 (15%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITEN--PAKFINVLISKGDLAVG 58
           MK +R + + ++ V AL+  ++   ++  +         +    A  + VL++   L VG
Sbjct: 1   MKASRFVVVGIAAVAALLLALVVRGMIGGNGASNANASQKVAVEAPTVKVLVAARHLKVG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDD----------------------------------- 83
             +    L W A+PE+ + + +  D                                   
Sbjct: 61  ERIAEADLAWKAWPEDGITESYFTDKPVTPVAPAEAKSAEDKALEEKVKNGAAQVADVAD 120

Query: 84  --VHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISS 140
             ++    M  + G +VR  +L  +PI   K+V    GG ++ +L  G RA  + +++ S
Sbjct: 121 KTLNPTRGMDAVLGGVVREEMLANEPIVARKVVRADAGGFMAVMLAPGMRAMAVPVTVES 180

Query: 141 AVGGMIKPNDHVDVVMVRSLSERKPTV---TVVLSNIRVIAIDHNID--SDERVLVGSTA 195
             GG I P D VD+V+   L     T      VL N++V+A+D  ++  SD+  ++G+TA
Sbjct: 181 TAGGFILPGDRVDIVVSTELQSNGQTTHVAKPVLRNVKVLAVDQTVEAKSDQPSVIGATA 240

Query: 196 TLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAG 252
           TLE+ P + +AL  A++   LSL+LRS AD+   S            G ++ + + G
Sbjct: 241 TLEVRPEEGEALAQAKAQGPLSLMLRSYADVGGPSGRVG--PSATGTGNKVVVYRNG 295


>gi|13471033|ref|NP_102602.1| hypothetical protein mll0900 [Mesorhizobium loti MAFF303099]
 gi|14021777|dbj|BAB48388.1| mll0900 [Mesorhizobium loti MAFF303099]
          Length = 308

 Score =  166 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 57/247 (23%), Positives = 108/247 (43%), Gaps = 25/247 (10%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHV-----QTEEVITENPAK--FINVLISKG 53
           M+   +  I ++ VF  ++   A   V          +T  +    P +  F  ++++K 
Sbjct: 1   MRGKAITMIGIAAVFGAISIFAADFWVKSQAKADAEEKTASIAAPVPPRIEFKTIVVAKA 60

Query: 54  DLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL 113
            L  G  +    L  + +P++++  G    +            +V  PI   +P+ L KL
Sbjct: 61  PLRYGQELDRAKLIEIPWPQDSLPQGAFATIDGLLGEG---NRIVLSPIEVNEPVLLTKL 117

Query: 114 VDR-GNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP------- 165
               G   LS++L  G RA T+     + VGG + P D VDVV+ R   E +        
Sbjct: 118 SGPNGRATLSNMLTPGMRAVTIRTDEIAGVGGFVTPGDRVDVVLTRDAGEIQEVAKNAQG 177

Query: 166 ------TVTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSL 218
                 T  +V+++ +V+++    D  +    + ++ T+E+T   A+ +  A++V  LSL
Sbjct: 178 AAGSTVTSEIVVADAKVLSVGQGADERQTTPQITNSVTIEVTTEGAQKVALARTVGTLSL 237

Query: 219 VLRSIAD 225
            LRS ++
Sbjct: 238 SLRSASE 244


>gi|294676058|ref|YP_003576673.1| Flp pilus assembly protein CpaB [Rhodobacter capsulatus SB 1003]
 gi|294474878|gb|ADE84266.1| Flp pilus assembly protein CpaB [Rhodobacter capsulatus SB 1003]
          Length = 291

 Score =  166 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 55/252 (21%), Positives = 108/252 (42%), Gaps = 18/252 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITEN--PAKFINVLISKGDLAVG 58
           M++   + +V+    A +A  +A + +S   V+ + ++ E     + ++V++ +  LA G
Sbjct: 1   MRMIVALVLVLGVALAGLAVYMAQQQISQFQVERDRLVAEQRNAPQLVDVVVLRRPLAYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAM------------QELDGVLVRVPILKGD 106
              T   L  +     ++  G    V  P                E             +
Sbjct: 61  ERFTAADLGVIKMQVGHLPAGIFHSVATPQGAPEEAQAASVFPGGETRPRAALRAYDAYE 120

Query: 107 PIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP 165
            I   K+   G + G+++ L    RA T+ +  ++ V G ++P D VDV     ++  + 
Sbjct: 121 AILANKITAPGVDAGITASLSPNMRAFTISVDATTGVSGFLRPGDRVDVYWSGEVNGER- 179

Query: 166 TVTVVLSNIRVIAIDHNIDSD--ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSI 223
              ++ +N+R+IAID + D+D  E   +  T T E+TP Q  +L  AQ   +L+L L  +
Sbjct: 180 VTKLIDTNLRLIAIDQSADADRAEETQLAKTVTAEVTPEQVASLTLAQGTGELTLSLVGM 239

Query: 224 ADLNPSSSEDSD 235
            +     + + D
Sbjct: 240 QNTADPGAIEID 251


>gi|319779650|ref|YP_004130563.1| SAF domain protein [Taylorella equigenitalis MCE9]
 gi|317109674|gb|ADU92420.1| SAF domain protein [Taylorella equigenitalis MCE9]
          Length = 325

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 60/253 (23%), Positives = 107/253 (42%), Gaps = 9/253 (3%)

Query: 13  GVFALVAGIIAMRLVSPHHVQTEEVITENPAK-FINVLISKGDLAVGMVVTPNILEWVAF 71
             FA+ AGI+A    + +  +    I  N  +  I  +++ GD+  G ++  +IL     
Sbjct: 11  AGFAIGAGILATFSANKYMKEKISQIEANHRQVMIPRIVAAGDIPEGTIIDSSILAVRDI 70

Query: 72  PEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRA 131
           PE  V      D   P+  + ++G ++  P+  GDP+             S  +  G+RA
Sbjct: 71  PENWVSS----DSLSPDEFERIEGKIITSPLTAGDPVLWAHTSTVSRRPFSEKVAVGRRA 126

Query: 132 ATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHN--IDSDERV 189
            TM +   ++V G+I P D +D+ +      R      +L  + V+A D    + +D   
Sbjct: 127 VTMPVDTINSVSGLIVPGDLIDLYVSFKYRNRD-ITAPLLQGVLVLATDKESKLTNDGSE 185

Query: 190 LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS-SEDSDVWDVQEEGKEIQI 248
              ST TL+ +P +A  LVAA+    ++  LR+  D   S      D+  +        I
Sbjct: 186 REFSTVTLDTSPEEAAKLVAARQDGVITAFLRNPDDKKASQKGVKGDLASILGIATSGPI 245

Query: 249 IKAGVIVNKDGEG 261
           ++    V    +G
Sbjct: 246 VRKKASVIYGDQG 258


>gi|254512153|ref|ZP_05124220.1| Flp pilus assembly protein CpaB [Rhodobacteraceae bacterium KLH11]
 gi|221535864|gb|EEE38852.1| Flp pilus assembly protein CpaB [Rhodobacteraceae bacterium KLH11]
          Length = 290

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 63/270 (23%), Positives = 113/270 (41%), Gaps = 17/270 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQ-------TEEVITENPA---KFINVLI 50
           M+    + +++    A  A  +A   ++ +  +        EE +    A     ++VL+
Sbjct: 1   MRSVFGLVLIIGVALAGGAVYMAREYITDNQAKLAQERKLREEALANAKAGLVPTVDVLV 60

Query: 51  SKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRL 110
           S   L  G  +T   +  V +PE  + +G   ++         +   V   + K + I  
Sbjct: 61  SNRSLKYGEQLTQEDIRVVQWPENAIPEGTFVEIAALFPDTRDNERFVLRAMEKDEAIMA 120

Query: 111 EKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVR--SLSERKPTV 167
            K+   G   GL S LPKG RA  + + ++S V G ++P D VDV          R    
Sbjct: 121 VKVTAPGETAGLRSQLPKGMRAFAISVDVASGVSGFLRPGDTVDVYWTGAVRSEGRGEIT 180

Query: 168 TVVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADL 226
            +VL+NI ++A+D     D     +  T T+  TP Q  AL  AQ+  ++SL L    D 
Sbjct: 181 RLVLTNIELVAVDQTAGLDVTGTTIARTVTVAATPQQIAALAQAQNTGRMSLALVGAQDD 240

Query: 227 NPSSSEDSD---VWDVQEEGKEIQIIKAGV 253
             +   + D   +  ++E+     +++  V
Sbjct: 241 KVAEVVEVDQRALLGIEEQAPAPVVVEKKV 270


>gi|116620531|ref|YP_822687.1| SAF domain-containing protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223693|gb|ABJ82402.1| SAF domain [Candidatus Solibacter usitatus Ellin6076]
          Length = 299

 Score =  165 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 52/251 (20%), Positives = 108/251 (43%), Gaps = 19/251 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M    +  +  + + A  A ++  R++      T    T      + V ++  +L VG +
Sbjct: 1   MNKRFVGVLTFAFLVAAGASLVLYRVLINRPQATNAAPT-----MVQVALATRNLEVGTL 55

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +  + ++   +P   V  G    V      +++ G  V   I   +PI   +L  +G GG
Sbjct: 56  LKEDDVKLSDWP-GAVPIGATAQV------KDVLGRGVTTAIFAKEPIIESRLAPKGAGG 108

Query: 121 -LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT----VTVVLSNIR 175
            L++++P G RA  + ++    V G + P  HVD+++  +              +L NI 
Sbjct: 109 GLAAMIPSGMRAVAVRVNEVVGVAGFVVPGMHVDILISGNTPGGDGNLGTLTKTLLQNIE 168

Query: 176 VIAIDHNI--DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
           V++   +   D++ + ++     L +TP QA+ L  A +   + L+LR+  D   S +  
Sbjct: 169 VLSAGQDFKKDNEGKPIMVQVVNLLVTPEQAEQLSLASNQTTIQLILRNPLDHEISKTSG 228

Query: 234 SDVWDVQEEGK 244
           + +  +   G+
Sbjct: 229 TALRSLFTGGR 239


>gi|260463893|ref|ZP_05812089.1| Flp pilus assembly protein CpaB [Mesorhizobium opportunistum
           WSM2075]
 gi|259030268|gb|EEW31548.1| Flp pilus assembly protein CpaB [Mesorhizobium opportunistum
           WSM2075]
          Length = 299

 Score =  165 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 57/238 (23%), Positives = 104/238 (43%), Gaps = 23/238 (9%)

Query: 8   GIVVSGVFALVAGIIAMRLVSPHHVQTEE-----VITENPAKFINVLISKGDLAVGMVVT 62
            I ++ VF  ++   A   V       E+            +F  ++++   L  GM + 
Sbjct: 1   MIGIAAVFGAISIFAADFWVKSQADAQEKTASIAAPAPPKIEFKTIVVANAPLRYGMELD 60

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR-GNGGL 121
              L  + +P++++  G    +          G +V  PI   +P+ L KL    G   L
Sbjct: 61  RTKLIEIPWPQDSLPQGAFATIDGLLGEG---GRVVLSPIEVNEPVLLTKLSGPNGRATL 117

Query: 122 SSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP-------------TVT 168
           S++L  G RA T+     + VGG + P D VDVV+ R   E +              T  
Sbjct: 118 SNMLTPGMRAVTIRTDEIAGVGGFVTPGDRVDVVLTRDAGEIQEVAKNAQGAAGSTITSE 177

Query: 169 VVLSNIRVIAIDHNIDSDER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           +V+++ +V+++    D  +    + ++ TLE+T   A+ +  A++V  LSL LRS ++
Sbjct: 178 IVVADAKVLSVGQGADERQTAPQIANSVTLEVTTEGAQKVALARTVGTLSLSLRSASE 235


>gi|319943381|ref|ZP_08017663.1| SAF domain protein [Lautropia mirabilis ATCC 51599]
 gi|319743196|gb|EFV95601.1| SAF domain protein [Lautropia mirabilis ATCC 51599]
          Length = 339

 Score =  165 bits (418), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 52/268 (19%), Positives = 108/268 (40%), Gaps = 15/268 (5%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVV 61
           +   L+ +  + +   VA     R V+       E +     + ++V+++   L  G +V
Sbjct: 11  RHRNLLLMSAAMLCGGVAIYAGSRYVNEQVQAERERLAPVAQQMVDVVVANATLDKGEIV 70

Query: 62  TPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGL 121
           +   +   + P E V    +     P     L G  + +P+  G+ +    +        
Sbjct: 71  SGETMAIRSVPAEYVSSSVVT----PEQFDALVGQRLLLPMRPGEMLSTAAVSSAEQLVF 126

Query: 122 SSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK-------PTVTVVLSNI 174
           SS +  G RA T+ +   +++ GM++P D +D+++                    +L N+
Sbjct: 127 SSRVKPGIRALTISVDEINSISGMLQPGDRIDLLLTARPPSASGHGEAEHDATVPLLQNL 186

Query: 175 RVIAIDHN----IDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
            V+A         + +      S+ T+E+TP QA+ L+ AQ   +L+ VLR+  D  P  
Sbjct: 187 LVMATGRQVRPGANDNGDDRSFSSVTVEVTPSQAQRLIVAQRAGRLTAVLRNPDDGMPMD 246

Query: 231 SEDSDVWDVQEEGKEIQIIKAGVIVNKD 258
           +   D+  +  +     +    V+  +D
Sbjct: 247 AAAVDLRSLFPQPARPAVAPRKVVARQD 274


>gi|329847252|ref|ZP_08262280.1| flp pilus assembly protein CpaB [Asticcacaulis biprosthecum C19]
 gi|328842315|gb|EGF91884.1| flp pilus assembly protein CpaB [Asticcacaulis biprosthecum C19]
          Length = 311

 Score =  165 bits (417), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 71/305 (23%), Positives = 128/305 (41%), Gaps = 50/305 (16%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAK--FINVLISKGDLAVG 58
           MK +R + + V+ + A++   +   +++    Q  +   +         VLI+  +L  G
Sbjct: 1   MKASRYVVMGVAAIAAILLAFLVRGMIAGGGAQEAKATVDKTPAVATARVLIAARELKAG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAM---------------------------- 90
             ++   L W  +P  ++   +I D   P                               
Sbjct: 61  TRISEADLTWQEWPVASLNAAYIVDGGMPAGAPGMEGAAKPAADKPKSDVEEKVGDVTQA 120

Query: 91  -----------QELDGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISI 138
                      +   G + R  IL  +PI   K+V    GG ++ +L  G RA  + +S+
Sbjct: 121 VADKIAPSPTKEAYVGGVAREDILANEPIIDAKIVRSDEGGFMAVMLQPGMRALAVPVSV 180

Query: 139 SSAVGGMIKPNDHVDVVMVRSLSERKPTVTV-----VLSNIRVIAIDHN--IDSDERVLV 191
            +  GG I P D VD+++   L       T+     VL NIRV+AID +   + D++ ++
Sbjct: 181 DNTAGGFILPGDRVDILVTHQLPSATGRGTIDSVQPVLRNIRVLAIDQSVAAEQDKQTVI 240

Query: 192 GSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLN-PSSSEDSDVWDVQEEGKEIQIIK 250
           G+TATLE++P   + +  A++   LSL+LRS AD   PS +  +       E   +++ +
Sbjct: 241 GATATLEVSPGDGQVVTLAKASGTLSLMLRSYADAQGPSGAVTTSPTGGASEDLPVRVYR 300

Query: 251 AGVIV 255
            G   
Sbjct: 301 NGQAT 305


>gi|297618080|ref|YP_003703239.1| Flp pilus assembly protein CpaB [Syntrophothermus lipocalidus DSM
           12680]
 gi|297145917|gb|ADI02674.1| Flp pilus assembly protein CpaB [Syntrophothermus lipocalidus DSM
           12680]
          Length = 242

 Score =  164 bits (416), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 61/251 (24%), Positives = 116/251 (46%), Gaps = 25/251 (9%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK ++   I ++ +F L A ++A R ++    + E      P   + V+++  D+    V
Sbjct: 1   MKGSKKYWI-LAILFGLAATVLAYRYIAGVKARYE------PKNLVQVVVAATDIPKNSV 53

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +T   ++    P +      + D      + E+ G +    I+ G+ I   K++      
Sbjct: 54  ITREKVKLELVPAQFAHPAAVRD------LDEVVGRVAASYIVAGEEILSAKIISDAEKT 107

Query: 121 --LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTV---VLSNIR 175
             L+  +P GKRA ++ ++  S V G+++P D VDV+    L+  +  V V   +L ++ 
Sbjct: 108 NKLAYAVPMGKRAVSVPVNAVSGVSGLVRPGDRVDVIATVELASGQENVAVTSFILQDVE 167

Query: 176 VIAIDHNIDSDERV-------LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNP 228
           V+A+D N+D  + V          +T TL +TP +A+ LV A     + L LR+ AD + 
Sbjct: 168 VLAVDQNLDETKPVPAAKEEAAPATTVTLAVTPEEARPLVLASEQGSIRLALRAPADHDR 227

Query: 229 SSSEDSDVWDV 239
                  + D+
Sbjct: 228 VMLPPVRLVDI 238


>gi|86159250|ref|YP_466035.1| Flp pilus assembly CpaB [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85775761|gb|ABC82598.1| Flp pilus assembly CpaB [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 307

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 54/216 (25%), Positives = 96/216 (44%), Gaps = 16/216 (7%)

Query: 34  TEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQEL 93
            E            V+++  DL     +  ++L  V +P  NV +G   D        +L
Sbjct: 48  VETRTAAARVSTTPVVVATIDLPEATTLRADVLTVVQWPSANVPEGAASDPA------KL 101

Query: 94  DGVLVRVPILKGDPIRLEKLVDRGNG-GLSSLLPKGKRAATMDISISSAVGGMIKPNDHV 152
              +VR  ++KG+P+   +L     G GL+++LP G RAA + ++    V G I P D V
Sbjct: 102 VDRVVRARVIKGEPVIESRLAAADAGHGLAAILPPGMRAAAVRVNDVVGVSGFIHPGDSV 161

Query: 153 DVVMVRSLSERKPT-----VTVVLSNIRVIAIDHNIDSD----ERVLVGSTATLELTPMQ 203
           DV++V        +       ++L N+ V+A+   ++ +    E+ L  + ATL +   Q
Sbjct: 162 DVIVVMRPESNGNSNPAYFSKIILQNVPVLAVGKELERNERSLEKSLPATVATLMVDSEQ 221

Query: 204 AKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDV 239
           ++ L  AQ+   + L LRS  D     +   +   +
Sbjct: 222 SEKLALAQTKGNILLTLRSGIDRELVDTTGVNPAGL 257


>gi|325108089|ref|YP_004269157.1| Flp pilus assembly protein CpaB [Planctomyces brasiliensis DSM
           5305]
 gi|324968357|gb|ADY59135.1| Flp pilus assembly protein CpaB [Planctomyces brasiliensis DSM
           5305]
          Length = 418

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 59/248 (23%), Positives = 113/248 (45%), Gaps = 20/248 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK+  ++ +     FA+  G+IAM  V     Q      ++  + + VL++  D++ G++
Sbjct: 1   MKMKTILVLA----FAVGCGLIAMVGVQQMIAQQSN---KDQNQTVEVLVAAQDISPGVL 53

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +      +   P E V    +       + +E     + VP++ GD IR  KL  RG   
Sbjct: 54  LNQANCAFKKLPVEGVPSDAVR------SKEEYAERGLLVPVMAGDIIRKSKLGARGEIA 107

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT----VTVVLSNIRV 176
            S+ +P G R  ++ ++ +    G+++P D VD+ +   +   +        ++L  I V
Sbjct: 108 ASASIPAGMRTVSIQVNDTKTHSGLLQPGDRVDLQVTYEVRTSEGFRVTKTAILLEYIEV 167

Query: 177 IAID--HNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
            A D   N+++ E + +     TL +TP QA  +  A +  +L  ++RS AD +  + E 
Sbjct: 168 FASDAFRNLEAGESKEIKAKNITLLVTPDQANFIQLANTKGELVPIMRSRADSHLITPEG 227

Query: 234 SDVWDVQE 241
            D   + E
Sbjct: 228 VDAQVIAE 235


>gi|83950065|ref|ZP_00958798.1| CpaB family protein [Roseovarius nubinhibens ISM]
 gi|83837964|gb|EAP77260.1| CpaB family protein [Roseovarius nubinhibens ISM]
          Length = 281

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 51/240 (21%), Positives = 100/240 (41%), Gaps = 13/240 (5%)

Query: 9   IVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPA--KFINVLISKGDLAVGMVVTPNIL 66
           ++V    A  A  +A  ++  +  +       N    K ++V ++K  LA G  +T   +
Sbjct: 1   MIVGIGLAGFAVYMAKSVIQGYRTELNSARAANQPAIKTVDVYVAKRALAYGDRLTKEDV 60

Query: 67  EWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLL 125
             V +P   + +G    V       + +   V   + K + +   K+   G + G+ + L
Sbjct: 61  VQVKYPARALPEGVFQTVEDLFPEGQKEFRTVLRAMEKYEALLGVKVTAPGEDAGILTKL 120

Query: 126 PKGKRAATMDISISSAVGGMIKPNDHVDVVMVR---------SLSERKPTVTVVLSNIRV 176
            +GKRA  + +  +S V G ++P D VDV                       ++L+ + +
Sbjct: 121 ERGKRAFAIKVDTTSGVAGFLRPGDRVDVYWTGNTGRGGLRTEGDSTGDVTKLILTGVNL 180

Query: 177 IAIDHNI-DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
           IA+D +  D     ++  T T+ ++P +  AL  AQ+  KL+L L    +   +   + D
Sbjct: 181 IAVDQSSNDQTTGAILARTVTVAVSPQEVAALAQAQATGKLTLSLLGTKEDTIAEVIEVD 240


>gi|116623254|ref|YP_825410.1| SAF domain-containing protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226416|gb|ABJ85125.1| SAF domain [Candidatus Solibacter usitatus Ellin6076]
          Length = 300

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 59/249 (23%), Positives = 105/249 (42%), Gaps = 17/249 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M    +M + VS V+AL+      RL                A    V+++   L  G  
Sbjct: 3   MDRRFVMVMGVSLVWALMVSAAFFRLAGGGG-------RTRAASRKQVVVATRPLPAGST 55

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG- 119
           +  + ++  + PE+    G    V      +++    V   I   +P+   +L  +G+G 
Sbjct: 56  LDRDAVKLRSVPEDVFPAGAFSRV------EDVLERPVISAIQPEEPVVEARLAVKGSGA 109

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT-VTVVLSNIRVIA 178
           GL  ++P G RA ++ ++    V G + P   VDV++      R  T    VL NI V++
Sbjct: 110 GLGPMIPTGMRAISVRVNDVVGVAGFVLPGMRVDVLVTGKPLNRADTETQTVLQNITVLS 169

Query: 179 IDHNIDSDER--VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDV 236
               I +D R   ++    TL +TP +A+AL  A +   + LVLR+  D   + +    +
Sbjct: 170 AGQTITTDGRSQPIMAPVVTLLVTPGEAEALTLANTEGHIQLVLRNSTDRISAPTRGRRL 229

Query: 237 WDVQEEGKE 245
            ++     E
Sbjct: 230 HELYGAAAE 238


>gi|27378603|ref|NP_770132.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
 gi|27351751|dbj|BAC48757.1| blr3492 [Bradyrhizobium japonicum USDA 110]
          Length = 329

 Score =  163 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 70/263 (26%), Positives = 114/263 (43%), Gaps = 16/263 (6%)

Query: 1   MKLTRLMGIVVSGVFALVA-GIIAMRLVSPHHVQTEEVIT-ENPAKFINVLISKGDLAVG 58
           M     + I++  + A  A G+IA  +  P  V          P   +   ++   L+ G
Sbjct: 13  MSSALRLSIIIVLLLATAAFGLIAYNMNLPKQVPVAVTEQGPAPPSTVGYFVAARPLSRG 72

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRG 117
            +         +   E +  G I  +  P+A   L G LVR  +  G PI L+ ++  R 
Sbjct: 73  TLARDEDFAVRSALPERLPAGAI--LETPDAKAGLTGSLVRKFVEAGSPITLQDVLRPRD 130

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT----VTVVLSN 173
            G L+S+L    RA ++ +   S V G+I+P DHVDV++ +   +  P       VVL N
Sbjct: 131 RGFLASVLAPDSRAISIKVDEESGVSGLIRPGDHVDVLLTQVFEKADPARRALSEVVLGN 190

Query: 174 IRVIAIDHNIDSDERVL------VGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADL- 226
           +RVIAID  I    R +         T +LEL P Q K +  A+ +  +SL +R+  +  
Sbjct: 191 VRVIAIDQEIVQGGRTVSSLAGKQAQTVSLELAPDQVKKITVAKQIGTISLAVRAAVEQW 250

Query: 227 NPSSSEDSDVWDVQEEGKEIQII 249
           + + +      DV  E      +
Sbjct: 251 DTADTGAMSSCDVSPEIARQNAV 273


>gi|323700358|ref|ZP_08112270.1| Flp pilus assembly protein CpaB [Desulfovibrio sp. ND132]
 gi|323460290|gb|EGB16155.1| Flp pilus assembly protein CpaB [Desulfovibrio desulfuricans ND132]
          Length = 273

 Score =  163 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 114/247 (46%), Gaps = 15/247 (6%)

Query: 4   TRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTP 63
             L+ I +S   A++AG+I  +  +         + EN    +    +K DL  G+ +T 
Sbjct: 6   RALVQITLSLFLAVIAGVIIFKWTNGVKQAAPTAVVENTVPVVV---AKTDLGRGVKLTE 62

Query: 64  NILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG--NGGL 121
           ++LE   F +++   G   +V      ++++G ++   +  GD +   KL D+    GG+
Sbjct: 63  DMLEIRKFTQDSRPSGAFAEV------KQVEGRVLNQTVGMGDALTPLKLADKSIMGGGV 116

Query: 122 SSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS-ERKPTVTVVLSNIRVIAID 180
           S+L+  GKRA  +  +    + G ++P D VDV++  ++    KP   +VL  I+VIA  
Sbjct: 117 SALITPGKRAMAVKGNEVMGLSGFVRPGDRVDVIVSLTVGRNEKPVTKLVLEQIKVIATG 176

Query: 181 HNI---DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVW 237
             +   + + +V      TLELTP +++ L  A +   L   LR+  D     +  + V 
Sbjct: 177 TQLTPPNEEGKVASVGVYTLELTPAESERLALASTQGTLHFALRNEQDNADVRTIGTTVP 236

Query: 238 DVQEEGK 244
                 +
Sbjct: 237 QTLAALR 243


>gi|51245388|ref|YP_065272.1| hypothetical protein DP1536 [Desulfotalea psychrophila LSv54]
 gi|50876425|emb|CAG36265.1| hypothetical protein DP1536 [Desulfotalea psychrophila LSv54]
          Length = 285

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 53/263 (20%), Positives = 115/263 (43%), Gaps = 19/263 (7%)

Query: 5   RLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAK-FINVLISKGDLAVGMVVTP 63
           RL  +V++ V A     +  + +S  +V    V+ + P +   ++ ++  D++ G  +  
Sbjct: 6   RLTFLVIAVVIAFSVSFVVYKKMSTPNV----VMEQKPGQATTDIAVAVKDMSRGSKIGS 61

Query: 64  NILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG--NGGL 121
             ++   + +E +  G   D      ++++ G +V  P+   +PI    L  +    GGL
Sbjct: 62  EDVQMATYLQETLPSGHFTD------LEQVVGRIVLSPLTTTEPILNSDLAPQDLTKGGL 115

Query: 122 SSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV--RSLSERKPTVTVVLSNIRVIAI 179
           ++++   KRA  + +     V G + P   VDV++   +    R      VL NI V+++
Sbjct: 116 AAVITPTKRAMAIKVDNVIGVAGFLHPGHLVDVLVSIEKPGDTRSQITKTVLQNILVLSV 175

Query: 180 DHNIDS--DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSED-SDV 236
                   D++V   +  TLE+   + + L  A +  ++ L LR  +D+ P  +   +  
Sbjct: 176 GTLAQESADKKVHKVTVVTLEVDLEEGEKLALAVNEGRIQLALRGYSDVEPVLTRGITKT 235

Query: 237 WDVQEEGKEI-QIIKAGVIVNKD 258
             ++    ++ + +K G    K 
Sbjct: 236 SLLKSYSPDVFKTVKGGKTAVKK 258


>gi|328953762|ref|YP_004371096.1| Flp pilus assembly protein CpaB [Desulfobacca acetoxidans DSM
           11109]
 gi|328454086|gb|AEB09915.1| Flp pilus assembly protein CpaB [Desulfobacca acetoxidans DSM
           11109]
          Length = 272

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 58/232 (25%), Positives = 105/232 (45%), Gaps = 12/232 (5%)

Query: 20  GIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDG 79
           G  A  + S            +    +  + +  ++A G V+ P +L+ V  P+E+V   
Sbjct: 17  GGFAAYIASGWLKARARPAARDSVAMMPAVAAARNIAPGSVLIPELLKVVQLPKEHVAAD 76

Query: 80  FIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISI 138
              D      ++ L+G + R  I+ G+ I+  +L  +G  GG++ ++   KRA T+ +  
Sbjct: 77  AATD------LKALEGRVTRQLIVAGEVIQEHELAPKGAPGGMAGIIGNDKRAVTIKVDE 130

Query: 139 SSAVGGMIKPNDHVDVVMVRSLSE--RKPTVTVVLSNIRVIAIDHNIDS---DERVLVGS 193
           +S V G I P + VDV++    +E    P   +VL N+ V+    +I+     ER  V  
Sbjct: 131 ASGVAGFIVPGNRVDVLLSLDRNEFKNDPVTQIVLQNLPVLGTGQDIEQQKAGERPKVVP 190

Query: 194 TATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKE 245
           T TLE+TP + + L  A     ++L LR   +     +  + V  +    K+
Sbjct: 191 TVTLEVTPEEGERLALAAKEGTITLALRGWTEKAAIPTAGARVSALLTPEKK 242


>gi|197123318|ref|YP_002135269.1| Flp pilus assembly protein CpaB [Anaeromyxobacter sp. K]
 gi|196173167|gb|ACG74140.1| Flp pilus assembly protein CpaB [Anaeromyxobacter sp. K]
          Length = 307

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 54/216 (25%), Positives = 96/216 (44%), Gaps = 16/216 (7%)

Query: 34  TEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQEL 93
            E            V+++  DL     +  ++L  V +P  NV +G   D        +L
Sbjct: 48  VETRTAAARVSTTPVVVATIDLPEATTLRADVLSVVQWPSANVPEGAASDPA------KL 101

Query: 94  DGVLVRVPILKGDPIRLEKLVDRGNG-GLSSLLPKGKRAATMDISISSAVGGMIKPNDHV 152
              +VR  ++KG+P+   +L     G GL+++LP G RAA + ++    V G I P D V
Sbjct: 102 VDRVVRARVIKGEPVVESRLAAADAGHGLAAILPPGMRAAAVPVNDVVGVAGFIHPGDSV 161

Query: 153 DVVMVRSLSERKPT-----VTVVLSNIRVIAIDHNIDSD----ERVLVGSTATLELTPMQ 203
           DV++V        +       ++L N++V+A+   +  +    E+ L  + ATL +   Q
Sbjct: 162 DVIVVMRPETNGNSNPAFFSKIILQNVQVLAVGKELGRNERSLEKSLPATVATLMVDSEQ 221

Query: 204 AKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDV 239
           ++ L  AQ+   + L LRS  D     +   +   +
Sbjct: 222 SEKLALAQTKGSILLTLRSGIDRELVDTTGVNPAGL 257


>gi|218513094|ref|ZP_03509934.1| pilus assembly protein [Rhizobium etli 8C-3]
          Length = 202

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 87/202 (43%), Positives = 128/202 (63%), Gaps = 4/202 (1%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  RL+ + V+ V A +AG++AMR+     V T+          +NVL+S G+LAVG  
Sbjct: 1   MKPARLIILAVAVVAAGLAGLLAMRMAGSGGVVTQVQSVIEKEPTVNVLVSSGNLAVGQR 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +    + W+A+P+  V  G I ++ +P+A+++L G +VR+PI +G+PIR EK+ D  +  
Sbjct: 61  LEEGSVHWMAWPQGGVVPGLITEIEKPDAIKDLQGAVVRLPIFEGEPIRPEKVADSSSRI 120

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE-RKPTVTVVLSNIRVIAI 179
           LSSLLP GKRA   +IS+++  GG I PND VDV+MVR  +E  K     VLSN+RV+AI
Sbjct: 121 LSSLLPAGKRAVATEISVATGAGGFILPNDRVDVIMVRKGTEANKLITETVLSNVRVLAI 180

Query: 180 DHNIDSDE---RVLVGSTATLE 198
           D  I   +   + +VG+TATLE
Sbjct: 181 DQQIQEKDDGSKAVVGTTATLE 202


>gi|329900777|ref|ZP_08272581.1| SAF domain protein [Oxalobacteraceae bacterium IMCC9480]
 gi|327549366|gb|EGF33934.1| SAF domain protein [Oxalobacteraceae bacterium IMCC9480]
          Length = 323

 Score =  162 bits (410), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 51/236 (21%), Positives = 104/236 (44%), Gaps = 11/236 (4%)

Query: 7   MGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNIL 66
           + + V+    + A ++A   +S    Q   +        I V+++KGDL  G V++ + +
Sbjct: 16  LVLGVALTIGVGAALLARSFLS---DQIASIEARGKGPTIPVVVAKGDLNKGTVLSADNV 72

Query: 67  EWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLP 126
                P E      +     P+    +DG  +   +  G+ +    +  +     S+ L 
Sbjct: 73  AVRQIPREFAHSASV----FPDQFARIDGQPIAYGLKSGESVMWGLMEGKKVPTFSARLE 128

Query: 127 KGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSD 186
            G RA T+ +   +++ G+++P D +D+++      +K     +L  ++V+A       D
Sbjct: 129 AGHRAMTVPVDEINSISGLLEPGDSIDLIVTVDHGGKK-ITFPLLQAVQVMATGQRAVDD 187

Query: 187 ERV---LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDV 239
            R       ST TL  TP QA+ ++ A+   K++ +LR+ AD  P +    D+  +
Sbjct: 188 PRTGERRQFSTVTLNTTPEQAQNVIVAREAGKITALLRNPADQAPMAGTRGDLAAL 243


>gi|294139869|ref|YP_003555847.1| Flp pilus assembly protein CpaB [Shewanella violacea DSS12]
 gi|293326338|dbj|BAJ01069.1| Flp pilus assembly protein CpaB, putative [Shewanella violacea
           DSS12]
          Length = 288

 Score =  161 bits (409), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 64/269 (23%), Positives = 118/269 (43%), Gaps = 27/269 (10%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M + RLM   V   F  +AG+I + L      +   + TEN      +L++K  +  G  
Sbjct: 1   MTVKRLMYFSV---FISLAGLIGLYLSISAPQKQINIKTENVRH--EILVAKQLIKSGQR 55

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
            + ++ EW A  E+ + +           + + +  ++      G  + L   +    GG
Sbjct: 56  FSASLFEWQALNEDQLTNLVDYIDRDKFDILKFNDSVLVSSFTAGHIMSLSDFLKPEEGG 115

Query: 121 -LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM---------VRSLSERKPTVTVV 170
            LS  L  G RA ++ +   +A  G++ P D VDV++          R    +   V  +
Sbjct: 116 FLSVSLRPGYRAVSVPVDQVTANSGLVGPGDFVDVLLLASQEQELRTRGNDTQSLYVKTI 175

Query: 171 LSNIRVIAIDHNIDSDERVLV----------GSTATLELTPMQAKALVAAQSVAKLSLVL 220
             N+RV+A +H +  ++ +             S  TLE+ P QA  ++ A  +  L+LVL
Sbjct: 176 ARNVRVLAFNHAVKVEQYIAAQKEYKGFIPDDSAVTLEVLPKQANRIILANQLGILTLVL 235

Query: 221 RSIADL-NPSSSEDS-DVWDVQEEGKEIQ 247
           RS  D  + ++S+D  ++ D+  + K +Q
Sbjct: 236 RSNNDSVDEANSQDQINIADIFPDIKRVQ 264


>gi|261251599|ref|ZP_05944173.1| flp pilus assembly protein RcpC/CpaB [Vibrio orientalis CIP 102891]
 gi|260938472|gb|EEX94460.1| flp pilus assembly protein RcpC/CpaB [Vibrio orientalis CIP 102891]
          Length = 279

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 63/271 (23%), Positives = 115/271 (42%), Gaps = 27/271 (9%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   RLM + +     L A  IA+ L++P   Q+E+        F  VL++K  + VG  
Sbjct: 1   MTAKRLMLLSLI----LSAVGIAILLLNPSKPQSEQRQAAAEV-FKRVLVAKQGVVVGQP 55

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQ-ELDGVLVRVPILKGDPIRLEKLVDRGNG 119
            T N+ +W +  E+ +   ++D + +    + +L   +    I  G  +  +      +G
Sbjct: 56  YTLNMFQWKSVSEQELN-NYLDFISEEEFSRLDLKPGIAHTAIQSGQVMSSDDFETPASG 114

Query: 120 -GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER---------KPTVTV 169
             ++  +  G RA ++ +   +A  G ++P D VD++++ S  E             VT 
Sbjct: 115 ISMAFKVQSGHRAISVPVDAVTANSGFVQPGDKVDILLLGSQVEELKKYDNQVAGLYVTT 174

Query: 170 VLSNIRVIAIDHNID----SDERVLVG------STATLELTPMQAKALVAAQSVAKLSLV 219
           +  ++RV+A +   D       R   G      S+ +LE+TP QA  +V A  + KL+L 
Sbjct: 175 IAIDVRVLAFNQYADPQDFQKNRSAYGADIPDNSSVSLEVTPEQATQIVLANQIGKLTLS 234

Query: 220 LRSIADLNPSSSEDSDVWDVQEEGKEIQIIK 250
           LR   ++     E   V          Q+  
Sbjct: 235 LRGAGEMISDVDEKYTVTSTLINPDSKQVAP 265


>gi|302037440|ref|YP_003797762.1| pilus assembly protein CpaB [Candidatus Nitrospira defluvii]
 gi|300605504|emb|CBK41837.1| Pilus assembly protein CpaB (modular protein) [Candidatus
           Nitrospira defluvii]
          Length = 403

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 65/256 (25%), Positives = 118/256 (46%), Gaps = 24/256 (9%)

Query: 1   MKLTR--LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVG 58
           M   R  L+ + + G+  L   + A + +     QT  +  E  ++ I + ++  DLA G
Sbjct: 1   MTPQRRALIVVALGGLIGLATSLWAYQWLQDVTEQTR-LDMEAKSRTIPIAVAAADLAWG 59

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG- 117
            V+  + +  V FP + V +G         + + L G +V + + + +PI   KL     
Sbjct: 60  AVLADDAVRMVPFPADTVPEGHF------ASAETLKGRVVIMDVKQHEPILESKLAPATV 113

Query: 118 -NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV--RSLSERKPTVTVVLSNI 174
            +GG++++    KRA  + +    AVGG IKP D VDV+    R      P   VVL N+
Sbjct: 114 TSGGVAAVTHPEKRAVAVKVDDVVAVGGFIKPGDRVDVLTTVRRPGKTDDPVTKVVLENV 173

Query: 175 RVIAIDHNID-----------SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSI 223
           RV+A+  + +            + ++ V S  TLE+ P +A+ L  A +  K+ L LR+ 
Sbjct: 174 RVLAMGQDTERAAQTDKAAKNQETKLSVPSVMTLEVAPDEAEKLALASTEGKVQLALRNP 233

Query: 224 ADLNPSSSEDSDVWDV 239
             +   ++  + +  +
Sbjct: 234 QSVTAVATTGATISSL 249


>gi|85705149|ref|ZP_01036249.1| CpaB family protein [Roseovarius sp. 217]
 gi|85670471|gb|EAQ25332.1| CpaB family protein [Roseovarius sp. 217]
          Length = 289

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 51/230 (22%), Positives = 98/230 (42%), Gaps = 13/230 (5%)

Query: 19  AGIIAMRLVSPHHVQT--EEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENV 76
           A  +A   +  +  Q   E        + +++ ++   +  G  +T   +  +AFP++++
Sbjct: 19  AVYMAKTYIDGYQQQLALERQQRAPNIETVDIYVANQLIKYGEPLTTEAVRLIAFPKDSL 78

Query: 77  FDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMD 135
            +G      +               + K +PI   K+   G   G++S L +G RA  + 
Sbjct: 79  PEGAFSSTEELFPSGASVVRKALRRMEKNEPILAVKVTKPGEEAGITSQLERGMRAFAIK 138

Query: 136 ISISSAVGGMIKPNDHVDVVMVRSLSER---------KPTVTVVLSNIRVIAIDHNIDSD 186
           + ++S V G ++P D VD+    S+                 ++ + +++IA+D   D D
Sbjct: 139 VDVTSGVSGFLRPGDTVDIYWTGSIGAGNLRTEEDSTGEVTKLIDTGVKLIAVDQVADMD 198

Query: 187 -ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
               +V  T  + +TP Q  AL  AQS  +LSL L   +D   + S + D
Sbjct: 199 MTEAVVARTVAVAVTPNQVAALAQAQSTGRLSLSLVGASDDTVAQSIEVD 248


>gi|84687278|ref|ZP_01015158.1| CpaB family protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84664711|gb|EAQ11195.1| CpaB family protein [Rhodobacterales bacterium HTCC2654]
          Length = 274

 Score =  160 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 53/231 (22%), Positives = 96/231 (41%), Gaps = 8/231 (3%)

Query: 13  GVFALVAGIIAMRLVSPHHVQ--TEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVA 70
              A  A  +A   +  +      E        +   + + K  +A G  +T   +    
Sbjct: 3   VGLAGFAVYMARDYIGNYQAALEQERAARAQMVQTAEIYVVKESVAYGDRITDENIRLTR 62

Query: 71  FPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGK 129
           FP + + +G      +     E     V   + K + +   K+ + G + G+++ L  G 
Sbjct: 63  FPVDAIPEGAFKTEEELFPQGEKRYRTVLRAMEKDEALLAVKVTEAGADAGVAARLASGM 122

Query: 130 RAATMDISISSAVGGMIKPNDHVDVVMVRSLSER----KPTVTVVLSNIRVIAIDHNIDS 185
           RA  + + ++S V G ++P D VD+      S      +    ++ +NIR+IAID   D+
Sbjct: 123 RAFAIRVDVASGVSGFLRPGDKVDIYWTGRGSSDSVTSQEVTKLIQTNIRIIAIDQMADT 182

Query: 186 DER-VLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
           D     V  T T+E TP Q  AL  AQ+  +++L L    D   + + + D
Sbjct: 183 DRTAPTVARTVTIEATPEQVAALAQAQATGRMALSLVGAQDDTVAEAVEID 233


>gi|323493504|ref|ZP_08098626.1| Flp pilus assembly protein CpaB [Vibrio brasiliensis LMG 20546]
 gi|323312327|gb|EGA65469.1| Flp pilus assembly protein CpaB [Vibrio brasiliensis LMG 20546]
          Length = 280

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 62/271 (22%), Positives = 117/271 (43%), Gaps = 27/271 (9%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   RLM + +     L A  I++ L+S    + ++        F  VL++K  + +G  
Sbjct: 1   MTAKRLMLLSLV----LSAVGISILLLSQSEQKNDQQQAAAET-FKRVLVAKQKVDIGQP 55

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPN-AMQELDGVLVRVPILKGDPIRLEKL-VDRGN 118
            T N+ EW    ++ + D ++D + +   ++Q+    +    IL G  +        +G 
Sbjct: 56  YTLNMFEWKQVSQQEL-DNYLDYISREAFSVQQFTPGIAHSEILAGQVMSAGDFSTPKGG 114

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER---------KPTVTV 169
             L+  +  G RA ++ +   +A  G ++P D VD++++ S  E             VT 
Sbjct: 115 VSLAFKVRNGYRAISVPVDSVTANSGFVQPGDKVDILLLGSEVEELKKYDNKVSGLYVTT 174

Query: 170 VLSNIRVIAIDHNIDSD----ERVLVG------STATLELTPMQAKALVAAQSVAKLSLV 219
           +  ++RV+A +   D+D    +R   G      S+ +LE+ P QA  +V A  + KL+L 
Sbjct: 175 IAKDVRVLAFNQYSDADNFQKKRSAYGADLPDNSSVSLEVNPEQATQIVLANQIGKLTLS 234

Query: 220 LRSIADLNPSSSEDSDVWDVQEEGKEIQIIK 250
           LR   + +        V   Q   +  Q+  
Sbjct: 235 LRGAGEDDSDDQSIYTVKSTQINPESKQVAP 265


>gi|149915643|ref|ZP_01904169.1| CpaB family protein [Roseobacter sp. AzwK-3b]
 gi|149810535|gb|EDM70378.1| CpaB family protein [Roseobacter sp. AzwK-3b]
          Length = 290

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 56/249 (22%), Positives = 107/249 (42%), Gaps = 14/249 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQT--EEVITENPAKFINVLISKGDLAVG 58
           M+L   + +V+    A  A  +A   +  +  Q   E        + + VL++K  L  G
Sbjct: 1   MRLVFGLVLVLGLGLAGFAVYMAKSYIQGYQNQLALERAQRAPQIETVEVLVAKTPLKYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG- 117
             + P+ +  V FP++ + +G    +       E +   VR  +   + I   K+   G 
Sbjct: 61  QKLKPDAVRLVKFPKDALPEGVFMTMDALFPKGEQEPRAVRRAMEVNEAIMAVKVTAPGE 120

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER----------KPTV 167
           + G+SS L +G RA  + + ++S V G ++P D VDV     +                 
Sbjct: 121 DAGISSQLAQGMRAFAIKVDVASGVSGFLRPGDRVDVYWTGQVRGGSDVRTEGNSMGDVT 180

Query: 168 TVVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADL 226
            ++ + +++IA+D   D +  + ++  T T+   P Q  AL  AQ+  +LSL L    + 
Sbjct: 181 KLIETGVQLIAVDQISDENTTQAIIARTVTVAARPQQVAALAQAQATGRLSLSLVGTDEE 240

Query: 227 NPSSSEDSD 235
           + +   + D
Sbjct: 241 SVAEVIEVD 249


>gi|115358170|ref|YP_775308.1| Flp pilus assembly CpaB [Burkholderia ambifaria AMMD]
 gi|115283458|gb|ABI88974.1| Flp pilus assembly CpaB [Burkholderia ambifaria AMMD]
          Length = 342

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 59/236 (25%), Positives = 97/236 (41%), Gaps = 17/236 (7%)

Query: 13  GVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFP 72
            V  + AGI A  L    +V             + V ++  DL  G+++  N L W    
Sbjct: 8   AVLIIAAGIGAFIL-RQLYVSASTPPPPGNTADVRVRVAAADLPEGLLLRDNDLAWKPMA 66

Query: 73  EENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-GLSSLLPKGKRA 131
              V  G   +        +L G L+R  +  G PIR + ++  G    L++ L  G RA
Sbjct: 67  RAQVPAGAFVESQPG---ADLKGALLRSRVEAGAPIRADNVISAGAPDFLAAALQPGMRA 123

Query: 132 ATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT-----VTVVLSNIRVIAIDHN---- 182
            ++ +   S   G+I+P D VDVV+ + +     T        V+   RV+A+       
Sbjct: 124 ISVPVDDVSGNAGLIQPGDFVDVVLTQQIGGSATTPGTFEAETVVRRARVLAVGSEFQRA 183

Query: 183 ---IDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
                + +  +   T TLE+ P  A+ ++ A  +  LSL LRS A  +   +   D
Sbjct: 184 KGPASAPDAPVRARTVTLEVAPRTAQVVLVATRLGSLSLALRSFATSDRRQAAGGD 239


>gi|326797326|ref|YP_004315146.1| Flp pilus assembly protein CpaB [Marinomonas mediterranea MMB-1]
 gi|326548090|gb|ADZ93310.1| Flp pilus assembly protein CpaB [Marinomonas mediterranea MMB-1]
          Length = 315

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 64/277 (23%), Positives = 113/277 (40%), Gaps = 37/277 (13%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLV-SPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK + +  +  + +FAL   ++   L+ S    +T   +      +  VL++   L  G 
Sbjct: 1   MKASSVFFVSGALIFALGGALLGSALLTSEPPPKTVTKVVPKKPNYRAVLVASNTLRPGD 60

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
            +    +EW A  ++   D F   +   +   +L G  V  PI  G  +  + LV  G  
Sbjct: 61  FMNATSIEWRAADKQYPEDAFF--LKGLDEKSQLYGATVTQPIPAGTELESDLLVSPGEP 118

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP------------- 165
           G ++S+L  G RA  +   + ++  G+I   D VDV++       +              
Sbjct: 119 GFIASVLKPGMRAVAIPADVVTSNAGLISGGDRVDVILSLKRDYEQGADNNPLATIKLPK 178

Query: 166 -TVTVVLSNIRVIAID----------HNIDSDERVLVGS-------TATLELTPMQAKAL 207
                +L N+RV++++            ++S +     S       T TLE+ P   + L
Sbjct: 179 LASQTLLRNVRVLSLNGTLDAFREKVQKVESKKEKKTDSNKRKSYETVTLEVLPKDVERL 238

Query: 208 VAAQSVAKLSLVLRSI--ADLNPSSSEDSDVWDVQEE 242
             A+ V  L L LRS+   DL  S+S + D  + Q E
Sbjct: 239 TVAREVGILQLALRSVQGQDLALSTSPEKDSKESQSE 275


>gi|144898050|emb|CAM74914.1| Flp pilus assembly protein CpaB [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 288

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 64/275 (23%), Positives = 117/275 (42%), Gaps = 23/275 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+   ++ ++V+ + A +  ++A R           V  ++    + VL+   D+A G  
Sbjct: 1   MRPLAIVLVIVAVLAAGLTALLAKRWTDKQSTARPTVAADS----VEVLVLARDVATGSA 56

Query: 61  VTPNILEWVAFPEENVFDG-FIDDVHQPNAMQELDGVLVRVPILKGDPIRLEK-LVDRGN 118
           ++   L +  +P   V  G F+      +      G + R P+ +G+P          G+
Sbjct: 57  LSDADLRYENWPA--VNAGRFMTRKDGDDPKARAIGAVARRPLSEGEPFTPSATFTRDGS 114

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP------------- 165
           G L+ +L  G RA ++ IS +SAV G + P D VDVV+                      
Sbjct: 115 GILAGMLAPGMRAVSVAISNASAVSGFVVPGDRVDVVLAADFQRADSEAAGKGGGAIVRY 174

Query: 166 TVTVVLSNIRVIAIDHNID--SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSI 223
               VL++++V+A+D       D   + G TATLE++P QA+ LV A  + +LSL+LR +
Sbjct: 175 AAETVLADVKVLAVDQQFSKGKDGPTIQGKTATLEVSPDQAEILVTAGLMGQLSLILRGV 234

Query: 224 ADLNPSSSEDSDVWDVQEEGKEIQIIKAGVIVNKD 258
              +  +          +    ++ +  G      
Sbjct: 235 GPQDAGNQTKRPFTADTQASAAMRALAGGSAKPAA 269


>gi|225181998|ref|ZP_03735430.1| Flp pilus assembly protein CpaB [Dethiobacter alkaliphilus AHT 1]
 gi|225167283|gb|EEG76102.1| Flp pilus assembly protein CpaB [Dethiobacter alkaliphilus AHT 1]
          Length = 229

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 59/234 (25%), Positives = 109/234 (46%), Gaps = 18/234 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  +    ++S + ALVA       ++    Q+     ++ A    +L+++ ++     
Sbjct: 1   MKGKKF--FLLSLILALVAAGAIFHYLNEMERQS-----KSAANLTTILVAREEIPARTR 53

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRGNG 119
           ++ ++      P++ +    I +        ELDG   R  ++ G+ +   +LV ++   
Sbjct: 54  LSASMFTTAEVPQDAIHGDAIRETS------ELDGAYARERLVAGEQVLSARLVFEQSET 107

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT-VTVVLSNIRVIA 178
           GLS  +  G RA T+ ++  S V G I P D+VD ++    +E + T   VV S I+V+A
Sbjct: 108 GLSYKVSDGHRAVTVPVNNVSGVAGYILPGDYVDAIVTIESTEDEDTVTKVVESKIKVLA 167

Query: 179 IDH-NIDSDERVLVGSTATLELTPMQA-KALVAAQSVAKLSLVLRSIADLNPSS 230
                ++ D   L+  T TL+ TP  A  A++ A     L LVLR + + N  +
Sbjct: 168 SGQYTVEQDREQLIVETVTLD-TPADAVTAIIQASERGSLRLVLRPVEESNDRA 220


>gi|332284570|ref|YP_004416481.1| putative secreted protein [Pusillimonas sp. T7-7]
 gi|330428523|gb|AEC19857.1| putative secreted protein [Pusillimonas sp. T7-7]
          Length = 326

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 55/233 (23%), Positives = 100/233 (42%), Gaps = 13/233 (5%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
              L  ++++GV  L A   A + +     + + +  +     +  +++  DL  G  + 
Sbjct: 7   NRSLAMLLLAGVAGLGAAWAAKQHIDG---KVQLLEAQARTPMVERIVAAYDLPAGTRLG 63

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLS 122
           P  L    FP      G +     P    EL G ++R P+  GD +       + +   S
Sbjct: 64  PEHLALRHFPANVASSGSL----APGRFTELTGTMLRAPLRGGDAVLEVHTTGQDHAAFS 119

Query: 123 SLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID-- 180
           S L  G+RA +M +   ++V G+++P D +D+ +     +R+     +L  + V+A D  
Sbjct: 120 SHLSAGRRAISMPVDAINSVSGLLQPGDLIDLYVSFEY-QRRHITAPLLQGVLVLATDAN 178

Query: 181 -HNIDSDERVLVGS--TATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
              +        GS  T TL+ +P  A  LVAA+    ++ VLR   D+  S 
Sbjct: 179 TQFVQDAGHASRGSYATVTLDASPEDAVKLVAARQGGTITAVLRPPQDVASSQ 231


>gi|197106488|ref|YP_002131865.1| Flp pilus assembly protein CpaB [Phenylobacterium zucineum HLK1]
 gi|196479908|gb|ACG79436.1| Flp pilus assembly protein CpaB [Phenylobacterium zucineum HLK1]
          Length = 310

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 64/244 (26%), Positives = 113/244 (46%), Gaps = 7/244 (2%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M++  ++ +  S V  L A ++A + V P     +       A  + V+++  ++  G  
Sbjct: 1   MRVVTIVSLAASAVLGLGALVVA-KTVLPGAGAAKGAAVVQEAPGVPVVVAAREIKYGDK 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG- 119
           + P +L  V  P   V  G    V Q  +  +    +    +   +P+   K+   G+  
Sbjct: 60  LVPGMLTIVNAPAGLVPQGAFQTVDQVLSADKGGPPVALTRLAAREPVLPTKISGPGSRP 119

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP----TVTVVLSNIR 175
            +S+ + +G RA T+ +  SS VGG   P D VDVV++R L+   P       VV+ N R
Sbjct: 120 TVSAEVGEGMRAYTLKVDASSGVGGHALPGDRVDVVLLRDLTPSGPDRNFISYVVVQNAR 179

Query: 176 VIAIDHNID-SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           V+ +D N D + E+    STATLE++  +++ L  A ++  LSL LR   +   + +   
Sbjct: 180 VLGVDLNADPTSEKPATPSTATLEVSVEESQKLAIAATLGTLSLALRRSGEAEIADAGPL 239

Query: 235 DVWD 238
              D
Sbjct: 240 RTGD 243


>gi|149912018|ref|ZP_01900612.1| Flp pilus assembly protein CpaB [Moritella sp. PE36]
 gi|149804917|gb|EDM64951.1| Flp pilus assembly protein CpaB [Moritella sp. PE36]
          Length = 288

 Score =  158 bits (401), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 61/269 (22%), Positives = 110/269 (40%), Gaps = 27/269 (10%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   RL+ + V      + G+I +       V +     ++  K   VL+S  D+ +G  
Sbjct: 1   MNAKRLVYLSVCM---SLLGLIWLFFSLSAPVNSTP--KQDTVKTYEVLVSTQDVVIGRP 55

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
            + ++  W    E +V D          ++Q L   +     + G  +     +    GG
Sbjct: 56  YSASLFAWKTVDESSVRDRIDFIDKANFSIQALKNTVAAADFVTGQILSPSDFLKPEQGG 115

Query: 121 -LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM---------VRSLSERKPTVTVV 170
            LS +L    RA ++ +   +A  G+I P DHVDV++          R    +   V  +
Sbjct: 116 FLSVMLRPNYRAVSIPVDEVTANSGLIGPGDHVDVLLLASKSQELRSRGNETQSLYVKTI 175

Query: 171 LSNIRVIAID---HNIDSDERVL-------VGSTATLELTPMQAKALVAAQSVAKLSLVL 220
             N+RV+A +         E+           ST TLE++P+QA  +  A  +  LS+VL
Sbjct: 176 AQNVRVLAFNDALQLARYMEKQKHNKGVIPDNSTVTLEVSPLQANQITLANQLGTLSMVL 235

Query: 221 R--SIADLNPSSSEDSDVWDVQEEGKEIQ 247
           R  +  + + +     +V D+    K++Q
Sbjct: 236 RSKNSQETDSAVIPAVNVDDILPAIKQVQ 264


>gi|283779854|ref|YP_003370609.1| Flp pilus assembly protein CpaB [Pirellula staleyi DSM 6068]
 gi|283438307|gb|ADB16749.1| Flp pilus assembly protein CpaB [Pirellula staleyi DSM 6068]
          Length = 372

 Score =  158 bits (401), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 53/247 (21%), Positives = 108/247 (43%), Gaps = 20/247 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M++  L+ I ++    LVA I   +++                +   +L++  D+ +   
Sbjct: 1   MRMKSLILIFIALGCGLVASIGISQVMERGGSGAAPA-----MEMEQILVALADIDIDAK 55

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +    ++   +P+  V +G +       ++ E++    +    KG+PI L K+ D+ N  
Sbjct: 56  LNAENVQLEEWPKSKVPEGAVR------SLDEVEAKFAQQRFFKGEPILLAKISDQ-NVN 108

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE--RKPTVTVVLSNIRVIA 178
               +P+G R   + +   + +   I P D VDV++    SE  ++     +L N+RV A
Sbjct: 109 PMIRIPEGYRVMPVKVDDETVLKA-ISPGDRVDVMVFLRRSEEIKQTATYTILRNVRVFA 167

Query: 179 IDHNIDSD----ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           ++ N + D     + +   T +L + P Q++ L  A  + K+ L +R   D    + E  
Sbjct: 168 VNSNTERDLETKGQDVNARTVSLIIKPQQSRELAVASQIGKIILTMRRP-DETDEAGEGE 226

Query: 235 DVWDVQE 241
           DV  + E
Sbjct: 227 DVTPITE 233


>gi|319783875|ref|YP_004143351.1| Flp pilus assembly protein CpaB [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169763|gb|ADV13301.1| Flp pilus assembly protein CpaB [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 301

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 61/252 (24%), Positives = 112/252 (44%), Gaps = 25/252 (9%)

Query: 8   GIVVSGVFALVAGIIAMRLV-SPHHVQTEEVITENPAKFIN------VLISKGDLAVGMV 60
            I ++ VF  ++   A   V S     +EE  +  PA  +       ++++   L  GM 
Sbjct: 1   MIGIAAVFGAISIFAADFWVKSQAKADSEEKTSSIPAPVVPKVEFKTIVVANAPLRYGME 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR-GNG 119
           +    L  + + +E+V  G    +   NA+      +V  PI   +P+ L KL    G  
Sbjct: 61  LDRAQLSEIPWSQESVPQGAFTTI---NALLADGSRVVLSPIEVNEPVLLTKLSGPNGRA 117

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP-------------T 166
            LS+++  G RA T+     + VGG + P D VDVV+ R   E +              T
Sbjct: 118 TLSNMMTPGMRAVTIRTDEIAGVGGFVTPGDRVDVVLTRDAGEIQEVAKNAQGAAGSTIT 177

Query: 167 VTVVLSNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
             +V+++ +V+++    D  +    + ++ T+E+T   A+ +  A++V  LSL LRS ++
Sbjct: 178 SEIVVADAKVLSVGQGADERQTTPQISNSVTIEVTTDGAQKVALARTVGTLSLSLRSASE 237

Query: 226 LNPSSSEDSDVW 237
                S  + + 
Sbjct: 238 GADGKSGVTTIS 249


>gi|172062958|ref|YP_001810609.1| Flp pilus assembly protein CpaB [Burkholderia ambifaria MC40-6]
 gi|171995475|gb|ACB66393.1| Flp pilus assembly protein CpaB [Burkholderia ambifaria MC40-6]
          Length = 342

 Score =  158 bits (400), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 59/236 (25%), Positives = 98/236 (41%), Gaps = 17/236 (7%)

Query: 13  GVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFP 72
            V  + AGI A  L    +V             + V ++  DL  G+++  N L W +  
Sbjct: 8   AVLIIAAGIGAFIL-RQLYVSASTPPPPGNTADVRVRVAAADLPEGLLLRDNDLAWKSMA 66

Query: 73  EENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-GLSSLLPKGKRA 131
              V  G   +        +L G L+R  +  G PIR + ++  G    L++ L  G RA
Sbjct: 67  RAQVPAGAFVESQPG---ADLKGALLRNRVDAGAPIRADNVISAGAPDFLAAALQPGMRA 123

Query: 132 ATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT-----VTVVLSNIRVIAIDHN---- 182
            ++ +   S   G+I+P D VDVV+ + +     T        V+   RV+A+       
Sbjct: 124 ISVPVDDVSGNAGLIQPGDFVDVVLTQQIGGSATTPGTFEAETVVRRARVLAVGSEFQRA 183

Query: 183 ---IDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
                + +  +   T TLE+ P  A+ ++ A  +  LSL LRS A  +   +   D
Sbjct: 184 KGPASAPDAPVRARTVTLEVAPRTAQVVLVATRLGSLSLALRSFATSDRRQAAGGD 239


>gi|148261012|ref|YP_001235139.1| SAF domain-containing protein [Acidiphilium cryptum JF-5]
 gi|326404412|ref|YP_004284494.1| putative pilus assembly protein [Acidiphilium multivorum AIU301]
 gi|146402693|gb|ABQ31220.1| SAF domain protein [Acidiphilium cryptum JF-5]
 gi|325051274|dbj|BAJ81612.1| putative pilus assembly protein [Acidiphilium multivorum AIU301]
          Length = 275

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 61/249 (24%), Positives = 106/249 (42%), Gaps = 20/249 (8%)

Query: 6   LMGIVVSGVFALV-AGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPN 64
           L+ I +  + AL  AG   +  +  H             K + +L +   LA G ++ P 
Sbjct: 2   LLRIALFILLALGLAGFGTVAWLDMH----PSHPHAKAPKMVALLATGRPLAPGTLLQPA 57

Query: 65  ILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSS 123
                  P   V    + D   P       G +VR  +  GD +  + ++  G+ G L++
Sbjct: 58  DFVAENRPPSKVPADAVPDT--PANRAAYTGAMVRHRLSAGDLLATDIVIRPGDHGFLAA 115

Query: 124 LLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE------RKPTVTVVLSNIRVI 177
           +L  G RA ++ +   +   G+I P DHVD+++ + L+       ++     VLS++RVI
Sbjct: 116 VLQPGMRAVSVGVDAITGAAGLIWPGDHVDLLLTQHLTGANLLPTQRVAAETVLSDVRVI 175

Query: 178 AIDHNIDSDERVL------VGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSS 231
           AID  +                T TLE+TP QA+ +  A  +  LSL++R        + 
Sbjct: 176 AIDQRLVQGASGTHPAAKNTARTVTLEVTPEQAERVEVAAHLGPLSLIVRPSEAARGPTP 235

Query: 232 EDSDVWDVQ 240
           +   V+  Q
Sbjct: 236 KPPPVFSGQ 244


>gi|84685163|ref|ZP_01013062.1| pilus assembly protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84666895|gb|EAQ13366.1| pilus assembly protein [Rhodobacterales bacterium HTCC2654]
          Length = 275

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 58/254 (22%), Positives = 109/254 (42%), Gaps = 10/254 (3%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+   L+        A+    +A R++         V      + + ++ +  D+  G  
Sbjct: 1   MRKAPLILAASGIALAVGCAAVAQRVLGGSEQAAPTVAV---PETVVLIAAARDIRFGEP 57

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NG 119
           +  + L    +P + V  G  D        +          I +GD +    + + G + 
Sbjct: 58  IRRDDLVPQTWPADLVPTGAFDSATVLLGAEGTAPRRATQTIREGDVVLAANVSEFGASV 117

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAI 179
            + S L  G RA  + ++  +AVGG + P DHVD+V+ +   +   T  V+L + RV+A+
Sbjct: 118 TIGSTLSPGTRAVAIRVNADTAVGGFVSPGDHVDIVLTQGRGDTLRTG-VILQDTRVLAV 176

Query: 180 DHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS----D 235
           D + ++        T T+E+ P  ++ LV AQ   +LSL+LR+   +  +   D     D
Sbjct: 177 DQDTEA-RGARKARTITVEVAPRDSQRLVLAQEAGQLSLILRNDDAIGDTGEMDQITLRD 235

Query: 236 VWDVQEEGKEIQII 249
           VW   E   E +++
Sbjct: 236 VWGDPEPTPEPEVV 249


>gi|148976308|ref|ZP_01813032.1| Flp pilus assembly protein CpaB [Vibrionales bacterium SWAT-3]
 gi|145964402|gb|EDK29657.1| Flp pilus assembly protein CpaB [Vibrionales bacterium SWAT-3]
          Length = 290

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 55/229 (24%), Positives = 105/229 (45%), Gaps = 22/229 (9%)

Query: 20  GIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDG 79
             +++ L S  +  +E+V      + I VL+    + +G   TPN  +W A P   + + 
Sbjct: 16  VALSVLLFSQGNNASEKVSVPTTQQTIKVLVPSRTIDIGQNYTPNSFQWKAIPLGEL-EN 74

Query: 80  FIDDVHQPNAMQELD-GVLVRVPILKGDPIRLEKLVDRGNG-GLSSLLPKGKRAATMDIS 137
           +ID V   +  ++     + +  +++G  +    + +   G  LS  L  G RA ++ + 
Sbjct: 75  YIDYVTPESISEDHSMSGIAQTKLVEGSVLSHADITEPKGGYSLSFKLQPGYRAISVPVD 134

Query: 138 ISSAVGGMIKPNDHVDVVMVRSLSE---------RKPTVTVVLSNIRVIAID--HNIDSD 186
             +A  G I+P D VD++++ S            +   VT ++ + RV+A +     +S 
Sbjct: 135 QITANSGFIQPGDRVDILLLGSQDGELLRYGNSSQGLYVTTIVHDARVLAFNNTQAAESY 194

Query: 187 ERVLVG--------STATLELTPMQAKALVAAQSVAKLSLVLRSIADLN 227
           ++V           S+ +LE+TP QA  +V A+ + KL+L LR   D  
Sbjct: 195 QKVRDSYGAVIPDNSSVSLEVTPEQANQVVLAEQLGKLTLALRGQNDTQ 243


>gi|147677784|ref|YP_001211999.1| flp pilus assembly protein CpaB [Pelotomaculum thermopropionicum
           SI]
 gi|146273881|dbj|BAF59630.1| flp pilus assembly protein CpaB [Pelotomaculum thermopropionicum
           SI]
          Length = 242

 Score =  156 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 54/239 (22%), Positives = 103/239 (43%), Gaps = 27/239 (11%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK   ++ + V    A   G      V   +++   VI+     F  V +++  +     
Sbjct: 1   MKNRLILILAVIVGLAAAGGT----YVYLDNLKKSYVIS---GDFTRVAVARQRITARTR 53

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG- 119
           +T  ++E    P + + +          + +E+ G + +  IL G+ I  ++L    +  
Sbjct: 54  ITAQMIELKDIPAKYINELA------AVSPEEIVGKIAKSEILPGEQILRDRLAQGSSAT 107

Query: 120 -GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS-----LSERKPTVTVVLSN 173
            GL+ +L  GKRA T+ ++  S + G+IKP D VDVV           E+    ++++ +
Sbjct: 108 DGLAFMLQPGKRAVTVAVNEVSGLAGLIKPGDRVDVVGTFDLQGAPGQEKSSITSILIQD 167

Query: 174 IRVIAIDHNI-------DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           + V++ D           + ++     T TL +TP QA+ LV       + L+LR   D
Sbjct: 168 VDVLSTDQATIPLQENGQNGKKEAPARTVTLSVTPEQAQPLVLCSEKGTIRLILRPATD 226


>gi|322434103|ref|YP_004216315.1| Flp pilus assembly protein CpaB [Acidobacterium sp. MP5ACTX9]
 gi|321161830|gb|ADW67535.1| Flp pilus assembly protein CpaB [Acidobacterium sp. MP5ACTX9]
          Length = 291

 Score =  156 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 58/230 (25%), Positives = 100/230 (43%), Gaps = 19/230 (8%)

Query: 1   MKLTRLM-GIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           M   RL    +++ + + +   +  R +  H    E V  ++       + +   L  G 
Sbjct: 1   MNGRRLTTAFLIALLISGLCTWVLSRKMGTH--AAERVADQHY------VAASRPLQSGE 52

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG 119
            + P+ +E V +P  N   G           ++L G  V  P+ K  P+  + L   G+G
Sbjct: 53  QLKPDSMELVNWPASNPIAGGFLKP------EDLVGRSVLYPVEKDQPLTDKLLSTAGSG 106

Query: 120 -GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV-RSLSERKPTVTVVLSNIRVI 177
            GL++ +P G RA ++       V G + P  H+DV++  R+    +P    VL +  V+
Sbjct: 107 PGLAARIPAGMRAISLKSDEIMGVAGFLSPGSHLDVLVTYRTDKNPEPVTLTVLQDAEVL 166

Query: 178 AIDHNI--DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
           A    I  D D + +  +  TL LTP  A+  V A S   +  +LRS +D
Sbjct: 167 AAGQKIQPDPDGKPVTATVVTLLLTPEDAQRAVLASSQGAIHFILRSGSD 216


>gi|148253053|ref|YP_001237638.1| hypothetical protein BBta_1513 [Bradyrhizobium sp. BTAi1]
 gi|146405226|gb|ABQ33732.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 309

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 58/244 (23%), Positives = 102/244 (41%), Gaps = 23/244 (9%)

Query: 24  MRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDD 83
           +   S    +   V+  +      VL++   +A+G ++    + W       V  G++  
Sbjct: 23  IAWFSQMRSRPVAVVERSVESRPAVLVAARTIALGTLLRKEDIAWKDVMPGEVRPGYLMR 82

Query: 84  VHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-GLSSLLPKGKRAATMDISISSAV 142
                A  E  G + R    + +P+   + V  G+   L+++L  G RA ++ +  + + 
Sbjct: 83  GQVSEA--EFLGAISRRNFAQDEPLIASEFVKPGDRQFLAAVLKPGSRAISIFVDAAQSA 140

Query: 143 GGMIKPNDHVDVVMVRSLSE------RKPTVTVVLSNIRVIAIDHNIDSDER-------- 188
            GM  P D VDV++ +S  E      RK     +L ++RVIAID ++             
Sbjct: 141 AGMALPGDRVDVILTQSFGEQATDPGRKTVSETMLRDVRVIAIDQSLTPSTNVAAAISTE 200

Query: 189 VLVGSTATLELTPMQAKALVAAQSVAKLSLVL----RSIADLNPSSSEDSDVW--DVQEE 242
             +  T TLEL   QA+AL+ A  + K  L +    R   +     +E   VW  DV   
Sbjct: 201 ARIPKTVTLELLERQAEALMVAAQLGKFQLAVLPLERVAVEHPEEQTEAGPVWASDVSPA 260

Query: 243 GKEI 246
            +E+
Sbjct: 261 LREV 264


>gi|254461000|ref|ZP_05074416.1| Flp pilus assembly protein CpaB [Rhodobacterales bacterium
           HTCC2083]
 gi|206677589|gb|EDZ42076.1| Flp pilus assembly protein CpaB [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 286

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 49/243 (20%), Positives = 98/243 (40%), Gaps = 14/243 (5%)

Query: 7   MGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLI------SKGDLAVGMV 60
           M   V  +  +    +A+ +   +  Q +  + E  A    V+       +   L+ G  
Sbjct: 1   MIFGVVLLIGIALAGVAVHMTQKYVNQHKAALLEAQANKTPVVPTVPVFVANRKLSYGDE 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NG 119
           +    +    +P   +  G      +   + +     V     K + I   K+ + G + 
Sbjct: 61  IKLKDIAVAQWPSNALPKGIFQSKEELFPIDQAGARYVMRATEKFEAILAVKITEPGKSV 120

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP------TVTVVLSN 173
           GL S L  G+ A T+ +  +S V G ++P ++VDV     +              ++ S 
Sbjct: 121 GLQSRLEPGQSAFTIKVDSTSGVSGFLRPGNNVDVYWTGKVQANGEQRKSRTVTRLIESA 180

Query: 174 IRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSE 232
           +R+IAID + + + ++  +  T T+ +T +Q  +L  AQS  +L+L L    D   +   
Sbjct: 181 VRIIAIDQSANEEVKKASIARTVTVAVTQLQGASLTQAQSTGRLNLSLVGERDETIAELI 240

Query: 233 DSD 235
           + D
Sbjct: 241 EVD 243


>gi|302391028|ref|YP_003826848.1| Flp pilus assembly protein CpaB [Acetohalobium arabaticum DSM 5501]
 gi|302203105|gb|ADL11783.1| Flp pilus assembly protein CpaB [Acetohalobium arabaticum DSM 5501]
          Length = 278

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 58/244 (23%), Positives = 114/244 (46%), Gaps = 16/244 (6%)

Query: 7   MGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNIL 66
           + IV++ +  L+       ++       +E + E P    +V+++K ++     +T + +
Sbjct: 5   VVIVIAVILGLITSGAVYFMMDN---MQQEAVKEQPK--ASVVVAKQNIEPREQITRSKV 59

Query: 67  EWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG--NGGLSSL 124
           +    P+E V    +  + Q      L        I+ G+ +   +L+ +   + GL+  
Sbjct: 60  QLKQVPQETVHSQAVTSISQAVEKFALK------DIISGEQLLKPRLLGKEEVSSGLAFN 113

Query: 125 LPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTV-TVVLSNIRVIAIDHNI 183
           L   KRA T+ ++  S V G + P D+VDVV V S  E + TV   VL  ++V+A+  ++
Sbjct: 114 LADDKRAVTVPVTEVSGVAGFLTPGDYVDVVSVFSTYEAQQTVAKTVLQKVKVLAVAQDM 173

Query: 184 --DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQE 241
             + D++  V  + TL +   +A+ LV A    ++ LVLRS  + + S S      ++  
Sbjct: 174 VRERDQKPKVTKSVTLGVGLAEAEKLVLADRKGEIRLVLRSAQNESFSMSNGVKFEELVG 233

Query: 242 EGKE 245
             +E
Sbjct: 234 NLEE 237


>gi|327540753|gb|EGF27320.1| Pilus assembly, Flp-type CpaB [Rhodopirellula baltica WH47]
          Length = 403

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 50/247 (20%), Positives = 103/247 (41%), Gaps = 20/247 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+   +  ++++ V   +A I   + +         V        + + ++   + +   
Sbjct: 30  MRNKSVF-LILACVCGTIAAIGVSQWMQAQSTGQSSVA------TVEIFVTAKTIDIAEE 82

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +T + +    +P + V  G          +++++G   R    +G+P+   KL+   NG 
Sbjct: 83  ITADKIRLEQWPADRVPTGA------SGKLEDVEGKFARQRFYEGEPVMPVKLMADANGS 136

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE--RKPTVTVVLSNIRVIA 178
            S  +P G    +M     S+V  +++P D VDV+     SE   + T   VL+ +RV A
Sbjct: 137 -SQTIPVGFSVVSMRADPESSVATLVRPGDRVDVMAYFVKSELIPETTAKTVLTGVRVFA 195

Query: 179 ID----HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           +D      +DS+       + +L +      A   A  + K+ L L + +D+N +   ++
Sbjct: 196 VDGRTEREVDSEAEAKPARSISLLIHKKDTPAWTYASELGKIRLTLGNPSDINETKDGET 255

Query: 235 DVWDVQE 241
           D    QE
Sbjct: 256 DGGAGQE 262


>gi|87199533|ref|YP_496790.1| Flp pilus assembly CpaB [Novosphingobium aromaticivorans DSM 12444]
 gi|87135214|gb|ABD25956.1| Flp pilus assembly CpaB [Novosphingobium aromaticivorans DSM 12444]
          Length = 260

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 50/218 (22%), Positives = 94/218 (43%), Gaps = 13/218 (5%)

Query: 43  AKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPI 102
           A    ++++   +  G  +T        +P   V  G   ++            +    I
Sbjct: 4   ASLTRIVVASQAIEFGKPLTNTNTRLADWPAGTVPPGAFTNLA-----DAQRNRIAMQAI 58

Query: 103 LKGDPIRLEKLVDR-GNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS-- 159
             G+PI   ++    G   L++ LP G  A ++ IS  + V G ++P D VD+++ R   
Sbjct: 59  AAGEPILASRVTGTDGRATLAAALPPGMVAVSLPISDVTGVSGFVRPGDLVDIILTRQIP 118

Query: 160 ---LSERKPTVTVVLSNIRVIAIDHNID-SDERVLVGSTATLELTPMQAKALVAAQSVAK 215
                ++     V+L  + V+ ID   D S    +VG TAT+++  + A+ L  A+ +  
Sbjct: 119 GEGAGQQDKMTDVILRQVAVLGIDQVADKSKTEAVVGKTATVQVDTLGAQKLALARELGT 178

Query: 216 LSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAGV 253
           LSL LRS+A +  +    + V      G+++ I +   
Sbjct: 179 LSLGLRSLASVEDTGPTRT-VLARDLAGRQLFIARRSA 215


>gi|32473552|ref|NP_866546.1| pilus assembly protein CpaB [Rhodopirellula baltica SH 1]
 gi|32398232|emb|CAD78327.1| probable pilus assembly protein CpaB [Rhodopirellula baltica SH 1]
          Length = 403

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 50/247 (20%), Positives = 103/247 (41%), Gaps = 20/247 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+   +  ++++ V   +A I   + +         V        + + ++   + +   
Sbjct: 30  MRNKSVF-LILACVCGTIAAIGVSQWMQAQSTGQSSVA------TVEIFVTAKTIDIAEE 82

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +T + +    +P + V  G          +++++G   R    +G+P+   KL+   NG 
Sbjct: 83  ITADKIRLEQWPADRVPTGA------SGKLEDVEGKFARQRFYEGEPVMPVKLMADANGS 136

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE--RKPTVTVVLSNIRVIA 178
            S  +P G    +M     S+V  +++P D VDV+     SE   + T   VL+ +RV A
Sbjct: 137 -SQTIPVGFSVVSMRADPESSVATLVRPGDRVDVMAYFVKSELIPETTAKTVLTGVRVFA 195

Query: 179 ID----HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           +D      +DS+       + +L +      A   A  + K+ L L + +D+N +   ++
Sbjct: 196 VDGRTEREVDSEAEAKPARSISLLIHKKDTPAWTYASELGKIRLTLGNPSDINETKDGET 255

Query: 235 DVWDVQE 241
           D    QE
Sbjct: 256 DGGAGQE 262


>gi|260778163|ref|ZP_05887056.1| flp pilus assembly protein RcpC/CpaB [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260606176|gb|EEX32461.1| flp pilus assembly protein RcpC/CpaB [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 279

 Score =  155 bits (391), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 63/269 (23%), Positives = 115/269 (42%), Gaps = 29/269 (10%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   RLM + +     L++ +    L+        +   +    F  VL+S  D+ VG V
Sbjct: 1   MTAKRLMMLSI-----LLSSVGIGLLLLGQDNSEHQTKEQPEQVFQRVLVSGQDIGVGDV 55

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQ-ELDGVLVRVPILKGDPIRLEKLVDR-GN 118
            TPN+  W +  EE + D ++D V +       L   +  + I +G  I    L+   G 
Sbjct: 56  YTPNMFRWQSLSEEQLSD-YVDYVTEDEITSINLASGIAHIAIKQGQVIAAADLIPPQGG 114

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE---------RKPTVTV 169
             L+  +  G RA ++ +   +A  G ++P D VD++++ S                V+ 
Sbjct: 115 ASLALKVRAGYRAVSVPVDQVTANSGFVQPGDKVDILLLGSKVSELKKYDNVVEGLYVST 174

Query: 170 VLSNIRVIAIDHNIDSDE----------RVLVGSTATLELTPMQAKALVAAQSVAKLSLV 219
           + +N+R++A ++   S+           ++   S+ +LE+TP QA  +V A  + +L+L 
Sbjct: 175 IATNVRILAFNNLSSSEGFQEKRHDYGAKIPDNSSVSLEVTPEQATQIVLANQLGRLTLS 234

Query: 220 LRSIA--DLNPSSSEDSDVWDVQEEGKEI 246
           LR     D +   S       +  E K I
Sbjct: 235 LRGSGETDFSLPQSHTITTTQLNPESKLI 263


>gi|283769331|ref|ZP_06342230.1| Flp pilus assembly protein CpaB [Bulleidia extructa W1219]
 gi|283103988|gb|EFC05372.1| Flp pilus assembly protein CpaB [Bulleidia extructa W1219]
          Length = 228

 Score =  155 bits (391), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 57/235 (24%), Positives = 102/235 (43%), Gaps = 27/235 (11%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK    +  + +   AL    +A+ L+S              A+   V ++  ++     
Sbjct: 1   MKK---IKFIAAISGALTMVFLALFLISSS--------AGRGAQSTAVYVASKNIKANQQ 49

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG--- 117
           +T ++LE+   P   V +G            EL G + +V ILK   I  E +   G   
Sbjct: 50  ITEDMLEYKKVPGNLVVEGA------AKNKDELLGKMAKVDILKNSVISKENVYKEGEPE 103

Query: 118 -NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRV 176
            NGGL+ ++ KGKRA +  +  S+ +  +++  D VD+++ R   +       +LSN+++
Sbjct: 104 KNGGLTYVIAKGKRAISFPVEYSTGISSLLRGGDRVDIILTR-AKDSNFVSKTILSNVKI 162

Query: 177 IAIDHNID-----SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADL 226
           +A+ ++       S       ST T+EL+P     L+       LSL LR+  D 
Sbjct: 163 LALGNDYSVGVNKSGSEGKSYSTVTVELSPEDCVKLMNGSKAGTLSLSLRTPGDN 217


>gi|162147490|ref|YP_001601951.1| pilus assembly protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545597|ref|YP_002277826.1| Flp pilus assembly protein CpaB [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786067|emb|CAP55649.1| putative pilus assembly protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209533274|gb|ACI53211.1| Flp pilus assembly protein CpaB [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 292

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 71/271 (26%), Positives = 120/271 (44%), Gaps = 32/271 (11%)

Query: 5   RLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPN 64
           R++ IVV+    +   I+    +          +TE     + VL+++     G ++   
Sbjct: 4   RILLIVVAVSGLIGVVILGRLALHSGEKPVVAQVTEKKVPTVGVLVARKAEPAGALLQSG 63

Query: 65  ILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSS 123
            L+   FP   V  G I DV  P+    L G L+RVP+ +G  +  E ++  G+ G L++
Sbjct: 64  DLQTKDFPANLVPPGAIHDV--PSERAALTGGLLRVPVPEGGLLTNEAVLRVGDHGFLAA 121

Query: 124 LLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP------------------ 165
           +L  G  A ++ +   S V  +I+P D+VD+++   ++                      
Sbjct: 122 VLKPGDSAVSVGVDSVSGVADLIEPGDYVDLIVTHDVATADVANSGGGAGGNPGGDAGGG 181

Query: 166 --TVTVVLSNIRVIAID----HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLV 219
                 VLS +RV+AID    H    D R +   T TLE+TP QA+A+  A  + +L+L 
Sbjct: 182 RIAAETVLSALRVVAIDREMQHTSTVDSRGVGNRTVTLEVTPAQAEAVAVAGRLGRLTLA 241

Query: 220 LRS-----IADLNPSSSEDSDVWDVQEEGKE 245
           +RS     +A   P ++   DV      G E
Sbjct: 242 VRSLDQAGVAAFAPHTTWGGDVSPALAHGPE 272


>gi|312883753|ref|ZP_07743472.1| Flp pilus assembly protein CpaB, putative [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309368502|gb|EFP96035.1| Flp pilus assembly protein CpaB, putative [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 279

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 55/228 (24%), Positives = 100/228 (43%), Gaps = 23/228 (10%)

Query: 20  GIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDG 79
             IA+ L++P   Q E+        F  VL++K  + VG   T N+ +W    E+ +   
Sbjct: 16  VGIAILLLNPSKPQFEQSQAAAEI-FKRVLVAKQRVVVGQPYTLNMFQWEKVSEQEL-SN 73

Query: 80  FIDDVHQPNAMQ-ELDGVLVRVPILKGDPIRLEKL-VDRGNGGLSSLLPKGKRAATMDIS 137
           ++D + + +  + +L   +    I  G  +  +      G   ++  +  G RA ++ + 
Sbjct: 74  YLDFISEEDFSRLDLKSGIAHTAIQSGQVMSKDDFETPNGGISMAFKVQNGHRAISVPVD 133

Query: 138 ISSAVGGMIKPNDHVDVVMVRSLSER---------KPTVTVVLSNIRVIAIDHNID---- 184
             +A  G ++P D VD++++ S  E             VT +  N+RV+A +   D    
Sbjct: 134 AVTANSGFVQPGDKVDILLLGSQVEELKKYDNQVAGLYVTTIAVNVRVLAFNQYADPQDF 193

Query: 185 SDERVLVG------STATLELTPMQAKALVAAQSVAKLSLVLRSIADL 226
              R   G      S+ +LE+TP QA  +V A  + KL+L LR   + 
Sbjct: 194 QKNRSAYGADIPDNSSVSLEVTPEQATQIVLANQIGKLTLSLRGAGEA 241


>gi|330811038|ref|YP_004355500.1| hypothetical protein PSEBR_a4092 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379146|gb|AEA70496.1| Hypothetical protein; putative exported protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 271

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 58/227 (25%), Positives = 105/227 (46%), Gaps = 16/227 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M    L  I +S V  L A  +A   +S        +         +V+++  ++  G +
Sbjct: 1   MSSRTLPLIGISLVMGLGAAWMADSWLS------ARLNATPDDHLRSVVVATVEIPFGQM 54

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR-GNG 119
           V    +  V  P + + D         ++ ++  G +    IL+GD +R  +L +  G  
Sbjct: 55  VEAQQVTTVRMPMDTIPDDAF------DSSEQAVGKIATFDILRGDIVRGARLSEHLGGS 108

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRS--LSERKPTVTVVLSNIRVI 177
            L+SL+   KRA ++ +     VGG + P + VDV+  ++        T   +L N+RV+
Sbjct: 109 TLASLIAPDKRAISVRVDDVVGVGGFLLPGNRVDVLATKTTNAGSNSATSRTLLENLRVL 168

Query: 178 AIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSI 223
           A+D    +D+ + +V    TLE++  +A+ LV AQ+  KL L LR+ 
Sbjct: 169 AVDQTAGTDKTQPVVVRAVTLEMSATEAELLVTAQTEGKLQLALRNP 215


>gi|78062907|ref|YP_372815.1| Flp pilus assembly CpaB [Burkholderia sp. 383]
 gi|77970792|gb|ABB12171.1| Flp pilus assembly CpaB [Burkholderia sp. 383]
          Length = 342

 Score =  153 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 63/274 (22%), Positives = 106/274 (38%), Gaps = 28/274 (10%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVV 61
           K  RL  +VV+             ++   +V               V ++  DL  G+++
Sbjct: 3   KPLRLAVLVVAAGIG-------AFILRELYVAASTPSVATETDQARVRVAAADLPEGLLL 55

Query: 62  TPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-G 120
             N L W   P   V  G   +        +L G L+R  +  G PIR+E ++  G    
Sbjct: 56  RDNDLAWKRMPRAQVPAGAFVESQPG---ADLKGALLRNHVGAGAPIRVENVIPAGAPDF 112

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT-----VTVVLSNIR 175
           L++ L  G RA ++ +   S   G+I+P D VDV++ + +     +        V+   R
Sbjct: 113 LAAALQPGMRAISVPVDDVSGNAGLIQPGDFVDVLLTQQIGGSATSPGTFEAETVVRRAR 172

Query: 176 VIAIDHNIDSDERV-------LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNP 228
           V+A+       +             T TLE+ P  A+ ++ A  +  LSL LRS A  + 
Sbjct: 173 VLAVGSEFQRAKAPASAPDATARARTVTLEVAPRTAQVVLVATRLGSLSLALRSFATSDR 232

Query: 229 SSSEDSDVWDVQEEGKEIQIIKAGVIVNKDGEGI 262
                 D     E+  + Q + AG +     E  
Sbjct: 233 RQPAGGD-----EQEPDTQPVWAGDVSRAAREAA 261


>gi|242315438|ref|ZP_04814454.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1106b]
 gi|242138677|gb|EES25079.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1106b]
          Length = 366

 Score =  153 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 56/257 (21%), Positives = 98/257 (38%), Gaps = 43/257 (16%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F   A  +A            +     P + + V ++  DL  G++
Sbjct: 5   LKLAGLMLVAVVGAFLFRALYVA----------ASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNA------------------MQELDGVLVRVPI 102
           +    L W          G + +                          +L G L+R P+
Sbjct: 55  LRDADLGWKTMARSAAPAGALIEGDARGDGKAAGAANDASAAAAGEPKTDLKGDLLRHPV 114

Query: 103 LKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL- 160
             G P+    ++     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + L 
Sbjct: 115 RAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQLA 174

Query: 161 --------SERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAKAL 207
                    +R      + + +RV+A+         D+ +      T T E++   A+ +
Sbjct: 175 APGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSRDAQVI 234

Query: 208 VAAQSVAKLSLVLRSIA 224
                +  LSL LRS A
Sbjct: 235 TVGAHLGALSLALRSFA 251


>gi|225174960|ref|ZP_03728957.1| Flp pilus assembly protein CpaB [Dethiobacter alkaliphilus AHT 1]
 gi|225169600|gb|EEG78397.1| Flp pilus assembly protein CpaB [Dethiobacter alkaliphilus AHT 1]
          Length = 238

 Score =  153 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 53/237 (22%), Positives = 97/237 (40%), Gaps = 17/237 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  R + +  + +  LV  +     +   +      I  +     NV+++   +     
Sbjct: 1   MKANRKLLLA-AVIVGLVTVVALNSYIRSLNTPALASIPHS-----NVVVASSTIPAHTR 54

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG- 119
           +T  +L+ V+ P + V    +       ++ +  G + R  I++G+ +   ++V      
Sbjct: 55  ITAEMLDVVSIPNDAVHPEALR------SVDDAAGGISRTEIVRGEQVIDARVVTEDRRA 108

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE--RKPTVTVVLSNIRVI 177
            LS  +P+G RA ++ +   + V G I   D++DV++    +E         V  N+ V+
Sbjct: 109 TLSYRVPEGMRAISIPVGEVTGVAGYISAGDNIDVLITYDDTEIHEGAITYTVFQNVNVL 168

Query: 178 AIDHNIDS--DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSE 232
           A   N     DE   V  T TL +T  QA+ L  A       L LRS  D +    E
Sbjct: 169 ATGPNTREKDDEEQEVVGTVTLSVTAAQAEVLAYALLKGNYHLTLRSPLDEDEVELE 225


>gi|284048527|ref|YP_003398866.1| Flp pilus assembly protein CpaB [Acidaminococcus fermentans DSM
           20731]
 gi|283952748|gb|ADB47551.1| Flp pilus assembly protein CpaB [Acidaminococcus fermentans DSM
           20731]
          Length = 339

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 57/272 (20%), Positives = 102/272 (37%), Gaps = 38/272 (13%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   +LM +  S   A+   ++ + L +    Q    +    A  + V+ +  D+A   V
Sbjct: 27  MSPRKLMLLCGSAALAVFL-LLYVILSALFPDQKPGNVA---AGNVTVVEAARDIAPQTV 82

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +T  +L+ V  P   V  G + D  Q        G    + +  GD +   KL   G GG
Sbjct: 83  LTEEMLKTVEVPANLVPAGALTDKKQA------LGKKTGIDLFAGDILTERKLTSHG-GG 135

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
              ++P G RA +  ++  + V G  KP D VD+++V            +L ++ ++A++
Sbjct: 136 FVGMIPDGMRAVSFGVNDVTGVSGFAKPGDKVDILLVTDKEGNGIVSKTLLKDVLILAVN 195

Query: 181 ----------HNIDSDERVLVG-----------------STATLELTPMQAKALVAAQSV 213
                         SD++ L                   S  T+ LTP  A  L+ +  +
Sbjct: 196 KSSDRPQGTTQTSGSDKKTLTSGSQPAGNSGSTGSMGTPSVVTVALTPYDAAKLIGSSRI 255

Query: 214 AKLSLVLRSIADLNPSSSEDSDVWDVQEEGKE 245
            +L ++LR         S    V  +      
Sbjct: 256 GQLQMMLRPADGSTDDKSIGYYVIPLPGNTAS 287


>gi|87312293|ref|ZP_01094391.1| probable pilus assembly protein CpaB [Blastopirellula marina DSM
           3645]
 gi|87284997|gb|EAQ76933.1| probable pilus assembly protein CpaB [Blastopirellula marina DSM
           3645]
          Length = 363

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 44/194 (22%), Positives = 92/194 (47%), Gaps = 13/194 (6%)

Query: 22  IAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFI 81
           +A   +S       +  T    +  N+ ++  D+ +   ++P +++   +P++ V +G +
Sbjct: 1   MASIGISQVLESKSQQSTAPQMEMENIFVAIEDIDINEQLSPELIKLEPWPKDKVPEGAV 60

Query: 82  DDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRGNGGLSSLLPKGKRAATMDISISS 140
            +      ++E++    RV +  G+PI   KL     + G S ++PKG R  ++ ++  +
Sbjct: 61  TN------LEEIENRRPRVRLYAGEPILERKLFGSNEDKGASKMIPKGFRVHSVRVTAET 114

Query: 141 AVGGMIKPNDHVDVVMVRSLSE--RKPTVTVVLSNIRVIAID----HNIDSDERVLVGST 194
           +  G+I P D VDV++    S    K     +L N+RV A++       DS+   +   T
Sbjct: 115 SASGLILPGDRVDVLVYLRNSGSINKTLTRTILKNVRVFAVNEQTHRETDSEGNTITAKT 174

Query: 195 ATLELTPMQAKALV 208
            +L + P Q + L+
Sbjct: 175 VSLLVKPSQVEVLM 188


>gi|121534342|ref|ZP_01666166.1| SAF domain [Thermosinus carboxydivorans Nor1]
 gi|121307112|gb|EAX48030.1| SAF domain [Thermosinus carboxydivorans Nor1]
          Length = 286

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 53/232 (22%), Positives = 104/232 (44%), Gaps = 23/232 (9%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MKL+    + ++ V +L    +  + +       +E   + P + + V+++K D+     
Sbjct: 1   MKLSTKGVLAIALVLSLATTGLIYKYL-------QEATQKTPQEGVVVVVAKVDIPPKTK 53

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NG 119
           +T  ++     P E V  G + +      ++   G + R  I+ G+ I   +LV +G + 
Sbjct: 54  ITAEMVATAKVPAEYVQPGAVRE------LKTAVGAIAREHIVAGEQIAERRLVIQGKSA 107

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE-RKPTVTVVLSNIRVIA 178
           G + ++P  KRA T+ ++  + V G +KP D+VDVV     +        ++L N+ V+A
Sbjct: 108 GFTGIIPPDKRAVTIAVTEVTGVAGFVKPGDYVDVVATFDQNTVGDNVSQIILQNVLVLA 167

Query: 179 IDH--------NIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRS 222
            +              +  +  +T TL +TP +   L  A+   K+ L LR 
Sbjct: 168 ANRDAEAGAADGAKDKKEAIKTATVTLAVTPDEVAQLALAEDKGKVRLALRP 219


>gi|217978827|ref|YP_002362974.1| Flp pilus assembly protein CpaB [Methylocella silvestris BL2]
 gi|217504203|gb|ACK51612.1| Flp pilus assembly protein CpaB [Methylocella silvestris BL2]
          Length = 338

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 55/253 (21%), Positives = 105/253 (41%), Gaps = 22/253 (8%)

Query: 5   RLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKF---INVLISKGDLAVGMVV 61
           R + IV+  VF +    + +  V     +  EV +   A       +L +   +  G ++
Sbjct: 4   RKLLIVLGAVFVIAGVGLCIAWVGQLRNREIEVASPAAAPAASEQAILSATRAIPAGELL 63

Query: 62  TPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-G 120
             + + W       V  G +       A  E  G + R     G+ +    LV   +   
Sbjct: 64  RSDDIGWKNVGAAGVQAGNLLRGQ--VAETEFFGAITRRDFAAGEGLIASDLVKPNDRRF 121

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE-----RKPTVTVVLSNIR 175
           L+++L  G+RA ++ +  + +  G++ P D+VDV++ +   +     R+     VL N+R
Sbjct: 122 LAAVLKPGRRALSVSVDAAQSAAGLVLPGDYVDVILTQDFGDKIDIGRRTVSETVLWNVR 181

Query: 176 VIAIDHNIDSDERVL-----------VGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
           VIA+D ++D+    +           +  T TLE+   QA+ L+ A  + K  L +R + 
Sbjct: 182 VIAVDQSLDAQTSTVAEHTALGAESHIPKTVTLEMFERQAETLLVAAQLGKFQLAVRPLV 241

Query: 225 DLNPSSSEDSDVW 237
                  ED  + 
Sbjct: 242 GSGDVKIEDQHIA 254


>gi|300856049|ref|YP_003781033.1| putative cell wall-binding protein [Clostridium ljungdahlii DSM
           13528]
 gi|300436164|gb|ADK15931.1| putative cell wall binding protein [Clostridium ljungdahlii DSM
           13528]
          Length = 321

 Score =  151 bits (382), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 48/223 (21%), Positives = 97/223 (43%), Gaps = 24/223 (10%)

Query: 41  NPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRV 100
             AK   +L++   ++ G ++   +++ +  P   +FD +I D        ++ G     
Sbjct: 35  EAAKKTTILVAAETISPGTLIDKKMIKKIQVPYNPIFDNYIKDSS------KIAGKYTTE 88

Query: 101 PILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL 160
            I K +   ++KL+++G   L+  +    RA ++ ++  S V G++KP D+VD+++  S 
Sbjct: 89  TISKNEGFHIDKLLEKGGDELNLKIDNDYRAISISVTGDSGVSGLLKPKDYVDIIVYTSE 148

Query: 161 SERK------PTVTVVLSNIRVIAIDHNIDSDERVLVGST------------ATLELTPM 202
                         +VL NI+V+A+D  I  D +    +              TL +   
Sbjct: 149 KRDGIKVVRPDEAKIVLQNIQVLAVDKQISRDNKESNSNKSSDNGKAPTNFLVTLSVKVS 208

Query: 203 QAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKE 245
             + +V AQS+  + L LR + D   + +  +   D+     E
Sbjct: 209 DLEKVVLAQSIGSIKLALRPLKDEITTQTNGTTWEDMSVNTDE 251


>gi|261856885|ref|YP_003264168.1| Flp pilus assembly protein CpaB [Halothiobacillus neapolitanus c2]
 gi|261837354|gb|ACX97121.1| Flp pilus assembly protein CpaB [Halothiobacillus neapolitanus c2]
          Length = 258

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 55/245 (22%), Positives = 110/245 (44%), Gaps = 13/245 (5%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNI 65
            + + V+ +   +A ++A++ ++          T  P K   V++   +L VG V++   
Sbjct: 8   FLYVAVAVLLGGLASVLAVKYINQQV--ATRTHTAAPQKMRTVVVPVHNLKVGDVLSAKD 65

Query: 66  LEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLL 125
           L     P   V    +     P+  +   G ++  P+ +G PI    +    N   S ++
Sbjct: 66  LATRDIPVAYVPADALT----PDDYESHLGQMLTTPLAQGAPISAMAMEPIANHF-SDII 120

Query: 126 PKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNI-- 183
              + A T+D+S ++++ G+I P DH+D++++ S + +      +LS++ V+A   +   
Sbjct: 121 KPDRVAYTIDVSETNSISGLIVPGDHIDILLLLSKNSKDDI-RPLLSDVLVLATGKHAKG 179

Query: 184 ---DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQ 240
              D  E     S  TLELTP  A+ +  A+ + +L ++LRS     P +       D+ 
Sbjct: 180 VRSDGTEGNQGYSNLTLELTPKNAQRIGIAKKMGQLLVMLRSPDTKFPPNLGLLTASDLL 239

Query: 241 EEGKE 245
             G  
Sbjct: 240 GAGPR 244


>gi|255597441|ref|XP_002536774.1| conserved hypothetical protein [Ricinus communis]
 gi|223518588|gb|EEF25608.1| conserved hypothetical protein [Ricinus communis]
          Length = 302

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 57/257 (22%), Positives = 108/257 (42%), Gaps = 20/257 (7%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
           ++ ++ I++  V A++  +I   +V+       + ++      + + +S  DL  G+++ 
Sbjct: 1   MSNIIKILLLLVGAVLIALIVRTVVASISHPAAQAVS-----TVKIRVSAADLPQGLLLR 55

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRGNGGL 121
            + L W   P  NV    I  V       EL G L+R     G  +  + ++     G L
Sbjct: 56  DDDLAWKDVPAGNVPAAAI--VANAPNAIELKGALLRHAAAAGTVLGPDDVILPSAPGFL 113

Query: 122 SSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP------TVTVVLSNIR 175
           ++ L    RA ++ I   S   G+I+P D+VD+++ + +  R        +   V+  +R
Sbjct: 114 AATLKPDMRAVSVAIDDVSGNAGLIQPGDYVDLLLTQQMDHRTDSPDLAVSSETVVERVR 173

Query: 176 VIAID------HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
           V+A+          D+ +      T TLE+TP  A+ +  A  +  LS  LRS A  +  
Sbjct: 174 VLAVGSELSRPKTSDAPDANNRARTVTLEVTPHMAEVVSVAARLGSLSFALRSFAKASRE 233

Query: 230 SSEDSDVWDVQEEGKEI 246
           +   S V          
Sbjct: 234 ADAASAVPASGPLQARP 250


>gi|167581962|ref|ZP_02374836.1| Flp pilus assembly protein CpaB family [Burkholderia thailandensis
           TXDOH]
          Length = 269

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 59/271 (21%), Positives = 105/271 (38%), Gaps = 39/271 (14%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F   A  IA            +     P + + V ++  DL  G++
Sbjct: 5   LKLAGLMLVAVVGAFLFRALYIA----------ASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNA--------------MQELDGVLVRVPILKGD 106
           +    L W      +V  G + +                      +L G L+R P+ +G 
Sbjct: 55  LRDVDLGWKTMARGDVPAGALIEGDARGDGRTAGAAVDASAAAAGDLKGDLLRHPVREGM 114

Query: 107 PIRLEKLV-DRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL----- 160
           P+    ++     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + L     
Sbjct: 115 PLGPADVILPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQLAAPGG 174

Query: 161 ----SERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAKALVAAQ 211
                ER      + + +RV+A+         D+ +      T T E++   A+ +    
Sbjct: 175 APADPERAVESETIAARVRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSHDAQVITVGA 234

Query: 212 SVAKLSLVLRSIADLNPSSSEDSDVWDVQEE 242
            +  LSL LRS A  +  ++  +        
Sbjct: 235 HLGALSLALRSFATSDRGAAGLASAEPPAPP 265


>gi|149178506|ref|ZP_01857094.1| pilus assembly transmembrane protein [Planctomyces maris DSM 8797]
 gi|148842621|gb|EDL56996.1| pilus assembly transmembrane protein [Planctomyces maris DSM 8797]
          Length = 324

 Score =  148 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 57/238 (23%), Positives = 94/238 (39%), Gaps = 14/238 (5%)

Query: 10  VVSGVFALVAGIIAMRLVSP--HHVQTEEVITENPAKFINVLI---SKGDLAVGMVVTPN 64
           + + +FA++ G+ A   V    H      V+ E+P      ++   +  DL  G  ++ +
Sbjct: 1   MTAAIFAILLGLGAAYTVRQFLHEKPKPFVLAEDPPAGPKKIVLPIASRDLVPGQKLSLD 60

Query: 65  ILEWVAFPEENVFDGFIDDVHQPN---AMQELDGVLVRVPILKGDPIRLEKLVDRGNG-G 120
            +  +    E +   +  D          Q + G  ++  I  G P     L   G G G
Sbjct: 61  DISLLQISPELLSKRYDADSEGKQRIMMTQYIAGRTLKTAIKAGQPFHTIDLFANGMGPG 120

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT-VVLSNIRVIAI 179
           +S +L  G RA T+ I     V G  +P   VDV+     ++  P  T  +L  +RV+A+
Sbjct: 121 ISEILEPGNRAVTVAIHKIGNVAGFSRPGTIVDVLFRSKETDGIPETTITLLEKVRVLAV 180

Query: 180 DHNIDSDERVLVG----STATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
                   +V  G       TLE++P Q K L   +    LSL LR   +     S  
Sbjct: 181 GDQAVPGHKVGEGGGMDHPVTLEVSPEQGKVLKVVEDHGILSLALRHPDENTEVVSAG 238


>gi|319788662|ref|YP_004148137.1| Flp pilus assembly protein CpaB [Pseudoxanthomonas suwonensis 11-1]
 gi|317467174|gb|ADV28906.1| Flp pilus assembly protein CpaB [Pseudoxanthomonas suwonensis 11-1]
          Length = 274

 Score =  148 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 60/239 (25%), Positives = 102/239 (42%), Gaps = 22/239 (9%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
               + I ++   AL+A  +A+  V      T    T++    + V +   D+  G ++ 
Sbjct: 7   SKNFLYIAIAVGMALLAAFVAVNYVQT----TVAERTQDNRPMVEVAVPMDDMPQGAILQ 62

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLS 122
           P  L     P E      +     P    + +G ++R P+  G P+    LV   +   S
Sbjct: 63  PGDLALRRIPAEYAPADAVT----PENHGQFEGRMLRSPVRGGAPLSASALVPLYDQF-S 117

Query: 123 SLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT-----VVLSNIRVI 177
            L+P+GK A T+ +  ++++ GMI P D +D++ ++   E     T      +L  +RV+
Sbjct: 118 RLIPRGKVAYTLSVDENNSISGMIAPGDLIDILFLKDKDESSGARTGALALPLLQQVRVL 177

Query: 178 AIDHNIDS----DERVL----VGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNP 228
           A    I      D R        S+ TLEL   QAK L  A     L ++LR + D +P
Sbjct: 178 ATGTRIGERVAPDGRPADDGQGFSSVTLELDHGQAKTLAVASEAGSLRVLLRELEDDSP 236


>gi|167919050|ref|ZP_02506141.1| Flp pilus assembly protein CpaB [Burkholderia pseudomallei BCC215]
          Length = 275

 Score =  148 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 56/257 (21%), Positives = 98/257 (38%), Gaps = 43/257 (16%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F   A  +A            +     P + + V ++  DL  G++
Sbjct: 5   LKLAGLMLVAVVGAFLFRALYVA----------ASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNA------------------MQELDGVLVRVPI 102
           +    L W          G + +                          +L G L+R P+
Sbjct: 55  LRDADLGWKTMARSAAPAGALIEGDARGDGKAAGAANDASAAAAGEPKTDLKGDLLRHPV 114

Query: 103 LKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL- 160
             G P+    ++     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + L 
Sbjct: 115 RAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQLA 174

Query: 161 --------SERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAKAL 207
                    +R      + + +RV+A+         D+ +      T T E++   A+ +
Sbjct: 175 APGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSRDAQVI 234

Query: 208 VAAQSVAKLSLVLRSIA 224
                +  LSL LRS A
Sbjct: 235 TVGAHLGALSLALRSFA 251


>gi|254441777|ref|ZP_05055270.1| Flp pilus assembly protein CpaB [Octadecabacter antarcticus 307]
 gi|198251855|gb|EDY76170.1| Flp pilus assembly protein CpaB [Octadecabacter antarcticus 307]
          Length = 286

 Score =  148 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 59/277 (21%), Positives = 112/277 (40%), Gaps = 15/277 (5%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHV--QTEEVITENPAKFINVLISKGDLAVG 58
           M+    + + V    A  A  +    +   +   + +    E     ++V      +  G
Sbjct: 1   MRAVFGLVLFVGMGLAGFAIYMVQGYLQEQNANLERQRAAMELAVPTVHVYAVNRVMEHG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN 118
             +T   +  + + E  + +G      +  +    +  +V   +   +PI   K+   G 
Sbjct: 61  EQITMQDIIMIRYAEPYLPEGVFRTAEELFSAGPDELRVVIRQMEPNEPILATKVTAPGE 120

Query: 119 -GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE------RKPTVTVVL 171
            GG+++LL +G RA T+++ +SS V G + P D VDV     ++             ++ 
Sbjct: 121 VGGITALLARGMRAFTIEVDVSSGVSGFLNPGDRVDVYWTGRVNGIDGANTNGEFTKLIQ 180

Query: 172 SNIRVIAIDHNIDSDE-RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           + I ++AID   +S      +  T T+++TP Q  AL  AQ+   LSL L    D   +S
Sbjct: 181 AGIELVAIDQTSESGRIGASIARTVTVQVTPDQVAALAQAQATGNLSLSLVGREDDTVAS 240

Query: 231 SEDSDVWDV-----QEEGKEIQIIKAGVIVNKDGEGI 262
           S + +   +     Q    EIQ  +   I  + G  +
Sbjct: 241 SVEVNQASLLGIEAQAPTPEIQTAEICSIRTRRGAEV 277


>gi|167902789|ref|ZP_02489994.1| Flp pilus assembly protein CpaB [Burkholderia pseudomallei NCTC
           13177]
          Length = 279

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 56/257 (21%), Positives = 98/257 (38%), Gaps = 43/257 (16%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F   A  +A            +     P + + V ++  DL  G++
Sbjct: 5   LKLAGLMLVAVVGAFLFRALYVA----------ASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNA------------------MQELDGVLVRVPI 102
           +    L W          G + +                          +L G L+R P+
Sbjct: 55  LRDADLGWKTMARSAAPAGALIEGDARGDGKAAGAANDASAAAAGEPKTDLKGDLLRHPV 114

Query: 103 LKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL- 160
             G P+    ++     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + L 
Sbjct: 115 RAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQLA 174

Query: 161 --------SERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAKAL 207
                    +R      + + +RV+A+         D+ +      T T E++   A+ +
Sbjct: 175 APGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSRDAQVI 234

Query: 208 VAAQSVAKLSLVLRSIA 224
                +  LSL LRS A
Sbjct: 235 TVGAHLGALSLALRSFA 251


>gi|295690799|ref|YP_003594492.1| Flp pilus assembly protein Cpab [Caulobacter segnis ATCC 21756]
 gi|295432702|gb|ADG11874.1| Flp pilus assembly protein CpaB [Caulobacter segnis ATCC 21756]
          Length = 293

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 82/288 (28%), Positives = 132/288 (45%), Gaps = 40/288 (13%)

Query: 1   MKLTRLMGIVVSGVFALVAGII---AMRLVSPHHVQTEEVITENPAKFINVLISKGDLAV 57
           M   RL+ ++++ V A+   ++   A+ + +   V               VL++K DLA+
Sbjct: 1   MSPVRLLIVLIAAVSAIGMAVVLQRALGVKADKPVAAAAPAAAPAKPMTQVLVAKRDLAI 60

Query: 58  GMVVTPNILEWVAFPEENVFDGFIDDVHQP------------------------NAMQEL 93
           G  +T   ++W A+P ++V   FI +   P                        +  + L
Sbjct: 61  GARLTQADIDWQAWPSDSVNAAFITNGAAPAEGETTSGAVALAKAAVTGQMIGGDPAKAL 120

Query: 94  DGVLVRVPILKGDPIRLEKLVDRGNGG-LSSLLPKGKRAATMDISISSAVGGMIKPNDHV 152
           DG +VR PIL G+PI   K+V  G GG LS +L  GKRA  + +S  +  GG I P D V
Sbjct: 121 DGAIVRDPILAGEPITARKIVRGGEGGYLSVVLTPGKRAVAVPVSADTTAGGFILPGDRV 180

Query: 153 DVVMVRSLS------ERKPTVTVVLSNIRVIAIDHN--IDSDERVLVGSTATLELTPMQA 204
           DV+  R          R      VL N+RV+A+D     D D +  + ++ATLE+   +A
Sbjct: 181 DVLSTRDAPLPGGVGGRVIIGETVLRNVRVLALDQKTVADKDAKSQIATSATLEVGAAEA 240

Query: 205 KALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAG 252
           +AL AA++   ++L LR+  D    S   +   D       ++I + G
Sbjct: 241 EALAAAKAGGPVTLALRAYTDAGAPSGGFAGPSD----PAAVRINRGG 284


>gi|260892925|ref|YP_003239022.1| Flp pilus assembly protein CpaB [Ammonifex degensii KC4]
 gi|260865066|gb|ACX52172.1| Flp pilus assembly protein CpaB [Ammonifex degensii KC4]
          Length = 233

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 56/234 (23%), Positives = 101/234 (43%), Gaps = 20/234 (8%)

Query: 16  ALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEEN 75
           A+ A +     +               A +++V+++  D+ V   +TP++L+    P   
Sbjct: 14  AVGAAVGTYFYLERLKATY-----RQKAHYVSVVVAAQDIPVRTSLTPSLLKLQDLPSSC 68

Query: 76  VFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG--GLSSLLPKGKRAAT 133
           V    +  +      ++  G +  VP+++G+ +   KL    +    L+  L  G+RA T
Sbjct: 69  VHPLAVRRI------EDAVGRVTTVPLVRGEVLLQSKLASSKDEKQELALSLQPGERAVT 122

Query: 134 MDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT---VVLSNIRVIAIDHNIDSDERVL 190
           + ++  S VGG++KP D VDVV    L  +    T   +V SN+RV+A+  +        
Sbjct: 123 LAVNAVSGVGGVLKPGDRVDVVATFDLESQGTKTTYTALVASNVRVLALGSS----GEKK 178

Query: 191 VGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGK 244
              T TL +TP Q   +  A     + L LR   +   +      + D+ E GK
Sbjct: 179 PYDTVTLAVTPRQGALITLATERGSVRLFLRGPKEQEATQLLPVKLPDLLEAGK 232


>gi|254197384|ref|ZP_04903806.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           S13]
 gi|169654125|gb|EDS86818.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           S13]
          Length = 350

 Score =  148 bits (374), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 56/257 (21%), Positives = 98/257 (38%), Gaps = 43/257 (16%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F   A  +A            +     P + + V ++  DL  G++
Sbjct: 5   LKLASLMLVAVVGAFLFRALYVA----------ASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNA------------------MQELDGVLVRVPI 102
           +    L W          G + +                          +L G L+R P+
Sbjct: 55  LRDADLGWKTMARSAAPAGALIEGDARGDGKAAGAANDASAAAAGEPKTDLKGDLLRHPV 114

Query: 103 LKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL- 160
             G P+    ++     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + L 
Sbjct: 115 RAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQLA 174

Query: 161 --------SERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAKAL 207
                    +R      + + +RV+A+         D+ +      T T E++   A+ +
Sbjct: 175 APGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSRDAQVI 234

Query: 208 VAAQSVAKLSLVLRSIA 224
                +  LSL LRS A
Sbjct: 235 TVGAHLGALSLALRSFA 251


>gi|126452162|ref|YP_001066149.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1106a]
 gi|126225804|gb|ABN89344.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1106a]
          Length = 350

 Score =  148 bits (373), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 56/257 (21%), Positives = 98/257 (38%), Gaps = 43/257 (16%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F   A  +A            +     P + + V ++  DL  G++
Sbjct: 5   LKLAGLMLVAVVGAFLFRALYVA----------ASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNA------------------MQELDGVLVRVPI 102
           +    L W          G + +                          +L G L+R P+
Sbjct: 55  LRDADLGWKTMARSAAPAGALIEGDARGDGKAAGAANDASAAAAGEPKTDLKGDLLRHPV 114

Query: 103 LKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL- 160
             G P+    ++     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + L 
Sbjct: 115 RAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQLA 174

Query: 161 --------SERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAKAL 207
                    +R      + + +RV+A+         D+ +      T T E++   A+ +
Sbjct: 175 APGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSRDAQVI 234

Query: 208 VAAQSVAKLSLVLRSIA 224
                +  LSL LRS A
Sbjct: 235 TVGAHLGALSLALRSFA 251


>gi|83721444|ref|YP_442981.1| CpaB family Flp pilus assembly protein [Burkholderia thailandensis
           E264]
 gi|257139205|ref|ZP_05587467.1| CpaB family Flp pilus assembly protein [Burkholderia thailandensis
           E264]
 gi|83655269|gb|ABC39332.1| Flp pilus assembly protein CpaB family [Burkholderia thailandensis
           E264]
          Length = 345

 Score =  148 bits (373), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 61/277 (22%), Positives = 107/277 (38%), Gaps = 44/277 (15%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F   A  +A            +     P + + V ++  DL  G++
Sbjct: 5   LKLAGLMLVAVVGAFLFRALYVA----------ASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNA--------------MQELDGVLVRVPILKGD 106
           +    L W      +V  G + +                      +L G L+R P+ +G 
Sbjct: 55  LRDVDLGWKTMARGDVPAGALIEGDARGDGRTAGAAVDASAAAAGDLKGDLLRHPVREGM 114

Query: 107 PIRLEKLV-DRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL----- 160
           P+    ++     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + L     
Sbjct: 115 PLGPADVILPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQLAAPGG 174

Query: 161 ----SERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAKALVAAQ 211
                ER      + + +RV+A+         D+ +      T T E++   A+ +    
Sbjct: 175 APADPERAVESETIAARVRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSHDAQVITVGA 234

Query: 212 SVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQI 248
            +  LSL LRS A     +S+   V     E     +
Sbjct: 235 HLGALSLALRSFA-----TSDRGAVGLASAEPPAPPV 266


>gi|188586926|ref|YP_001918471.1| Flp pilus assembly protein CpaB [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179351613|gb|ACB85883.1| Flp pilus assembly protein CpaB [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 233

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 53/237 (22%), Positives = 110/237 (46%), Gaps = 18/237 (7%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITEN--PAKFINVLISKGDLAVGM 59
           KL +  G++VS + A+V  +I  + +S      E            + V+++  +L  G 
Sbjct: 3   KLKKYRGLLVSLILAIVTVLIIHQYISSLETAYEGTGPREIDGEDQVAVVVATSNLDTGT 62

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG 119
           ++T + L+    PE+      + D       +E+ G +++  +++ + +   +++     
Sbjct: 63  ILTQDHLDTRKVPEQTAHPQAVTD------KEEITGEVLKQDVVEHEVLMSSRVLGEEEA 116

Query: 120 G-LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP-------TVTVVL 171
             LS ++P+ KRA ++ +   S V G I+  D+VDVV  +   +R+        +  ++L
Sbjct: 117 NKLSEVIPENKRAMSVAVDQVSGVAGFIQAGDYVDVVATKDEEDREGQEPSQDSSSEIIL 176

Query: 172 SNIRVIAIDHNI--DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADL 226
            N++V+A+   I     E V   ST TL +   +A  L  A+    + L+L+ I + 
Sbjct: 177 DNLQVLAVGDRILYSRQELVQEVSTVTLAVNRNEATELTHAEEEHVIRLLLQPITEN 233


>gi|152994346|ref|YP_001339181.1| SAF domain-containing protein [Marinomonas sp. MWYL1]
 gi|150835270|gb|ABR69246.1| SAF domain protein [Marinomonas sp. MWYL1]
          Length = 309

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 59/271 (21%), Positives = 109/271 (40%), Gaps = 31/271 (11%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAK--FINVLISKGDLAVG 58
           MK++ +  I  + VFA+   ++   L S        V      K  F  VL +  DL  G
Sbjct: 1   MKVSSVFFISGALVFAIGGALLVRVLASTPPPPAPVVKAAPAPKPVFTPVLAASKDLVPG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN 118
             +  + ++W+A  ++     +   +   + +  + G  VR P+ KGD +    +V  G+
Sbjct: 61  DFIDNSAVQWLAVDKQYESHSYF--LKGVDQVDAVFGATVREPVAKGDVLGSRVVVLPGD 118

Query: 119 GGL-SSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP------------ 165
            G  +S+L  G RA  +     ++  G++   D VDVV+     +               
Sbjct: 119 AGFIASVLESGMRAVAIPADAVTSNAGLVSAGDRVDVVLGLKRDQENGGEADPMASIELP 178

Query: 166 --TVTVVLSNIRVIAIDHNIDSDERVLV------------GSTATLELTPMQAKALVAAQ 211
                 +L N+RV+A++  ++   +                 T TLE+ P   + L  A+
Sbjct: 179 KLASQTLLRNVRVLALNDAVEEMAKEKPTEEKSGAKKRKFYETVTLEVFPKDVERLTVAR 238

Query: 212 SVAKLSLVLRSIADLNPSSSEDSDVWDVQEE 242
            +  L L LRS+ +     S D +    ++E
Sbjct: 239 EIGVLQLALRSVRNEMLVGSSDENRIAARDE 269


>gi|76810999|ref|YP_333434.1| CpaB family Flp pilus assembly protein [Burkholderia pseudomallei
           1710b]
 gi|126438737|ref|YP_001058907.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           668]
 gi|134282270|ref|ZP_01768975.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           305]
 gi|226196386|ref|ZP_03791968.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           Pakistan 9]
 gi|254179873|ref|ZP_04886472.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1655]
 gi|254188721|ref|ZP_04895232.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254258897|ref|ZP_04949951.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1710a]
 gi|76580452|gb|ABA49927.1| Flp pilus assembly protein CpaB family [Burkholderia pseudomallei
           1710b]
 gi|126218230|gb|ABN81736.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           668]
 gi|134246308|gb|EBA46397.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           305]
 gi|157936400|gb|EDO92070.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           Pasteur 52237]
 gi|184210413|gb|EDU07456.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1655]
 gi|225931603|gb|EEH27608.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           Pakistan 9]
 gi|254217586|gb|EET06970.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           1710a]
          Length = 350

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 56/257 (21%), Positives = 98/257 (38%), Gaps = 43/257 (16%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F   A  +A            +     P + + V ++  DL  G++
Sbjct: 5   LKLAGLMLVAVVGAFLFRALYVA----------ASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNA------------------MQELDGVLVRVPI 102
           +    L W          G + +                          +L G L+R P+
Sbjct: 55  LRDADLGWKTMARSAAPAGALIEGDARGDGKAAGAANDASAAAAGEPKTDLKGDLLRHPV 114

Query: 103 LKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS 161
             G P+    ++     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + L+
Sbjct: 115 RAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQLA 174

Query: 162 ERKPT---------VTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAKAL 207
               T            + + +RV+A+         D+ +      T T E++   A+ +
Sbjct: 175 APGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSRDAQVI 234

Query: 208 VAAQSVAKLSLVLRSIA 224
                +  LSL LRS A
Sbjct: 235 TVGAHLGALSLALRSFA 251


>gi|303241713|ref|ZP_07328210.1| Flp pilus assembly protein CpaB [Acetivibrio cellulolyticus CD2]
 gi|302590714|gb|EFL60465.1| Flp pilus assembly protein CpaB [Acetivibrio cellulolyticus CD2]
          Length = 250

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 51/261 (19%), Positives = 114/261 (43%), Gaps = 24/261 (9%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+      IV+S + AL    +    +       +  +  +  ++I+V ++   +A    
Sbjct: 1   MESVNKRVIVISIILALFTTALVFLYI------KDATVKPDVVEYIDVYVAAKTMAAKYE 54

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +T   ++     +E +    +          ++ G  ++  +++G+ I   +LV   N  
Sbjct: 55  ITEADIKKTRVTKEYLNTDAVL------VQADIIGKRLKESVIEGEQILRSRLVQEDNFT 108

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERK---------PTVTVVL 171
           L+  +P+G RA +++++  + V  +I+P D VD++    L ++               V+
Sbjct: 109 LAYNVPEGMRAISVNVNEQTEVANLIRPGDFVDIIASFPLEKQDIGQNTIINLGISQTVI 168

Query: 172 SNIRVIAIDHN--IDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPS 229
            N++V+A+  +  I+ D+++ +  T TL ++P  A+ L        + + LRSI D    
Sbjct: 169 QNVQVLALGQDLAIEEDKKLELPKTVTLAVSPKDAEKLTFVTEFGTMRMTLRSIGDDKII 228

Query: 230 SSEDSDVWDVQEEGKEIQIIK 250
            S D  + D     K + I+ 
Sbjct: 229 -SGDGTIKDDVMGDKGVIIVP 248


>gi|121599044|ref|YP_993007.1| Flp pilus assembly protein CpaB [Burkholderia mallei SAVP1]
 gi|124386572|ref|YP_001026339.1| Flp pilus assembly CpaB [Burkholderia mallei NCTC 10229]
 gi|126449623|ref|YP_001080387.1| Flp pilus assembly protein CpaB [Burkholderia mallei NCTC 10247]
 gi|254177864|ref|ZP_04884519.1| Flp pilus assembly protein CpaB family [Burkholderia mallei ATCC
           10399]
 gi|254358541|ref|ZP_04974814.1| Flp pilus assembly protein CpaB family [Burkholderia mallei
           2002721280]
 gi|121227854|gb|ABM50372.1| Flp pilus assembly protein CpaB [Burkholderia mallei SAVP1]
 gi|124294592|gb|ABN03861.1| Flp pilus assembly CpaB [Burkholderia mallei NCTC 10229]
 gi|126242493|gb|ABO05586.1| Flp pilus assembly protein CpaB [Burkholderia mallei NCTC 10247]
 gi|148027668|gb|EDK85689.1| Flp pilus assembly protein CpaB family [Burkholderia mallei
           2002721280]
 gi|160698903|gb|EDP88873.1| Flp pilus assembly protein CpaB family [Burkholderia mallei ATCC
           10399]
          Length = 350

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 56/257 (21%), Positives = 98/257 (38%), Gaps = 43/257 (16%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F   A  +A            +     P + + V ++  DL  G++
Sbjct: 5   LKLAGLMLVAVVGAFLFRALYVA----------ASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNA------------------MQELDGVLVRVPI 102
           +    L W          G + +                          +L G L+R P+
Sbjct: 55  LRDADLGWKTMARSAAPAGALIEGDARGDGKAAGAANDASAAAAGEPKTDLKGDLLRHPV 114

Query: 103 LKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS 161
             G P+    ++     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + L+
Sbjct: 115 RAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQLA 174

Query: 162 ERKPT---------VTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAKAL 207
               T            + + +RV+A+         D+ +      T T E++   A+ +
Sbjct: 175 APGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSRDAQVI 234

Query: 208 VAAQSVAKLSLVLRSIA 224
                +  LSL LRS A
Sbjct: 235 TVGAHLGALSLALRSFA 251


>gi|217421311|ref|ZP_03452815.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           576]
 gi|237812164|ref|YP_002896615.1| Flp pilus assembly protein CpaB [Burkholderia pseudomallei MSHR346]
 gi|217395053|gb|EEC35071.1| putative pilus assembly protein CpaB [Burkholderia pseudomallei
           576]
 gi|237502713|gb|ACQ95031.1| Flp pilus assembly protein CpaB [Burkholderia pseudomallei MSHR346]
          Length = 350

 Score =  146 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 56/257 (21%), Positives = 98/257 (38%), Gaps = 43/257 (16%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F   A  +A            +     P + + V ++  DL  G++
Sbjct: 5   LKLAGLMLVAVVGAFLFRALYVA----------ASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNA------------------MQELDGVLVRVPI 102
           +    L W          G + +                          +L G L+R P+
Sbjct: 55  LRDADLGWKTMARSAAPAGALIEGDARGDGKAAGAANDASAAAAGEPKTDLKGDLLRHPV 114

Query: 103 LKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS 161
             G P+    ++     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + L+
Sbjct: 115 RAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQLA 174

Query: 162 ERKPT---------VTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAKAL 207
               T            + + +RV+A+         D+ +      T T E++   A+ +
Sbjct: 175 APGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSRDAQVI 234

Query: 208 VAAQSVAKLSLVLRSIA 224
                +  LSL LRS A
Sbjct: 235 TVGAHLGALSLALRSFA 251


>gi|53719432|ref|YP_108418.1| putative fimbriae-assembly related protein [Burkholderia
           pseudomallei K96243]
 gi|52209846|emb|CAH35818.1| putative fimbriae-assembly related protein [Burkholderia
           pseudomallei K96243]
          Length = 350

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 56/257 (21%), Positives = 98/257 (38%), Gaps = 43/257 (16%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +KL  LM + V G F          L    +V   +     P + + V ++  DL  G++
Sbjct: 5   LKLAGLMLVAVVGAF----------LFRVLYVAASQPRPAAPPQQVRVRVAAADLPAGLL 54

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNA------------------MQELDGVLVRVPI 102
           +    L W          G + +                          +L G L+R P+
Sbjct: 55  LRDADLGWKTMARSAAPAGALIEGDARGDGKAAGAANDASAAAAGEPKTDLKGDLLRHPV 114

Query: 103 LKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS 161
             G P+    ++     G L++ L  G RA ++ I   S   G+I+P D+VDV++ + L+
Sbjct: 115 RAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGDYVDVLLTQQLA 174

Query: 162 ERKPT---------VTVVLSNIRVIAIDHNI-----DSDERVLVGSTATLELTPMQAKAL 207
               T            + + +RV+A+         D+ +      T T E++   A+ +
Sbjct: 175 APGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTVTFEVSSRDAQVI 234

Query: 208 VAAQSVAKLSLVLRSIA 224
                +  LSL LRS A
Sbjct: 235 TVGAHLGALSLALRSFA 251


>gi|319941903|ref|ZP_08016224.1| hypothetical protein HMPREF9464_01443 [Sutterella wadsworthensis
           3_1_45B]
 gi|319804556|gb|EFW01426.1| hypothetical protein HMPREF9464_01443 [Sutterella wadsworthensis
           3_1_45B]
          Length = 295

 Score =  145 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 57/225 (25%), Positives = 102/225 (45%), Gaps = 36/225 (16%)

Query: 28  SPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQP 87
           +        V++EN A+ ++V  +  +L+ G  ++   +EW A  +    D F+ +  Q 
Sbjct: 27  AVQKEAAAPVVSENKAQ-VSVARAAANLSPGSFLSARDIEWTAVAQSAAKDTFVQNESQ- 84

Query: 88  NAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-GLSSLLPKGKRAATMDISISSAVGGMI 146
               +L G LV  PI  G+ I    L+ R +   ++++L  G RA T+++ + +   G++
Sbjct: 85  ----DLSGALVLKPIKAGEVISPSALLARTDPEFVAAVLAPGMRAFTIEVDMVTGGAGLL 140

Query: 147 KPNDHVDVVMVRSLSERK----------PTVTVVLSNIRVIAIDHNIDSDE--------R 188
           +P + VDV++      +K               +L N+RVIA+DH I+            
Sbjct: 141 RPGNRVDVILAAQTDPQKSRAFASQKNFDVARTLLHNLRVIAVDHTIEPKGFGADPQSSD 200

Query: 189 VLVGS-----------TATLELTPMQAKALVAAQSVAKLSLVLRS 222
             +             T TLE+TP   + L  A+S  +LSL LR+
Sbjct: 201 PRMVRSSTPANINRKGTVTLEVTPKDVELLTVARSNGQLSLSLRN 245


>gi|220918103|ref|YP_002493407.1| Flp pilus assembly protein CpaB [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219955957|gb|ACL66341.1| Flp pilus assembly protein CpaB [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 309

 Score =  145 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 59/255 (23%), Positives = 110/255 (43%), Gaps = 16/255 (6%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVV 61
           +  R    V   V A++A +    L++ +       +         V++++ D+ V   +
Sbjct: 17  RKRRAAWGVTFLVVAILAAVGVALLLTRYMDARVAAVR---VPTSGVVVAQVDIPVATPI 73

Query: 62  TPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-G 120
            P  L  V +P   +  G   +         L G +  VPI +G+ +   KL   G   G
Sbjct: 74  KPEWLGVVPWPVTALPPGAASEPA------ALVGQVAIVPITRGEAVLPSKLATAGARSG 127

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP-TVTVVLSNIRVIAI 179
           L++LLP G RA  + +     V G + P D VDV++     E  P T  +VL N++V+A+
Sbjct: 128 LATLLPAGMRAVAVRVDDVVGVAGFLHPGDRVDVIVTMQPREGVPYTSKIVLQNVKVLAV 187

Query: 180 DHNID----SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
             +++      E+    + ATL +T  +++ L  + S  +L L LR++ D     ++   
Sbjct: 188 GQHLELRGKDAEKPNPVTVATLMVTGDESERLALSASKGQLLLSLRALGDEELVDTKGIT 247

Query: 236 VW-DVQEEGKEIQII 249
                    +E ++ 
Sbjct: 248 PPVLFASAAQEPRVA 262


>gi|317122047|ref|YP_004102050.1| Flp pilus assembly protein CpaB [Thermaerobacter marianensis DSM
           12885]
 gi|315592027|gb|ADU51323.1| Flp pilus assembly protein CpaB [Thermaerobacter marianensis DSM
           12885]
          Length = 236

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 56/248 (22%), Positives = 108/248 (43%), Gaps = 19/248 (7%)

Query: 1   MKLTRLM-GIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           M   R++  +++  +  L   ++    +     Q E          + V+++   +    
Sbjct: 1   MSRGRIVRYLLLPVLVGLAVTVLVAFYIRVPAGQAES------GPRVPVVVATRPVPAQT 54

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD-RGN 118
            +  ++L     P + V  G I        +++  G + +VP+ +G+ +   KL    G 
Sbjct: 55  RLEADMLAVRQVPADLVGRGAIGR------LEDAVGKVTKVPLAEGEFVLASKLARGDGT 108

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM---VRSLSERKPTVTVVLSNIR 175
            GL+  LP+G RA T+      AVGG ++P D VDV +          +P V +++ N+ 
Sbjct: 109 DGLAYRLPEGTRALTVAADPVIAVGGFVQPGDRVDVFIGLPGGQPGVAQPEVRLLVENVL 168

Query: 176 VIAIDHNIDSDERVL-VGST-ATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSED 233
           V+A+     ++ +    G T  TL ++P  A A+V A+   +L L LR   D  P+    
Sbjct: 169 VLAVQQQTAAEGQPAGEGLTHLTLAVSPAHAAAIVLAEQEGRLRLALRPAGDDTPAGPIT 228

Query: 234 SDVWDVQE 241
           + + D+  
Sbjct: 229 ARLADLAR 236


>gi|115376401|ref|ZP_01463638.1| Flp pilus assembly CpaB, putative [Stigmatella aurantiaca DW4/3-1]
 gi|310822673|ref|YP_003955031.1| Flp pilus assembly protein CpaB [Stigmatella aurantiaca DW4/3-1]
 gi|115366608|gb|EAU65606.1| Flp pilus assembly CpaB, putative [Stigmatella aurantiaca DW4/3-1]
 gi|309395745|gb|ADO73204.1| Flp pilus assembly protein CpaB [Stigmatella aurantiaca DW4/3-1]
          Length = 270

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 104/232 (44%), Gaps = 12/232 (5%)

Query: 27  VSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQ 86
           V+   ++ +E         + V+++  D+  G V++  ++   + PE+ V    +    +
Sbjct: 21  VAYSAIKKKEADVRRGWNLVPVVVAAQDIPEGSVISFEMISQRSVPEQFVTSSVV----K 76

Query: 87  PNAMQELDGVLVRVPILKGDPIRLEKL-VDRGNGGLSSLLPKGKRAATMDISISSAVGGM 145
           P++   +    V VP+  GDP+   +    +    LS+ + K  RA T++   +++VGG 
Sbjct: 77  PDSANYVVNQKVLVPLQAGDPLLWSQFETTKAAERLSTKVQKKGRAVTIEAKSTTSVGGW 136

Query: 146 IKPNDHVDVVMV-RSLSERKPTVTVVLSNIRVIAIDHNIDSD------ERVLVGSTATLE 198
           I+PNDHVDV+   R     +     +L N+ V+A      +       E     S  +L 
Sbjct: 137 IRPNDHVDVIGTFRDPQTDENVAVTLLQNVIVLATGKITGTTNVNLIPENQRDYSNISLL 196

Query: 199 LTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIK 250
           + P +A+ LV A  +  L+L LR+  D++               G+  ++++
Sbjct: 197 VIPEEAEILVLASELGNLTLSLRNEDDVDLIEERGRATISTLLSGERTRVLE 248


>gi|302343420|ref|YP_003807949.1| Flp pilus assembly protein CpaB [Desulfarculus baarsii DSM 2075]
 gi|301640033|gb|ADK85355.1| Flp pilus assembly protein CpaB [Desulfarculus baarsii DSM 2075]
          Length = 279

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 49/209 (23%), Positives = 90/209 (43%), Gaps = 12/209 (5%)

Query: 34  TEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQEL 93
             +   E   +   ++++  DL  G+ ++   L    +P E    G         A++ L
Sbjct: 33  KAQQEAERRVRTAPLVVAAVDLPAGLELSAGRLAVAQWPVEARPPGHF------GAVKPL 86

Query: 94  DGVLVRVPILKGDPIRLEKLVDR-GNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHV 152
            G +++ P++KG+P+   KL       GL++ +  G RA T+       V G +K  D V
Sbjct: 87  LGRVLQQPVVKGEPLLAGKLSPEGAAAGLAAAIKPGWRAVTISADEVVGVAGYLKVGDRV 146

Query: 153 DVVMVRSL--SERKPTVTVVLSNIRVIAIDHNIDSDER---VLVGSTATLELTPMQAKAL 207
           DV+         ++    + L ++ V+A+ H  + D +    L G   TL   P  A+ L
Sbjct: 147 DVIATVKGLDQGKEAVARLALQDLEVLAVSHQAEQDGKKPPKLKGQVLTLLARPADAERL 206

Query: 208 VAAQSVAKLSLVLRSIADLNPSSSEDSDV 236
             A    K+ L LR+  D  P+ +  + +
Sbjct: 207 ALAAGEGKILLALRNRQDRQPALTRGARL 235


>gi|237653357|ref|YP_002889671.1| Flp pilus assembly protein CpaB [Thauera sp. MZ1T]
 gi|237624604|gb|ACR01294.1| Flp pilus assembly protein CpaB [Thauera sp. MZ1T]
          Length = 286

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 61/263 (23%), Positives = 117/263 (44%), Gaps = 20/263 (7%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
              L+ + V+ +F L A  +A R +     +  E+      +  + +++K DLAVG  +T
Sbjct: 6   PRNLIILAVASLFGLGAAWLAARYL---EERATEIELRQQGQMGHAVVAKTDLAVGTPLT 62

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLS 122
            +++     P E +    I     P   +   G ++  P   G+P+   +L +R    LS
Sbjct: 63  RDLVAVREVPVEWLHSSAIT----PEQFERAAGAVLAQPARGGEPLVWSQLEERRPATLS 118

Query: 123 SLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHN 182
           + L  G+RA T+ +  +S++ G+++P D +D++              +L  +RV+A    
Sbjct: 119 AQLAPGRRATTIPVDETSSLSGLLRPGDRIDLLATVQRDH-HHLTLPLLQGVRVLATGSR 177

Query: 183 IDSDERVLVGS-------TATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
               E    G        T TL+L+  +A  LVAA+++A+L+ VLR   D   +  + +D
Sbjct: 178 TRPGEDDGAGDLLGGSFGTLTLDLSEEEATRLVAARALARLTAVLRHPRDTRTAPLQRTD 237

Query: 236 VWDV-----QEEGKEIQIIKAGV 253
              +           + +I  G+
Sbjct: 238 ALALLGLAPPAREAGVPVIYGGI 260


>gi|296121061|ref|YP_003628839.1| Flp pilus assembly protein CpaB [Planctomyces limnophilus DSM 3776]
 gi|296013401|gb|ADG66640.1| Flp pilus assembly protein CpaB [Planctomyces limnophilus DSM 3776]
          Length = 390

 Score =  143 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 52/241 (21%), Positives = 95/241 (39%), Gaps = 21/241 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK+  ++ ++V+    L+A +   + +            E     I VL+++ ++  G  
Sbjct: 1   MKMKPMILMLVAVACGLIAMMGVQQTLGS-------RSGEGSGPKIKVLVARKEVQAGTP 53

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +    + +    +    D  I      ++ +E D    RV + +G  +  ++L ++G  G
Sbjct: 54  LDETCVGFKLVSKSEAPDDVI------SSKEEYDKRAPRVKLYEGQYVLKKQLGNKGEYG 107

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT----VTVVLSNIRV 176
            S  +P G R  T+ ++ +    G++ P D VDV +  S +  K         VL  I V
Sbjct: 108 ASMEIPPGMRVVTVPVTATMTHSGLLSPGDRVDVQVTYSYTRPKYGKTFKTRTVLQYIEV 167

Query: 177 IAIDH----NIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSE 232
            A D        + E        +L + P Q   L  AQ    L L+LR   D  P+   
Sbjct: 168 WATDSVRMGTEAAKEDSSQSKNVSLLVYPGQGALLQLAQEKGTLHLLLRGRNDKAPAEQT 227

Query: 233 D 233
            
Sbjct: 228 G 228


>gi|255658703|ref|ZP_05404112.1| Flp pilus assembly protein CpaB [Mitsuokella multacida DSM 20544]
 gi|260849090|gb|EEX69097.1| Flp pilus assembly protein CpaB [Mitsuokella multacida DSM 20544]
          Length = 358

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 64/276 (23%), Positives = 106/276 (38%), Gaps = 49/276 (17%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVV 61
           K+T    +V +GV +++ G++    +S    +  E   +     + V+ +K D+    VV
Sbjct: 17  KITYRQWVVAAGVVSILLGLMVYLAMSGDDQKAAE---KPQTNLVQVVAAKQDIPERTVV 73

Query: 62  TPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL-VDRGNGG 120
             ++L+ V  P E V +G   DV                 I +GD +   K+ VD    G
Sbjct: 74  KEDMLKVVEVPSELVPEGAFHDVADAIDHP------TSTAIQQGDIMTSRKVYVDIRMAG 127

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
            + ++P   RA T+ I+  + V G   P D+VD++++    E      ++L ++ ++ I+
Sbjct: 128 FTGIIPPDCRAVTIPINDVTGVSGFAHPGDYVDIMVITGTKENGINGRIILQDVLLLGIN 187

Query: 181 HNID----------------------SDERVLVGS-----------TATLELTPMQAKAL 207
              D                      S     VGS           TAT+ L P  A  L
Sbjct: 188 RTADLPNTPTGDSSKKDGSQSDKQDASSGTANVGSVNTKASSDTMATATVALKPADALKL 247

Query: 208 VAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEG 243
            A      L LVLR      P    D   +D    G
Sbjct: 248 AAESQEGTLYLVLR------PFKPRDMYTFDTDYAG 277


>gi|84516632|ref|ZP_01003991.1| CpaB family protein [Loktanella vestfoldensis SKA53]
 gi|84509668|gb|EAQ06126.1| CpaB family protein [Loktanella vestfoldensis SKA53]
          Length = 277

 Score =  142 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 43/249 (17%), Positives = 107/249 (42%), Gaps = 7/249 (2%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQ--TEEVITENPAKFINVLISKGDLAVG 58
           M+    + ++V    A  A  +  + ++    Q      I       ++V ++   +  G
Sbjct: 1   MRAVFGLVLLVGMGLAGFAVYMVNQYMATQTAQLDRARQIAAQALVTVDVYVTTRSVTYG 60

Query: 59  MVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG- 117
             +T + +  V +P + + +G                 +V +P++  + +   K+ + G 
Sbjct: 61  EYLTADDVRLVPYPRDYLPEGTFATEQSLFPQGTQTPRVVVLPMIANELVLTTKVSEPGA 120

Query: 118 NGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVI 177
           + GL++L+  G RA  ++  +++   G+++P+D +DV     L + +    ++ S +++I
Sbjct: 121 SRGLTALVEPGFRAFPVEGRVAAGF-GILRPDDRIDVYWTGRLRDGREVTNLIKSGLQII 179

Query: 178 AIDHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVW 237
           A+  +  +        +  +++TP +   L  AQ+  +L+L L    DL+ +     D  
Sbjct: 180 AVLGDAGNRGGP---QSVVVQVTPEEVALLTQAQNSGQLTLALVGTGDLSETGPVTIDNS 236

Query: 238 DVQEEGKEI 246
            +  E   +
Sbjct: 237 ALTGEQDIV 245


>gi|108759025|ref|YP_632818.1| putative Flp pilus assembly protein CpaB [Myxococcus xanthus DK
           1622]
 gi|108462905|gb|ABF88090.1| putative Flp pilus assembly protein CpaB [Myxococcus xanthus DK
           1622]
          Length = 271

 Score =  142 bits (359), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 51/232 (21%), Positives = 104/232 (44%), Gaps = 12/232 (5%)

Query: 27  VSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQ 86
           ++   ++ +E         + V+++  D+  G V+T  ++   + PE+ V    +    +
Sbjct: 21  IAYSAIKKKEADVRRGWNLVPVVVAAQDVPEGTVITFEMISQRSVPEQFVTSSVV----R 76

Query: 87  PNAMQELDGVLVRVPILKGDPIRLEKL-VDRGNGGLSSLLPKGKRAATMDISISSAVGGM 145
           P++   +    V V +  GDP+   +    +    LSS + K  RA T++   +++VGG 
Sbjct: 77  PDSASYIVNQKVLVALQAGDPLLWSQFETTKAAERLSSKVQKKARALTIEAKHTTSVGGW 136

Query: 146 IKPNDHVDVVMV-RSLSERKPTVTVVLSNIRVIAIDHNIDSD------ERVLVGSTATLE 198
           I+PNDHVDV+   R     +     +L N+ V+A      +       E     +  +L 
Sbjct: 137 IRPNDHVDVIGTFRDPQTDENVAVTLLQNVIVVATGKITGTTNVNLIPENQREYNNISLM 196

Query: 199 LTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIK 250
           + P +A+ LV A  + +L+L LR+  D++               G+  ++++
Sbjct: 197 VLPEEAEILVLAVELGQLTLSLRNEDDVDLIEERGRATISTLLSGERTRVLE 248


>gi|170725114|ref|YP_001759140.1| Flp pilus assembly protein CpaB [Shewanella woodyi ATCC 51908]
 gi|169810461|gb|ACA85045.1| Flp pilus assembly protein CpaB [Shewanella woodyi ATCC 51908]
          Length = 298

 Score =  141 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 40/232 (17%), Positives = 94/232 (40%), Gaps = 16/232 (6%)

Query: 7   MGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNIL 66
           + ++++ V   +A             +    ++++  K   V+++  +L  G +++   +
Sbjct: 11  VLLIIAIVLGSIAAWATKNYFITKEQELIAELSKDNIKMAQVVVATQELRKGDIISEANM 70

Query: 67  EWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLP 126
                  + +    I     P    ++ G ++  P+  G P+    L        S +L 
Sbjct: 71  SVRKIQADTLPLDAIH----PKDFNQIVGQMLLEPMSPGRPLMGTYLPGHKAEQFSDILK 126

Query: 127 KGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT---VVLSNIRVIAID-HN 182
           +G+RA T++I   ++  GM+ P+DH+D+++               ++L N+ V+A    +
Sbjct: 127 EGQRAVTINIDELNSTAGMLVPSDHIDLLLSFDEESGDIERKKLQLLLENVTVLATGRQS 186

Query: 183 IDSD--------ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADL 226
           +D +        +     +T TL L+   A  +  A+   K    LR+  + 
Sbjct: 187 VDVNPELADTLYDNPNAYNTVTLALSVHDAARVTLAKEKGKFVTFLRNQTES 238


>gi|167836690|ref|ZP_02463573.1| Flp pilus assembly protein CpaB family [Burkholderia thailandensis
           MSMB43]
          Length = 351

 Score =  141 bits (356), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 59/255 (23%), Positives = 101/255 (39%), Gaps = 32/255 (12%)

Query: 10  VVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWV 69
            ++ + A+ A ++    ++               +         DL  G+++  + L W 
Sbjct: 9   ALTVIAAIGAFVMRGLFIAASRPVPPPAPVMARVRAA-----AADLPEGLLLRDSDLVWK 63

Query: 70  AFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKG 128
           + P + V  G   +     +  +L G L+R  + +G PI    ++     G L++ L  G
Sbjct: 64  SVPRDQVPPGAWAEGEPGGS--DLKGNLLRHMVREGTPIGAGDVISPNAPGFLAAALKLG 121

Query: 129 KRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP---------TVTVVLSNIRVIAI 179
            RA ++ I   S   G+I+P D+VDV++ + L                  V S +RV+A+
Sbjct: 122 MRAISVAIDDVSGNAGLIEPGDYVDVLLTQQLGTSGGPPVPPDHAIVSETVASRVRVLAV 181

Query: 180 D---HNIDSD----------ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA-- 224
                    D                 T TLE+TP  A+A+  A  +  LSL LRS A  
Sbjct: 182 GSVFQRPKDDAAQTNSNSNSNSSARARTVTLEVTPFYAQAITLASHLGSLSLALRSFAVS 241

Query: 225 DLNPSSSEDSDVWDV 239
           + NP+S        V
Sbjct: 242 ERNPASLAPEAPAPV 256


>gi|294102190|ref|YP_003554048.1| Flp pilus assembly protein CpaB [Aminobacterium colombiense DSM
           12261]
 gi|293617170|gb|ADE57324.1| Flp pilus assembly protein CpaB [Aminobacterium colombiense DSM
           12261]
          Length = 288

 Score =  141 bits (356), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 58/256 (22%), Positives = 120/256 (46%), Gaps = 23/256 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK  R + ++VS +  ++AG++  + +  + ++    I     + ++V+++        +
Sbjct: 1   MK-KRGIFLIVSLLLGIMAGLLVYQQIRSYKLK----IARAERELVSVVVAARPKDAFSI 55

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRGNG 119
           +T   ++ V  P  ++  G +       ++ E+ G    + + +GDP+   KL  D    
Sbjct: 56  ITAEDVKVVRMPRSSIPTGEVL------SLDEVVGKASMLALSEGDPVLKGKLSLDPEKL 109

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVV-MVRSLSERKPTVTVVLSNIRVIA 178
           G++  LP G+ A  + I    A GG+++P D+VDV  + R      PT  ++LS ++V+A
Sbjct: 110 GVAFQLPDGRVAIALPIDEVIAAGGLLRPGDYVDVFHVYREKDAVSPTSRLLLSRVKVLA 169

Query: 179 IDHNIDS-------DERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSS 231
           +   +          E+ ++  +A +E++P +A     AQS+  + L LR     N  + 
Sbjct: 170 LGGVLTRKEEKEGTKEKEMLARSAVVEVSPEEAAVAAWAQSLGSVWLALRPA---NEETL 226

Query: 232 EDSDVWDVQEEGKEIQ 247
             + V+   E   E Q
Sbjct: 227 TPAVVYKGPEVSPEPQ 242


>gi|251789645|ref|YP_003004366.1| Flp pilus assembly protein CpaB [Dickeya zeae Ech1591]
 gi|247538266|gb|ACT06887.1| Flp pilus assembly protein CpaB [Dickeya zeae Ech1591]
          Length = 308

 Score =  141 bits (356), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 55/270 (20%), Positives = 109/270 (40%), Gaps = 40/270 (14%)

Query: 1   MKLTRLMGIVVSGVFA-LVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGM 59
           MK+   + + V+ + A ++A I+  +L      Q        P +   VL++  DL+ G 
Sbjct: 1   MKINSTLLLSVALIAAGVMALIVRSQLPGTPAAQQTPAPAPIPVEKTAVLVTARDLSPGD 60

Query: 60  VVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN- 118
            +  + + W     +         +   +   +L G  +R  I  G P+    +V     
Sbjct: 61  FIDGSAVRWQE--TDQPVSRTFYFIRGKDQESQLYGATLRGKIPAGTPLNNNSVVRPNEP 118

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER---KPTV-------- 167
           G ++++L  G RA ++  S+ ++  G++   D+VD+++     +    +PT         
Sbjct: 119 GFIAAVLRPGMRAISIPTSVVASNAGLVSAGDYVDIILSLRRDDEVALQPTSQQPVPPPV 178

Query: 168 ---TVVLSNIRVIAIDHNIDS----------------------DERVLVGSTATLELTPM 202
                V  N+RV+A+++  D+                       +R  +  + TLE TP 
Sbjct: 179 VGAQTVARNLRVLALNNQTDAITSMRPRQDINGAEPAQNTPQGRQRTPIYQSITLEATPK 238

Query: 203 QAKALVAAQSVAKLSLVLRSIADLNPSSSE 232
           QA+ L  A+ V  L +  RS  D +  +  
Sbjct: 239 QAEVLTVAKEVGLLQMAQRSALDTSDDAEA 268


>gi|50119733|ref|YP_048900.1| hypothetical protein ECA0788 [Pectobacterium atrosepticum SCRI1043]
 gi|49610259|emb|CAG73702.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
          Length = 314

 Score =  141 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 52/272 (19%), Positives = 103/272 (37%), Gaps = 44/272 (16%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK+     +  + V A +  ++    +S        ++ + P K + VL++   L  G  
Sbjct: 1   MKVNSTYVLSGALVLAGIVALMVRSHLSSEPPAPPPMVVKVPEK-VAVLVAAKALHPGDF 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           +    L W     +       + +   ++   L G  +R  + +G P+    LV     G
Sbjct: 60  IDSASLRWDE--TDKPVSRTFNFIRGKDSQSLLLGATLRETVAEGTPLTSNVLVKPNEPG 117

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP-------------- 165
            ++++L KG RA ++  S  ++  G++   D VDV++     ++                
Sbjct: 118 FVAAVLRKGMRAISVPTSAIASNAGLVSAGDRVDVILSMKRDDQAELPPSRNQPVVMPLL 177

Query: 166 TVTVVLSNIRVIAIDHNIDS--------------------------DERVLVGSTATLEL 199
               ++ ++RV+A++    +                            R     T TLE+
Sbjct: 178 ASQTIVRDLRVLALNDKTGTPIYPRFDVAEDGTVLDATAKSRESAVRSRPTTYQTVTLEV 237

Query: 200 TPMQAKALVAAQSVAKLSLVLRSIADLNPSSS 231
           TP QA+AL  A+ +  L L LRS    + +  
Sbjct: 238 TPQQAEALAVAKELGMLHLALRSATQDDIADP 269


>gi|114797097|ref|YP_759868.1| putative Flp pilus assembly protein CpaB [Hyphomonas neptunium ATCC
           15444]
 gi|114737271|gb|ABI75396.1| putative Flp pilus assembly protein CpaB [Hyphomonas neptunium ATCC
           15444]
          Length = 295

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 51/233 (21%), Positives = 93/233 (39%), Gaps = 18/233 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK   L+ + +S      A       +S    +    +         + +++  +  G +
Sbjct: 1   MKAIPLISLGLSLALGAGAIFFGREFMSGDGGEANAAVAAPAIAMTQIAVARATIEPGKL 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG- 119
           +  +++E   +PE  V  G +  V          G++V      G+P+  EK+   G+  
Sbjct: 61  IDASMVEMRDWPESAVPAGAMRAVTDLGETAYSRGLVV-----AGEPLLAEKIDTTGSVL 115

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT-----------VT 168
            L++ +  G RA ++ ++  + V G + P D VDV       + +               
Sbjct: 116 TLAANIQPGMRAVSVVVANDTGVAGFVLPGDRVDVNEFVEAKDARGAPEDSRRSADVFAQ 175

Query: 169 VVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVL 220
            VL  ++V+A+D   +   E     +T TLE+TP  A  L AA   A L L L
Sbjct: 176 PVLKGVKVLAVDQTFEEGLEGAYPSNTVTLEVTPQDALLLGAASRRAALGLAL 228


>gi|121607247|ref|YP_995054.1| SAF domain-containing protein [Verminephrobacter eiseniae EF01-2]
 gi|121551887|gb|ABM56036.1| SAF domain [Verminephrobacter eiseniae EF01-2]
          Length = 306

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 41/227 (18%), Positives = 99/227 (43%), Gaps = 8/227 (3%)

Query: 33  QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQE 92
           Q   +   +  + I +L++K +L  G ++    +     P +      I     P   + 
Sbjct: 41  QVAAIEARSKKETIALLVAKRELKKGDLLATGNVAVREIPLDYAHSNAI----APEHFER 96

Query: 93  LDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHV 152
           ++G  +   +  G+ +    +  R     S+ +  G+RA T+ +   +++ G+++P D +
Sbjct: 97  IEGQGIEHGLKAGEMLLWSLMQTRKAATFSARIEIGRRAITVHVDEINSISGLLEPGDAI 156

Query: 153 DVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDERV---LVGSTATLELTPMQAKALVA 209
           D+++      +K     +L N++V+A       D +       ST TL+ T  QA++++ 
Sbjct: 157 DLMVTLDRGGKK-ITFPLLQNVQVMATGQRSADDPKSGERRQYSTVTLDTTQAQAQSVIV 215

Query: 210 AQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAGVIVN 256
           A+   K++ +LR+  D    + + + +  +  +  + Q +  G    
Sbjct: 216 AREAGKITALLRNPQDTQVQAGDSAAIAALLGQAGDAQSLADGAAGR 262


>gi|37680195|ref|NP_934804.1| Flp pilus assembly protein CpaB [Vibrio vulnificus YJ016]
 gi|37198942|dbj|BAC94775.1| Flp pilus assembly protein CpaB [Vibrio vulnificus YJ016]
          Length = 279

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 48/271 (17%), Positives = 96/271 (35%), Gaps = 25/271 (9%)

Query: 8   GIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILE 67
            + V    ++   +     +     Q              VL +   LA G  +    L 
Sbjct: 5   YMAVFAALSIALFLAGFVWLDTSQAQPPSQPLSTVEHKAKVLTTNRALAKGSFIERENLV 64

Query: 68  WVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-GLSSLLP 126
           W               +     ++++ G +    I     +  E L+       LS+L+ 
Sbjct: 65  WKEVSLAERESLGEVFLQPVFELEQIAGSVAVQFIPADSVLSPEMLLRPEQSDFLSALVK 124

Query: 127 KGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP----------TVTVVLSNIRV 176
            G RA ++++   +A  G+++P + VDV++       +            V  VL NI +
Sbjct: 125 PGMRAISIELDPMAAGLGLLRPGNKVDVLLTSQSEIDQDANGTPIYNNMAVETVLQNIHL 184

Query: 177 IAID------HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           +AI          +   +    ++ T E++   A+ LV A  + +LSLVLR   D    +
Sbjct: 185 LAIGNQYSPHQKPEKSAKSYDPTSVTFEVSLQDAEKLVLASKLGELSLVLRGNNDQTEVA 244

Query: 231 SED--------SDVWDVQEEGKEIQIIKAGV 253
           ++               Q+  + + +I+  V
Sbjct: 245 NKPLKWAKDISGAYDLEQQPTQSVTVIRGNV 275


>gi|27365650|ref|NP_761178.1| Flp pilus assembly protein CpaB [Vibrio vulnificus CMCP6]
 gi|320156052|ref|YP_004188431.1| flp pilus assembly protein CpaB [Vibrio vulnificus MO6-24/O]
 gi|27361798|gb|AAO10705.1| Flp pilus assembly protein CpaB [Vibrio vulnificus CMCP6]
 gi|319931364|gb|ADV86228.1| flp pilus assembly protein CpaB [Vibrio vulnificus MO6-24/O]
          Length = 279

 Score =  139 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 48/271 (17%), Positives = 95/271 (35%), Gaps = 25/271 (9%)

Query: 8   GIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILE 67
            + V    ++   +     +     Q              VL +   LA G  +    L 
Sbjct: 5   YMAVFAALSIALFLAGFVWLDTSQAQPPSQPLSTVEHKAKVLTTNRALAKGSFIERESLV 64

Query: 68  WVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-GLSSLLP 126
           W               +     + ++ G +    I     +  E L+       LS+L+ 
Sbjct: 65  WKEVSLAERESLGEVFLQPVFELDQIAGSVAVQFIPADSVLSPEMLLRPEQSDFLSALVK 124

Query: 127 KGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP----------TVTVVLSNIRV 176
            G RA ++++   +A  G+++P + VDV++       +            V  VL NI +
Sbjct: 125 PGMRAISIELDPMAAGLGLLRPGNKVDVLLTSQSEIDQDANGTPIYNNMAVETVLQNIHL 184

Query: 177 IAID------HNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           +AI          +   +    ++ T E++   A+ LV A  + +LSLVLR   D    +
Sbjct: 185 LAIGNQYSPHQKPEKSAKSYDPTSVTFEVSLQDAEKLVLASKLGELSLVLRGNNDQTEVA 244

Query: 231 SED--------SDVWDVQEEGKEIQIIKAGV 253
           ++               Q+  + + +I+  V
Sbjct: 245 NKPLKWAKDISGAYDLEQQPTQSVTVIRGNV 275


>gi|330830433|ref|YP_004393385.1| Flp pilus assembly protein CpaB [Aeromonas veronii B565]
 gi|328805569|gb|AEB50768.1| Flp pilus assembly protein CpaB [Aeromonas veronii B565]
          Length = 296

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 54/232 (23%), Positives = 99/232 (42%), Gaps = 23/232 (9%)

Query: 28  SPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQP 87
           S    +     +  P +   VL++   +  G  + P  L W A PE    +     +   
Sbjct: 30  SGASPRDPPAESLAPDRVAQVLVAAHRVQAGSFIHPEDLRWQALPEAEERNLPGLFLFGF 89

Query: 88  NAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMI 146
              + L G LV   +  G  +  + LV    +  LS+++  G RA T+ +   +A  G+I
Sbjct: 90  TDTKALKGSLVTRTLEAGQIVSADDLVRPEQSHYLSAMMAPGMRAVTLALGREAASHGLI 149

Query: 147 KPNDHVDVVMVRSLSER----------KPTVTVVLSNIRVIAIDHNIDSDERVLVGS--- 193
           +P + VDV++    + +            +  ++L++I+++AID  + +D   L G+   
Sbjct: 150 RPGNRVDVILTSKHARQHNAQGAEVTSNQSAEIILTDIKLLAIDAQV-TDIAALNGNPAA 208

Query: 194 -------TATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWD 238
                    T EL P  A  L+ A  + +L+LVLRS     P+ S    + +
Sbjct: 209 QDNFDQVAVTFELPPRAAARLLLAHRLGELALVLRSAQ-SAPAGSPAMALPE 259


>gi|127511580|ref|YP_001092777.1| SAF domain-containing protein [Shewanella loihica PV-4]
 gi|126636875|gb|ABO22518.1| SAF domain protein [Shewanella loihica PV-4]
          Length = 298

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 50/281 (17%), Positives = 116/281 (41%), Gaps = 25/281 (8%)

Query: 1   MKLTRL----MGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLA 56
           MKL  +    + +V++ +   ++             +  + +T++     +V+++   L 
Sbjct: 1   MKLKSIDFNWVLLVIALILGGISAWATKNYFIAKEQELRDELTKDNIAMADVIVATQPLK 60

Query: 57  VGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR 116
            G +++   +       + +    I     P+   E+ G ++  P+  G P+    L   
Sbjct: 61  KGDIISQANMSVRQIRADTLPLDAIH----PSRFGEVAGQMLLQPMAPGRPLIETYLPGM 116

Query: 117 GNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT---VVLSN 173
                S +L +G+RA T+DI   ++  GM+ P+DH+D+++      R        ++L +
Sbjct: 117 RVAQFSDILKEGQRAVTIDIDEINSSAGMLVPSDHIDLLLSFKEEGRNGERKRLQLLLED 176

Query: 174 IRVIAIDHN-IDSD--------ERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
           + V+A     ID +        +     +T TL L+   A  +  A+       +LR+  
Sbjct: 177 VTVLATGRRSIDVNPELVDTLYDNPNAYNTVTLALSVNDAARVSLAKQKGDFVTLLRNQK 236

Query: 225 DLNPS---SSEDSDVWDVQEEGKE--IQIIKAGVIVNKDGE 260
           + +     S  +  +++ +EE  E  +++I  G  +    +
Sbjct: 237 ESSALEFISMHEGQLFNREEENHELAVEVITGGSGIKTSTQ 277


>gi|167620126|ref|ZP_02388757.1| Flp pilus assembly protein CpaB family [Burkholderia thailandensis
           Bt4]
          Length = 234

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 51/235 (21%), Positives = 93/235 (39%), Gaps = 34/235 (14%)

Query: 43  AKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNA------------- 89
            + + V ++  DL  G+++    L W      +V  G + +                   
Sbjct: 1   PQQVRVRVAAADLPAGLLLRDVDLGWKTMARGDVPAGALIEGDARGDGRTAGAAVDASAA 60

Query: 90  -MQELDGVLVRVPILKGDPIRLEKLV-DRGNGGLSSLLPKGKRAATMDISISSAVGGMIK 147
              +L G L+R P+ +G P+    ++     G L++ L  G RA ++ I   S   G+I+
Sbjct: 61  AAGDLKGDLLRHPVREGMPLGPADVILPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIE 120

Query: 148 PNDHVDVVMVRSL---------SERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVGS 193
           P D+VDV++ + L          ER      + + +RV+A+         D+ +      
Sbjct: 121 PGDYVDVLLTQQLAAPGGAPADPERAVESETIAARVRVLAVGSAFQRPKDDAAQPNTRAR 180

Query: 194 TATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQI 248
           T T E++   A+ +     +  LSL LRS A     +S+   V     E     +
Sbjct: 181 TVTFEVSSHDAQVITVGAHLGALSLALRSFA-----TSDRGAVGLASAEPPAPPV 230


>gi|227326301|ref|ZP_03830325.1| hypothetical protein PcarcW_02899 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 314

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 54/275 (19%), Positives = 103/275 (37%), Gaps = 44/275 (16%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK+     +  + V A +  ++    +S        V+ + P     VL++  DL  G  
Sbjct: 1   MKVNSTYVLSGALVLAGIVALMVRSHLSSEPPAPPPVVVKAPEPT-KVLVAAKDLHPGDF 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           +  + L W     E       + V+  +    L G  +R P+ +G  +    +V+    G
Sbjct: 60  LDSSSLRWQE--TEKSVSRAFNFVYGQDKQSLLLGATLREPVKEGSWLSSNVVVNPNEPG 117

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP-------------- 165
            ++++L KG RA ++  S  ++  G++   D VDV++     ++                
Sbjct: 118 FVAAVLRKGMRAISVPTSAIASNAGLVSAGDRVDVILSMKRDDQSELPASRNQPVVMPLL 177

Query: 166 TVTVVLSNIRVIAIDHNIDS--------------------------DERVLVGSTATLEL 199
               ++ ++RV+A++    +                            R     T TLE+
Sbjct: 178 ASQTIVRDLRVLALNDKTGTPVYPRFDTAEDGTVLDATAKSRESAVRSRPATYQTVTLEV 237

Query: 200 TPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           TP QA+AL  A+ +  L L LRS    +       
Sbjct: 238 TPQQAEALAVAKELGILHLALRSADLDDSVDPATG 272


>gi|301165541|emb|CBW25112.1| putative pilus assembly-related protein [Bacteriovorax marinus SJ]
          Length = 271

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 56/272 (20%), Positives = 112/272 (41%), Gaps = 30/272 (11%)

Query: 12  SGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAF 71
           +   AL+  + AM +V  +    +  I +   K  +V+I+K D+    ++  + +   + 
Sbjct: 5   ALTLALIIAVFAMFMVYTYIDDEKTKIIKKYGKEQSVVIAKVDIKELELIDDSKVTVTSM 64

Query: 72  PEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-GLSSLLPKGKR 130
           P   V +     +      +E+   +  VPILKG+ I   ++       GLS  +  GKR
Sbjct: 65  PSNFVHEKAFKTI------KEIQNTVATVPILKGEQITKPRVSWPDERSGLSRQVAVGKR 118

Query: 131 AATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT---VTVVLSNIRVIAIDHNIDSDE 187
           A ++D+S  ++VG +IKP D VD++     +  +     +  +L ++ +++   +I  + 
Sbjct: 119 AISLDVSERASVGKLIKPGDRVDILAGIDYAGGRKDLQKMKTILQDVLILSTGKSISGNL 178

Query: 188 RVLVGS-----------------TATLELTPMQAKALV--AAQSVAK-LSLVLRSIADLN 227
            ++                    T TLEL P + + LV   + +      L LR+  D  
Sbjct: 179 PIIGVKTPRVIKKMKLNTYSDYGTVTLELDPYEVQKLVFILSYNSGTPPYLALRNNTDKE 238

Query: 228 PSSSEDSDVWDVQEEGKEIQIIKAGVIVNKDG 259
               + + ++D+  E      I         G
Sbjct: 239 VVRIKSTKLFDILGEDASEAKIFFSEKYKSQG 270


>gi|117619605|ref|YP_855990.1| Flp pilus assembly protein CpaB [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117561012|gb|ABK37960.1| Flp pilus assembly protein CpaB [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 296

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 57/236 (24%), Positives = 100/236 (42%), Gaps = 25/236 (10%)

Query: 23  AMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFID 82
           A +   P   Q  E      A+   VL++   +  G  + P  L W   P     +    
Sbjct: 27  APQTAVPPGEQAPE--PAASARLAQVLVAAHRVQAGAFIHPEDLVWQTLPAAEEMNLPGL 84

Query: 83  DVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSA 141
            +      + L G LV   +  G  +  + LV    +  LS+++  G RA T+ +   +A
Sbjct: 85  FLFGFTDTKALKGSLVTRTLEAGQIVSADDLVRPEQSHYLSAMMAPGMRAVTLALGREAA 144

Query: 142 VGGMIKPNDHVDVVMVRSLSER----------KPTVTVVLSNIRVIAIDHNIDSDERVLV 191
             G+I+P + VDV++    + +          K +  ++L++I+++AID  + +D   L 
Sbjct: 145 SHGLIRPGNRVDVILTSKHTHQRNAQGAEVTSKQSAEIILTDIKLLAIDAQV-TDIAALN 203

Query: 192 GS----------TATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVW 237
           G+            T EL P  A  L+ A  + +L+LVLRS     P+ SE   + 
Sbjct: 204 GTVAAQDNFDQVAVTFELAPSAAARLLLAHRLGELALVLRSAQ-AAPTGSEAVTLP 258


>gi|332798621|ref|YP_004460120.1| Flp pilus assembly protein CpaB [Tepidanaerobacter sp. Re1]
 gi|332696356|gb|AEE90813.1| Flp pilus assembly protein CpaB [Tepidanaerobacter sp. Re1]
          Length = 264

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 49/273 (17%), Positives = 97/273 (35%), Gaps = 46/273 (16%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +K  RL+ ++ + V  +   +I   L     +          +K I V+ +  ++A    
Sbjct: 3   LKKIRLIALIAALVTCISLYLIVSNLQKGGSIALN-------SKTITVVTATQNIAPYTK 55

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG- 119
           +T  ++        +    +         + ++ G + +  I  G+ I   ++    +  
Sbjct: 56  ITAEMVSAQNITASDGIQNYFT------QIGDVVGKICKSDIYAGEVITSNRIAGEKDIS 109

Query: 120 -GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVT---------- 168
            GL++ L  G RA T+ + +   V   IK  ++VDV+ V  +       T          
Sbjct: 110 LGLATQLENGMRAVTIAVDVEQGVAATIKAGNYVDVIYVNKVDGGSGDTTASSYLNSAAG 169

Query: 169 --------------------VVLSNIRVIAIDHNIDSDERVLVGSTATLELTPMQAKALV 208
                                 L N++V+A+D+    D+      + TL +TP QA  L 
Sbjct: 170 AKNPVNSQTLYHNYGQYFAVTALQNVKVVALDNVFYKDDTKTSYQSVTLGVTPEQAAQLA 229

Query: 209 A-AQSVAKLSLVLRSIADLNPSSSEDSDVWDVQ 240
                   + L LR   D    S    +V++  
Sbjct: 230 LMCDGEGTIRLSLRPQEDKTMISEPRGEVFENT 262


>gi|261820213|ref|YP_003258319.1| Flp pilus assembly protein CpaB [Pectobacterium wasabiae WPP163]
 gi|261604226|gb|ACX86712.1| Flp pilus assembly protein CpaB [Pectobacterium wasabiae WPP163]
          Length = 312

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 59/265 (22%), Positives = 104/265 (39%), Gaps = 44/265 (16%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK+     +  + V A +  ++    +S        V+ + P K   VL++  DL  G  
Sbjct: 1   MKVNSTYVLSGALVLAGIVALVVRSHLSSAPPPPPPVVVQAPEKTA-VLVAAKDLHPGDF 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           +    L W    EE V     + V   ++   L G  +R  + +G  +    LV +   G
Sbjct: 60  IDSASLRWQ-VTEEPV-SRTFNFVRGKDSQSLLFGATLRETVTEGSALTNNVLVRQNEPG 117

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP-------------- 165
            L+++L KGKRA ++  S  ++  G++   D VDV++     ++                
Sbjct: 118 FLAAVLGKGKRAISVPTSAVASNAGLVAAGDRVDVILSMKRDDQPELPASRNQPVVMPLL 177

Query: 166 TVTVVLSNIRVIAIDHNIDS--------------------------DERVLVGSTATLEL 199
               ++ ++RV+A++    +                            R     T TLE+
Sbjct: 178 ASQTIVRDLRVLALNDRTGTPVYPRLDAMEDGATLDAAAKSRESAVRSRPATYQTVTLEV 237

Query: 200 TPMQAKALVAAQSVAKLSLVLRSIA 224
           TP QA+AL  A+ +  L L LRS  
Sbjct: 238 TPQQAEALAVAKELGILHLALRSAT 262


>gi|227114875|ref|ZP_03828531.1| hypothetical protein PcarbP_18020 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 314

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 59/310 (19%), Positives = 112/310 (36%), Gaps = 55/310 (17%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK+     +  + V A +  ++    +S        V+ + P K   VL++  DL  G  
Sbjct: 1   MKVNSTYVLSGALVLAGIVALMVRSHLSSEPPAPPPVVVKAPEK-AAVLVAAKDLHPGDF 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           + P+ L W     +       + V   +    L G  +R  + +G  +    +V     G
Sbjct: 60  IDPSSLRWQT--TDEPVSRSFNFVRGQDNQSLLLGATLRETVTQGSWLSSNVVVKPNEPG 117

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP-------------- 165
            ++++L KG RA ++  S  ++  G++   D VDV++     ++                
Sbjct: 118 FVAAVLHKGMRAISVPTSAIASNAGLVSAGDRVDVILSMRRDDQSELPASRNQPVVMPLL 177

Query: 166 TVTVVLSNIRVIAIDHNIDS--------------------------DERVLVGSTATLEL 199
               ++ ++RV+A++    +                            R     T TLE+
Sbjct: 178 ASQTIVRDLRVLALNDKTGTPIYPRFDAAEDGTVLDATAKSRESAVRSRPATYQTVTLEV 237

Query: 200 TPMQAKALVAAQSVAKLSLVLRSIADLNPSSSE-----------DSDVWDVQEEGKEIQI 248
           TP QA+AL  A+ +  L L LRS    +                 +D++     G   + 
Sbjct: 238 TPQQAEALAVAKELGILHLALRSADLDDVVDPTTGRPHVTTVPLATDIYGAFSAGSGERK 297

Query: 249 IKAGVIVNKD 258
           +K      KD
Sbjct: 298 VKIYRAAQKD 307


>gi|113867003|ref|YP_725492.1| flp pilus assembly protein CpaB [Ralstonia eutropha H16]
 gi|113525779|emb|CAJ92124.1| flp pilus assembly protein CpaB [Ralstonia eutropha H16]
          Length = 343

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 54/256 (21%), Positives = 104/256 (40%), Gaps = 27/256 (10%)

Query: 16  ALVAGIIAMRLVSPHHVQTEEVITE-NPAKFINVLISKGDLAVGMVVTPNILEWVAFPEE 74
            L+   I   L        E++  + N  + + V++   + A G V+  N       P +
Sbjct: 26  GLLTLWIYHFLSGREAALKEQLAAQLNEGRRVAVMVPVRNAAPGTVIDGNGFAAREIPAD 85

Query: 75  NVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATM 134
            V++  I      ++  ++  + +   + +G P+R   +    +   S LL  GKRA T+
Sbjct: 86  LVYEDMI----LASSFDKVANLRLVRQVRQGQPVRRADVEALQSRDFSDLLKPGKRAFTI 141

Query: 135 DISISSAVGGMIKPNDHVDVVMVRS-----LSERKPTVTVVLSNIRVIAIDHNIDSDERV 189
           ++ + ++   M+KP +HVD+ ++ S         K T  +++S++ V+A   ++   +  
Sbjct: 142 EVDMVNSTAKMLKPGNHVDLFLISSTSPTAAGTDKQTARLLMSDMLVLATGQDVRPRDYG 201

Query: 190 LV-----------------GSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSE 232
                                + TL ++P QA  L  AQ V  L  VLR+ AD   +   
Sbjct: 202 EAMAAQAAEGAEGVDTNPDYDSLTLMVSPEQAARLALAQKVGSLRAVLRNAADKTATPQI 261

Query: 233 DSDVWDVQEEGKEIQI 248
                 +   G E  I
Sbjct: 262 AVSEHALFAGGDEAAI 277


>gi|296134297|ref|YP_003641544.1| Flp pilus assembly protein CpaB [Thermincola sp. JR]
 gi|296032875|gb|ADG83643.1| Flp pilus assembly protein CpaB [Thermincola potens JR]
          Length = 257

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 53/264 (20%), Positives = 102/264 (38%), Gaps = 43/264 (16%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   ++  + V+   AL+  +     +         V T+       V+++  ++    V
Sbjct: 1   MSNKKI--LFVAVFLALLTTLAMNYYLEQVKKAATNVTTKK------VVVANVNIPARTV 52

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-- 118
           +T +++     PEE V    + D       +++ G +    I  G+ +  EK++ +    
Sbjct: 53  ITGDMVSVKDVPEEFVHPNAVLDE------EQVIGFVSGSDISAGEQVLREKILRKEGNP 106

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP------------T 166
             LS  +P G RA ++ I+  + VGG+++P D VDV+    L    P             
Sbjct: 107 VSLSYQVPLGSRAMSVPINEVTGVGGLVRPGDRVDVIGTIELETSNPASNQQTGPTQTTV 166

Query: 167 VTVVLSNIRVIAIDHN---------------IDSDERVLVGSTATLELTPMQAKALVAAQ 211
             V+L N+ V+A+  N                 +++        TL +   + +AL    
Sbjct: 167 AHVLLQNVEVLAVGDNFTPATNRAVNQGKEDAKNNQSDTGAKNVTLAIPADKMQALTLML 226

Query: 212 SVAKLSLVLRSIADLNPSSSEDSD 235
              K++L LRS  D +       D
Sbjct: 227 DHGKVTLALRSPLDQSRYDRPPFD 250


>gi|253687067|ref|YP_003016257.1| Flp pilus assembly protein CpaB [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251753645|gb|ACT11721.1| Flp pilus assembly protein CpaB [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 314

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 53/272 (19%), Positives = 104/272 (38%), Gaps = 44/272 (16%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK+     +  + V A +  ++    +S        V+ + P K I VL++  DL  G  
Sbjct: 1   MKVNSTYVLSGAFVLAGIVALVVRSHLSSEPPAPPPVVAKAPEK-IAVLVAAKDLHPGDF 59

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN-G 119
           +  + + W     +       + V   ++   L G  +R  + +G  +    +V     G
Sbjct: 60  IDSSSVRWQT--TDESVSRSFNFVRGRDSQFLLFGATLRETVKEGTQLSSNVVVKPNEPG 117

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP-------------- 165
            ++++L KG RA ++  S  ++  G++   D VDV++     ++                
Sbjct: 118 FVAAVLHKGMRAISVPTSAIASNAGLVSAGDRVDVILSMRRDDQSELPVSRNQPVVMPLL 177

Query: 166 TVTVVLSNIRVIAIDHNIDS--------------------------DERVLVGSTATLEL 199
               ++ ++RV+A++  + +                            R     T TLE+
Sbjct: 178 ASQTIVRDLRVLALNDKVGTPVYPRLDAMEDGAALDAAAKSRESAVRSRPATYQTVTLEV 237

Query: 200 TPMQAKALVAAQSVAKLSLVLRSIADLNPSSS 231
           TP QA+AL  A+ +  L L LRS    +    
Sbjct: 238 TPQQAEALTVAKELGILHLSLRSATQDDVVDP 269


>gi|304311184|ref|YP_003810782.1| Flp pilus assembly protein [gamma proteobacterium HdN1]
 gi|301796917|emb|CBL45130.1| Flp pilus assembly protein [gamma proteobacterium HdN1]
          Length = 283

 Score =  131 bits (330), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 50/216 (23%), Positives = 88/216 (40%), Gaps = 14/216 (6%)

Query: 21  IIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGF 80
            +    +     Q  + I +   + I V+++  DL +G VVT         P+  V    
Sbjct: 26  FLTQNYIKTEVTQRNKAIDQQ-REAIQVVVASADLNIGDVVTLKNAVVRDIPKTFVPSEA 84

Query: 81  IDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISS 140
           +      N    L+G  ++  +  G+ I    +      G+ SLL  G+RA T+ +    
Sbjct: 85  VT---PANFAATLEGRQLKYKVKYGEVILPMHVSSTKIEGIVSLLEPGERAITIPVGKED 141

Query: 141 AVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNI---------DSDERVLV 191
            + G ++P   VD+ +         T    L  ++VIA    +         D  +    
Sbjct: 142 TISGFLRPGSRVDLFLTLKDGAVSRTA-PFLQRVKVIATGTELNDGIPRELKDPKKLQKT 200

Query: 192 GSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLN 227
            S  TL +TP+QA  L+ +QSV  +++VLR   D +
Sbjct: 201 FSDVTLAVTPVQATKLIHSQSVGDIAMVLRRPEDKS 236


>gi|307726634|ref|YP_003909847.1| Flp pilus assembly protein CpaB [Burkholderia sp. CCGE1003]
 gi|307587159|gb|ADN60556.1| Flp pilus assembly protein CpaB [Burkholderia sp. CCGE1003]
          Length = 365

 Score =  131 bits (330), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 46/268 (17%), Positives = 105/268 (39%), Gaps = 31/268 (11%)

Query: 7   MGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPA-KFINVLISKGDLAVGMVVTPNI 65
           + +  +   A     +  + ++    + ++ I  N     + V++   DL  G  ++ + 
Sbjct: 16  VLLFAAVCVAGGLTFLLYKYLNEREARLKQQIAANKVHDAVQVVVPARDLPAGTPLSSSD 75

Query: 66  LEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLL 125
                   + V     DD+ +P+  ++     +  P+ +G P+R   +        S +L
Sbjct: 76  FVSREIQGDLV----YDDMIRPDNFEQYRTSHLVKPVRRGLPLRAGDIDALRGRDFSDIL 131

Query: 126 PKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL------SERKPTVTVVLSNIRVIAI 179
           P G+RA T++I   ++   +++P + VDV  +         S+ +    +++ N+ V+A 
Sbjct: 132 PAGQRAVTVEIDTVNSTALLVRPGNRVDVYWIGKAFHQDRTSDDQRVAQLIMPNVLVLAT 191

Query: 180 DHNI---------DSDERVLVGS-----------TATLELTPMQAKALVAAQSVAKLSLV 219
             ++         + D+     S           T TL++    A  +  AQ +  L L+
Sbjct: 192 GQDLRPRDAGEASEQDQANANSSAMSRQQGMGYTTVTLQVPAEDAGRIALAQKIGGLRLI 251

Query: 220 LRSIADLNPSSSEDSDVWDVQEEGKEIQ 247
           LR+  D   +    ++  DV  +     
Sbjct: 252 LRNADDKASAGPVLTEEQDVFADPATFN 279


>gi|330819175|ref|YP_004348037.1| Flp pilus assembly protein CpaB [Burkholderia gladioli BSR3]
 gi|327371170|gb|AEA62525.1| Flp pilus assembly protein CpaB [Burkholderia gladioli BSR3]
          Length = 354

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 54/276 (19%), Positives = 108/276 (39%), Gaps = 34/276 (12%)

Query: 6   LMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNI 65
           L+GI V+    +        LVS   ++  E         ++V++ + D+  G  +   +
Sbjct: 18  LIGIAVAAAGGITWVTYRYMLVSEARIKA-EAAERREGPGVSVVVPRADVPAGTPLDSAV 76

Query: 66  LEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLL 125
                   + V     DD+ Q +        ++  P+ +G P+RL+ +        S  L
Sbjct: 77  FVAREISADLV----YDDMLQVDDFTHHRNAVLVKPVRRGRPLRLQDVDATRARDFSDTL 132

Query: 126 PKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLS---------ERKPTVTVVLSNIRV 176
             G RA T+ I   ++   M++P + VD+  V +LS             ++ +++  +RV
Sbjct: 133 AAGMRALTLPIDAINSTDSMLRPGNRVDLYWVGTLSFVTRGGDPAGDTKSIRLLMPGVRV 192

Query: 177 IAIDHNIDSDERVLVGS------------TATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
           +A  H++   +                  T TL++   +A  +  AQ +  L LVLR+  
Sbjct: 193 LATGHDVRPRDAGEAARDMADGARRDGYGTVTLQVPVAEAARIALAQKLGGLRLVLRNSK 252

Query: 225 DLNPSSSEDSDVWDVQ--------EEGKEIQIIKAG 252
           D         D  ++         ++ + ++II  G
Sbjct: 253 DPGDPVQRGLDETELFAARADAPADDRERVEIITGG 288


>gi|313902402|ref|ZP_07835805.1| Flp pilus assembly protein CpaB [Thermaerobacter subterraneus DSM
           13965]
 gi|313467333|gb|EFR62844.1| Flp pilus assembly protein CpaB [Thermaerobacter subterraneus DSM
           13965]
          Length = 236

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 54/245 (22%), Positives = 107/245 (43%), Gaps = 17/245 (6%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   R++  ++  V A +A  I +                     + V+++   +     
Sbjct: 1   MSRGRMVRYLLLPVLAGLAVTILVAF-----YVRVPAGEAGKEPRVPVVVATRPVPAQTP 55

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD-RGNG 119
           +  ++L     P + V  G +  +      +E  G + +VP+ +G+ +   KL    G+ 
Sbjct: 56  LQADMLAVRQVPADVVGRGAVGRI------EEAVGKVTKVPLAEGEFVLTSKLARGDGSD 109

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVM---VRSLSERKPTVTVVLSNIRV 176
           GL+  LP+G RA T+      AVGG ++P D VDV++          +P   +++ N+ V
Sbjct: 110 GLAYRLPEGTRALTIAADPVLAVGGFVQPGDRVDVLIGLPGGKPGVEQPEARILVENVLV 169

Query: 177 IAIDHNIDSDERVLVG--STATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           +A+  +  ++        +  TL + P  A A+V A+   +L L+LR   D  P+ +  +
Sbjct: 170 LAVQQDTAAEGEPAGDGLTHLTLAVAPAHAAAIVLAEQEGRLRLLLRPAGDGRPAGAVTA 229

Query: 235 DVWDV 239
            + D+
Sbjct: 230 RLADL 234


>gi|319940439|ref|ZP_08014784.1| hypothetical protein HMPREF9464_00003 [Sutterella wadsworthensis
           3_1_45B]
 gi|319806065|gb|EFW02814.1| hypothetical protein HMPREF9464_00003 [Sutterella wadsworthensis
           3_1_45B]
          Length = 321

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 61/288 (21%), Positives = 116/288 (40%), Gaps = 44/288 (15%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINV-----LISKGDLA 56
           K + L+ +  + V A  A  +A  L++PH  +      +  A    V       +   + 
Sbjct: 4   KTSSLLLLGFAVVLAGCAAFVARGLLAPHAAERPAAAAQAKASEAQVPPVWAAAAAKPVE 63

Query: 57  VGMVVTPNILEWVAFPEENVFDGFIDDVHQPN--AMQELDGVLVRVPILKGDPIRLEKLV 114
            G  ++   ++WV    +      I      +  A   L G  VR  + +G+ I  + ++
Sbjct: 64  PGEFLSGTAIKWVEMKADEAPASAISAKRPGDRTAAALLMGATVRRSVPQGELITQDDVL 123

Query: 115 DRGN-GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV--------------RS 159
             GN G L+++L  GKRA ++  S  S+  G++   D VDV++               ++
Sbjct: 124 YPGNPGFLAAVLSPGKRAVSIPTSAVSSNSGLVSAGDWVDVILTLKRETAEAMADQQDKT 183

Query: 160 LSERKPTVTVVLSNIRVIAID--------------HNIDSDERVLVG------STATLEL 199
               K     +L+N+RV+A++                 D+ +            T TLE+
Sbjct: 184 SGMTKLAAQTILTNVRVLALNNSTESIAPQPETAPQKTDAKKTASTAARRVDYRTITLEV 243

Query: 200 TPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQ 247
           TPM+A+AL  A+    L + +R +    P + + +    V E+   + 
Sbjct: 244 TPMEAQALAVAKEAGDLQVSIRGL--REPETKDAAGTSAVNEKTAAVT 289


>gi|119773844|ref|YP_926584.1| Flp pilus assembly protein CpaB-like protein [Shewanella
           amazonensis SB2B]
 gi|119766344|gb|ABL98914.1| Flp pilus assembly protein CpaB-like protein [Shewanella
           amazonensis SB2B]
          Length = 298

 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 44/246 (17%), Positives = 100/246 (40%), Gaps = 20/246 (8%)

Query: 1   MKLTRL----MGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLA 56
           M+  R+    + + ++ V   +A             +    ++ +  K ++V+++  +L 
Sbjct: 1   MQSKRIDFNWVLLGIALVLGSLAAWATKNYFIVKEQEIRAELSNSNVKMVDVVVATQELR 60

Query: 57  VGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR 116
            G +V    +   +   + +    I    +P+   E+ G ++   +  G P+    L   
Sbjct: 61  KGDIVDETNMSVRSIRADVIPLDAI----RPSQFNEVAGQMLLSEMSPGRPLISAYLPGF 116

Query: 117 GNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT---VTVVLSN 173
                S LL +G+RA T+DI+  ++  GM+ P+D VD+ +  ++         + +++  
Sbjct: 117 KTRQFSDLLQEGQRAVTIDINEENSTAGMLVPSDLVDLFLSYTVENGDSERVKMELLIEK 176

Query: 174 IRVIAIDHNI---------DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
            +V+A                 +     +T TL L+   A  +  A+   K   +LR+ A
Sbjct: 177 AQVLATGKRSIDVHPELVNSIYDNPDSYNTVTLALSTEDAIRVSLAKGRGKFVTLLRNKA 236

Query: 225 DLNPSS 230
           +  P +
Sbjct: 237 ESAPVA 242


>gi|297581607|ref|ZP_06943529.1| flp pilus assembly protein CpaB [Vibrio cholerae RC385]
 gi|297534014|gb|EFH72853.1| flp pilus assembly protein CpaB [Vibrio cholerae RC385]
          Length = 294

 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 57/268 (21%), Positives = 112/268 (41%), Gaps = 27/268 (10%)

Query: 20  GIIAMRLVSPHHVQTEEVITENPA--------KFINVLISKGDLAVGMVVTPNILEWVAF 71
            I+++  +      T   +++  A             L +K  +  G ++      WV  
Sbjct: 16  AILSIAWMQNSRPSTSPSVSKPTAVSSLPEKAATPRALAAKYPVQAGALLRAQDFHWVEL 75

Query: 72  PEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKR 130
             E+        +   + +  L+G L+     +   + +  ++    +  +S++L  GKR
Sbjct: 76  GSEHNASLNDLFLENFSQLDALEGSLITRHQDESQLLNVNDIIRPEQSHYVSAMLAPGKR 135

Query: 131 AATMDISISSAVGGMIKPNDHVDVVMV-----RSLSERKPTVTVVLSNIRVIAID----- 180
           A T++++ +    G+++P + VDVV+       S S  K   T VL  +R++AI      
Sbjct: 136 AVTLELTQAGVSHGLLRPGNWVDVVLTNESNVESASTPKYAATTVLEGVRLLAIGSVVTE 195

Query: 181 ----HNIDSDERVLVGST--ATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
                ++++            T E++P  AK L+ AQ +  LSLVLRS  + + +  E+ 
Sbjct: 196 FIAKQSVENGANPNSYEPVRVTFEVSPSDAKHLLLAQRLGVLSLVLRSQFESDLAEMEEG 255

Query: 235 DV-WDVQ-EEGKEIQIIKAGVIVNKDGE 260
            + WD Q  E    + +    +   DGE
Sbjct: 256 SILWDEQVSESFNPESLPRKTVRIFDGE 283


>gi|296158513|ref|ZP_06841343.1| Flp pilus assembly protein CpaB [Burkholderia sp. Ch1-1]
 gi|295891081|gb|EFG70869.1| Flp pilus assembly protein CpaB [Burkholderia sp. Ch1-1]
          Length = 365

 Score =  126 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 50/286 (17%), Positives = 110/286 (38%), Gaps = 44/286 (15%)

Query: 7   MGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAK-FINVLISKGDLAVGMVVTPNI 65
           + + ++ + A     +  + ++    + +  +  +  +  + V++   D  VG  ++   
Sbjct: 16  VLLFLAVLVAGGLTFLLYKYLNDREKKLKADLDAHRVRAGVTVVVPAQDAPVGTPLSSGN 75

Query: 66  LEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLL 125
                   + V     DD+ + +  ++     +  P+ +G P+R   +        S +L
Sbjct: 76  FVAREIAGDLV----YDDMIRADGFEQYRSSHLVKPVRRGLPLRAGDIDALRGRDFSDIL 131

Query: 126 PKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL------SERKPTVTVVLSNIRVIAI 179
             G RA T++I   ++   +++P + VDV  V  +      S+ K    +V+ N+ V+A 
Sbjct: 132 RPGTRALTVEIDTVNSTALLLRPGNRVDVYWVGKVFHENRTSDEKKVAQLVMPNVLVLAT 191

Query: 180 DHN---------IDSDERVLVGS-----------TATLELTPMQAKALVAAQSVAKLSLV 219
             +            D+     S           T TLE+       +  AQ +  L L+
Sbjct: 192 GEDMRPRDAGEAAQQDQANANSSAMSRQTGMGYTTVTLEVPVDDVARIALAQKIGGLRLI 251

Query: 220 LRSIAD---LNPSSSEDSDVW----------DVQEEGKEIQIIKAG 252
           LR+  D     PS +++SDV+                + +++I  G
Sbjct: 252 LRNSEDKGADGPSLAQESDVFIDPARGHVTSGTGPAPQTVEVISGG 297


>gi|323529160|ref|YP_004231312.1| Flp pilus assembly protein CpaB [Burkholderia sp. CCGE1001]
 gi|323386162|gb|ADX58252.1| Flp pilus assembly protein CpaB [Burkholderia sp. CCGE1001]
          Length = 363

 Score =  124 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 44/267 (16%), Positives = 100/267 (37%), Gaps = 31/267 (11%)

Query: 7   MGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKF-INVLISKGDLAVGMVVTPNI 65
           + + V+   A     +  + ++    + +  I  N  +  I V++   DL  G  ++ + 
Sbjct: 16  VLLFVAVCVAGGLTFLLYKYLNERETKLKAEIAANKVRTDIAVVVPARDLPAGTPLSSSD 75

Query: 66  LEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLL 125
                   + V     DD+ +P    +     +  P+ +G P+R   +        S +L
Sbjct: 76  FVSREIQGDLV----YDDMVRPENFDQYRASHLVKPVRRGLPLRAADIDALHGRDFSDVL 131

Query: 126 PKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL------SERKPTVTVVLSNIRVIAI 179
           P G+RA T++I   ++   +++P + VDV  +         S+ +    +++++  V+A 
Sbjct: 132 PAGQRAVTVEIDTVNSTALLLRPGNRVDVYWIGKAFHQDHTSDDRRVAQLMMADALVLAT 191

Query: 180 DHNIDSDERVLVG--------------------STATLELTPMQAKALVAAQSVAKLSLV 219
             ++   +                         +T TL++       +  AQ +  L L+
Sbjct: 192 GQDLRPRDAGEAAEHDQANANSSAMSRQEGMGYTTVTLQVPAEDVGRIALAQKIGGLRLI 251

Query: 220 LRSIADLNPSSSEDSDVWDVQEEGKEI 246
           LR+  D         +  DV  +   +
Sbjct: 252 LRNADDKATGGPALVEEKDVFIDPANV 278


>gi|91777218|ref|YP_552426.1| putative Flp pilus assembly CpaB [Burkholderia xenovorans LB400]
 gi|91689878|gb|ABE33076.1| Putative Flp pilus assembly CpaB [Burkholderia xenovorans LB400]
          Length = 363

 Score =  124 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 51/268 (19%), Positives = 108/268 (40%), Gaps = 34/268 (12%)

Query: 7   MGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAK-FINVLISKGDLAVGMVVTPNI 65
           + + ++ + A     +  + ++    + +  +  +  +  + V++   D+ VG  ++   
Sbjct: 16  VLLFLAVLVAGGLTFLLYKYLNDREKKLKADMDAHRVRAGVTVVVPAQDVPVGTPLSSGD 75

Query: 66  LEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLL 125
                   + V     DD+ + +  ++     +  P+ +G P+R   +        S +L
Sbjct: 76  FVAREIAGDLV----YDDMIRADNFEQYRSSHLVKPVRRGLPLRAGDIDALRGRDFSDVL 131

Query: 126 PKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSL------SERKPTVTVVLSNIRVIAI 179
             G RA T++I   +A   +++P +HVDV  V  +      S+ K    +V+ N+ V+A 
Sbjct: 132 RPGTRALTVEIDTVNATALLLRPGNHVDVYWVGKVFHEDHTSDEKKVAQLVMPNVLVLAT 191

Query: 180 DHN---------IDSDERVLVGS-----------TATLELTPMQAKALVAAQSVAKLSLV 219
             +            D+     S           T TLE+       +  AQ +  L L+
Sbjct: 192 GEDMRPRDAGEAAQQDQANANSSAMSRQAGMGYTTVTLEIPVDDVARVALAQKIGGLRLI 251

Query: 220 LRSIAD---LNPSSSEDSDVWDVQEEGK 244
           LR+  D     PS +++SDV+     G+
Sbjct: 252 LRNSEDKGADGPSLAQESDVFIDPARGR 279


>gi|51468905|emb|CAE47778.1| pilus assembling protein [Bdellovibrio bacteriovorus]
          Length = 314

 Score =  123 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 50/259 (19%), Positives = 103/259 (39%), Gaps = 31/259 (11%)

Query: 15  FALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEE 74
            ++ AG+ A  L+  +  + +    +       V+++K D+A    +   ++E    P +
Sbjct: 24  LSIAAGVFATFLLYSYSQEKKAEYDKRFGSTKRVVVAKEDIAEMQTIYDTMVETKELPAD 83

Query: 75  NVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAAT 133
            +    I          E+ G +  VPI KG  +    L+  G + G+S  +   KRA T
Sbjct: 84  FIQPDAIT------IPDEIIGNVAAVPIRKGQMVVKNNLLTPGPDTGISLQVAPSKRAVT 137

Query: 134 MDISISSAVGGMIKPNDHVDVVMVRSLS---ERKPTVTVVLSNIRVIAIDHNI------- 183
           + +     V  +I+P D +D+           ++  V  +++++ V+A   ++       
Sbjct: 138 IPVDEVRGVAKLIRPGDRIDIYAAVDSGKGVNQRREVFTMMNDVVVLATGVSVVNNIPRM 197

Query: 184 ---DSDERVLV---------GSTATLELTPMQAKAL--VAAQSVAKLSLVLRSIADLNPS 229
              DS  + L           +T T+E TP +A+ L  + + +   L + LR+ +D    
Sbjct: 198 FELDSTGKNLTQIALTGDTKYTTITVEATPKEAQDLFYILSTAPGNLFMALRNPSDRTIP 257

Query: 230 SSEDSDVWDVQEEGKEIQI 248
               S   D       + +
Sbjct: 258 PRMPSSTSDSVLGKPMVSV 276


>gi|325111215|ref|YP_004272283.1| Flp pilus assembly protein CpaB [Planctomyces brasiliensis DSM
           5305]
 gi|324971483|gb|ADY62261.1| Flp pilus assembly protein CpaB [Planctomyces brasiliensis DSM
           5305]
          Length = 349

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 50/243 (20%), Positives = 90/243 (37%), Gaps = 25/243 (10%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           +    +  I++  +  L+A  I            +E+ T        V ++  D+  G +
Sbjct: 4   LTPAFITLIMLIVIGGLIAVYIGKSFFYTEPAPPQEISTRL------VPMAGSDIPAGTL 57

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +T + +         + +  +      N  + + G      I +  PI    L   G   
Sbjct: 58  ITSDHIV-----RGRLREDKMTRETILND-EAIIGRYSLTDIKQAQPILTSDLYAPGER- 110

Query: 121 LSSLLPKGKRAATMDISISSAV-GGMIKPNDHVDVVMVRSLS-----ERKPTVTVVLSNI 174
               L  G +A T+ +  S++V  G+I+P D+VDV +  S        R      V   I
Sbjct: 111 PPLELEPGMQAVTVSLGDSTSVVDGLIEPGDYVDVHLTVSDDLSDSRYRGGFTMTVFKGI 170

Query: 175 RVIAIDHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           RV+A++            +T T ELTP Q+  ++ AQ    +++        NP    D 
Sbjct: 171 RVLAMNRLTQPTNISRGANTVTFELTPSQSNIILEAQRHGTITVS------YNPDGPGDG 224

Query: 235 DVW 237
            V 
Sbjct: 225 GVA 227


>gi|254487761|ref|ZP_05100966.1| Flp pilus assembly protein CpaB [Roseobacter sp. GAI101]
 gi|214044630|gb|EEB85268.1| Flp pilus assembly protein CpaB [Roseobacter sp. GAI101]
          Length = 198

 Score =  122 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 44/153 (28%), Positives = 74/153 (48%), Gaps = 9/153 (5%)

Query: 92  ELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAATMDISISSAVGGMIKPND 150
           E++G +V+V     + I   K+   G + GL+S L +G RA T+ + +SS V G ++P D
Sbjct: 5   EVNGDVVQVVARSFEAILAAKVTAPGEDTGLTSRLARGTRAFTIKVDVSSGVSGFLRPGD 64

Query: 151 HVDVVMVRSLS-------ERKPTVTVVLSNIRVIAIDHNIDSD-ERVLVGSTATLELTPM 202
            VDV     ++              ++ + +++IAID +   +     +  T T+ + P 
Sbjct: 65  RVDVYWTGRITVGDSNLRNAGDVTKLIEAGVQLIAIDQSAGGEMNEANIAQTVTVAVKPS 124

Query: 203 QAKALVAAQSVAKLSLVLRSIADLNPSSSEDSD 235
           Q  AL  AQS  KLSL L    D   + + + D
Sbjct: 125 QVAALAQAQSTGKLSLSLVGADDDTIAGAIEVD 157


>gi|226325180|ref|ZP_03800698.1| hypothetical protein COPCOM_02972 [Coprococcus comes ATCC 27758]
 gi|225206528|gb|EEG88882.1| hypothetical protein COPCOM_02972 [Coprococcus comes ATCC 27758]
          Length = 497

 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 59/233 (25%), Positives = 101/233 (43%), Gaps = 10/233 (4%)

Query: 2   KLTRLMGI-VVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           K++RL  +     V A++AG +A+       +     I E  +    V+ +   +  G  
Sbjct: 272 KVSRLQKVTAGLAVIAVLAGGVAVV----SEIDANNRIAEAFSGTTEVVAATKTIHAGDE 327

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG- 119
           ++ + L +V+ P   V DG I      ++ +   G +    I KG  +       + N  
Sbjct: 328 ISASDLAFVSVPNSTVADGAITKKDIDDSSKTPVGRVATQYIAKGSQLTNASTAGKDNPE 387

Query: 120 GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAI 179
            L++ +  G  A T+ +   S +GGM++ ND V V+     S      TV+  ++R+ A+
Sbjct: 388 SLAAAIGDGMEAVTISVDAQSGMGGMLRVNDRVKVIQPNDGSLGGDGFTVIADSVRIAAL 447

Query: 180 DHN-IDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSS 231
           D N           ST TLE+TP QA  +   ++   L+L L S AD   S  
Sbjct: 448 DGNFSSGSGSSDGYSTVTLEVTPEQAGKI---RTAGGLTLTLPSSADTTESGE 497


>gi|42521753|ref|NP_967133.1| putative flp pilus assembly protein CpaB [Bdellovibrio
           bacteriovorus HD100]
 gi|39574283|emb|CAE77787.1| putative flp pilus assembly protein CpaB [Bdellovibrio
           bacteriovorus HD100]
          Length = 301

 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 50/259 (19%), Positives = 103/259 (39%), Gaps = 31/259 (11%)

Query: 15  FALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEE 74
            ++ AG+ A  L+  +  + +    +       V+++K D+A    +   ++E    P +
Sbjct: 11  LSIAAGVFATFLLYSYSQEKKAEYDKRFGSTKRVVVAKEDIAEMQTIYDTMVETKELPAD 70

Query: 75  NVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAAT 133
            +    I          E+ G +  VPI KG  +    L+  G + G+S  +   KRA T
Sbjct: 71  FIQPDAIT------IPDEIIGNVAAVPIRKGQMVVKNNLLTPGPDTGISLQVAPSKRAVT 124

Query: 134 MDISISSAVGGMIKPNDHVDVVMVRSLS---ERKPTVTVVLSNIRVIAIDHNI------- 183
           + +     V  +I+P D +D+           ++  V  +++++ V+A   ++       
Sbjct: 125 IPVDEVRGVAKLIRPGDRIDIYAAVDSGKGVNQRREVFTMMNDVVVLATGVSVVNNIPRM 184

Query: 184 ---DSDERVLV---------GSTATLELTPMQAKAL--VAAQSVAKLSLVLRSIADLNPS 229
              DS  + L           +T T+E TP +A+ L  + + +   L + LR+ +D    
Sbjct: 185 FELDSTGKNLTQIALTGDTKYTTITVEATPKEAQDLFYILSTAPGNLFMALRNPSDRTIP 244

Query: 230 SSEDSDVWDVQEEGKEIQI 248
               S   D       + +
Sbjct: 245 PRMPSSTSDSVLGKPMVSV 263


>gi|281356955|ref|ZP_06243445.1| Flp pilus assembly protein CpaB [Victivallis vadensis ATCC BAA-548]
 gi|281316513|gb|EFB00537.1| Flp pilus assembly protein CpaB [Victivallis vadensis ATCC BAA-548]
          Length = 264

 Score =  121 bits (305), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 51/258 (19%), Positives = 104/258 (40%), Gaps = 21/258 (8%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M+      ++ + VF L+A ++     S   ++ E+      ++ + ++    D A    
Sbjct: 1   MRQK--FLLLGAVVFGLLAFVL-----SYQQLEAEKRRIIGDSETVVLIKLAVDKAPNEE 53

Query: 61  VTPNILEWVAFPEENVFD-GFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG 119
           + P  L  V +P     +   +      + +  + G  +   +  G  ++   L      
Sbjct: 54  LQPGDL--VRYPVRRSREMQSMSREIPWSEVSRVIGRQLETTMTAGQVLQSTDLKPMTQR 111

Query: 120 -GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV------RSLSERKPTVTVVLS 172
            G + ++  G RA  + +   S+V  +I+PND VDV+        R  S        +L 
Sbjct: 112 QGFNGVIRPGMRAVAIPVDPVSSVNNLIQPNDDVDVIGTFRFPDVRGDSSLDTVTLTILQ 171

Query: 173 NIRVIAIDHNIDSDE----RVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNP 228
           +++V+A+ +   S            T TL L P + + ++ A    KL+L LR+  D+  
Sbjct: 172 DVKVLAVGNRWGSASLDPAGARSYGTVTLLLYPEEVEMIIFASQKGKLNLSLRNFEDVKI 231

Query: 229 SSSEDSDVWDVQEEGKEI 246
           S   +    + ++  KEI
Sbjct: 232 SRETEKRSVNFKQLEKEI 249


>gi|76663414|emb|CAE47790.1| pilus assembling protein [Bdellovibrio bacteriovorus]
          Length = 302

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 52/250 (20%), Positives = 101/250 (40%), Gaps = 31/250 (12%)

Query: 15  FALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEE 74
            ++ AG+ A  L+  +  + +    +       V+++K D+A    V   ++E    P +
Sbjct: 11  LSIAAGVFATFLLYSYSQEKKAEYDKRFGSTKRVVVAKEDIAEMQTVYDTMVETKELPAD 70

Query: 75  NVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRG-NGGLSSLLPKGKRAAT 133
            +    I          E+ G +  VPI KG  I    L+  G + G+S  +   KRA T
Sbjct: 71  FIQPDAIT------VPDEIIGNVAAVPIRKGQMIVKNNLLTPGPDTGISLQVAPSKRAVT 124

Query: 134 MDISISSAVGGMIKPNDHVDVVMVRSLS---ERKPTVTVVLSNIRVIAIDHNI------- 183
           + +     V  +I+P D +D+           ++  V  +++++ V+A   ++       
Sbjct: 125 IPVDEVRGVAKLIRPGDRIDIYAAVDSGKGVNQRREVFTMMNDVVVLATGVSVVNNIPRM 184

Query: 184 ---DSDERVLV---------GSTATLELTPMQAKAL--VAAQSVAKLSLVLRSIADLNPS 229
              DS  + L           +T T+E TP +A+ L  + + +   L + LR+ +D    
Sbjct: 185 FELDSTGKNLTQIALTGDTKYTTITVEATPKEAQDLFYILSTAPGNLFMALRNPSDRTIP 244

Query: 230 SSEDSDVWDV 239
               S   D 
Sbjct: 245 PRMPSSTSDS 254


>gi|319795563|ref|YP_004157203.1| flp pilus assembly protein cpab [Variovorax paradoxus EPS]
 gi|315598026|gb|ADU39092.1| Flp pilus assembly protein CpaB [Variovorax paradoxus EPS]
          Length = 319

 Score =  120 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 44/259 (16%), Positives = 99/259 (38%), Gaps = 25/259 (9%)

Query: 24  MRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDD 83
             L +        +  +  ++  +V++++  +  G  V P ++   + P E + +  +  
Sbjct: 36  YYLRASEREIAASLEKDADSQRRDVVVARQPIGEGSQVLPGMVAKRSVPNEYLHNDALT- 94

Query: 84  VHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVG 143
              P +  +  G  + VP+  G P+             +  + +G RA T+ +   S++ 
Sbjct: 95  ---PESFAQFAGRQLTVPVAAGKPLLASFFAAPRKVF-AQEIEQGVRAVTIPVDEISSIS 150

Query: 144 GMIKPNDHVDVVMVRSLSERKPTVTVV--LSNIRVIAIDH---------------NIDSD 186
           GM++  D +D + V   S       V+  L ++ V A                  + D+D
Sbjct: 151 GMLRAGDRIDFMYVVEKSAANDPSVVIPLLQDVEVRATGQITSEQFAAMRKRADVSADTD 210

Query: 187 ERVL-VGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSS--EDSDVWDVQEEG 243
                  +T T+ + P  A+ L+ AQ + K+   LR+  D    ++  +  D+  +    
Sbjct: 211 PYARQRYATVTVAVQPQDAQKLILAQRLGKIIATLRNPEDRATMTTGVDAVDLDAIVSGF 270

Query: 244 KEIQIIKAGVIVNKDGEGI 262
           +  + +         G G+
Sbjct: 271 RPQRAVPVAASHAAGGSGV 289


>gi|149175454|ref|ZP_01854075.1| hypothetical protein PM8797T_18359 [Planctomyces maris DSM 8797]
 gi|148845722|gb|EDL60064.1| hypothetical protein PM8797T_18359 [Planctomyces maris DSM 8797]
          Length = 367

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 50/225 (22%), Positives = 92/225 (40%), Gaps = 17/225 (7%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK      + +  +F +   +IA  +        EE     P    N+ ++  +L  G +
Sbjct: 1   MKSLTPAKVTL-LMFGVFGVLIAAYIGKRLLAGKEEA---PPVATRNIPMAISELEPGTL 56

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           VT   L       +N+    +       + + + G +V+  I    PI   +L   G   
Sbjct: 57  VTDEHLGLGPIAIKNLKPEMMT------SNRVIVGRIVKERIPAATPISTGQLYPAGE-T 109

Query: 121 LSSLLPKGKRAATMDI-SISSAVGGMIKPNDHVDVVMVRSLSERKP-----TVTVVLSNI 174
               +  G RA ++ + S    V G+IKP ++VDV M  +               + + +
Sbjct: 110 PPIQVEPGMRAISVSLESSVDLVDGLIKPGEYVDVHMTPTGMNNDKRLNGGMTLTLFNGV 169

Query: 175 RVIAIDHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLV 219
           RVIAI+ +   +     G+  TLELTP QA  ++ A+   ++++ 
Sbjct: 170 RVIAINRSYTQNSSSRRGTNVTLELTPEQANIMILARDRGEITMS 214


>gi|78486069|ref|YP_391994.1| Flp pilus assembly CpaB [Thiomicrospira crunogena XCL-2]
 gi|78364355|gb|ABB42320.1| Flp (type IV) pilus assembly protein CpaB homolog [Thiomicrospira
           crunogena XCL-2]
          Length = 296

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 55/266 (20%), Positives = 110/266 (41%), Gaps = 36/266 (13%)

Query: 1   MKLTRLMGIV--VSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFIN------VLISK 52
           MKL     +V  ++ + A++A ++    V     + E   +      +       ++++ 
Sbjct: 1   MKLKTSDWVVYGIAALSAILAIVLVYGYVQNRVAEAEANASTKTITVVEKPELHSIVVAS 60

Query: 53  GDLAVGMVVTPNILEWVAFP-EENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLE 111
            D+  G  +  + ++ +  P E  V  G I +       Q   G +    I  G+ I  +
Sbjct: 61  RDIYRGEKIEADDVKVLNVPMEGLVVKGVIINP------QNAVGHVAHQKIYAGEWILAK 114

Query: 112 KLVDRGNG---GLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKP-TV 167
           KL          + +LL K +RA  + I   + + G+I P DHVDV+ V   ++ K    
Sbjct: 115 KLKLESQSRFQSVEALLEKTRRAIRLPIEPDTGLLGIISPGDHVDVISVFESADSKRMVS 174

Query: 168 TVVLSNIRVIAID----------------HNIDSDERVLVGST-ATLELTPMQAKALVAA 210
             +L NI V++I                  N+ ++++     +   L++   QA+ L  A
Sbjct: 175 RTILQNITVLSIGIENQMRASTADSEEDNQNLFANKQASNKKSMVALDVDTTQAEKLALA 234

Query: 211 QSVAKLSLVLRSIADLNPSSSEDSDV 236
            +V  + L+LR+ AD     ++  ++
Sbjct: 235 MNVGAIHLLLRNSADTELVDTKGVNL 260


>gi|154250525|ref|YP_001411349.1| SAF domain-containing protein [Parvibaculum lavamentivorans DS-1]
 gi|154154475|gb|ABS61692.1| SAF domain protein [Parvibaculum lavamentivorans DS-1]
          Length = 317

 Score =  119 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 83/228 (36%), Gaps = 22/228 (9%)

Query: 41  NPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRV 100
                + VL++  D+  G  ++   L      E     G   D           G +   
Sbjct: 70  AAENAVTVLVAARDVVRGQRISEADLGLRRM-EGPAPSGSFADAQSA------IGRVATD 122

Query: 101 PILKGDPIRLEKLV-DRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV-- 157
            I     I  + L  +    G+++L+P+G+RA  + I+    VGG ++  D VDV     
Sbjct: 123 DIRSSQIIFQQALSSEPAAAGIAALVPEGQRAFAIRIAEEDIVGGFLQAGDRVDVFATFP 182

Query: 158 ----------RSLSERKPTVTVVLSNIRVIAIDHNIDSDERVLV--GSTATLELTPMQAK 205
                           +    ++L +++V+A+   +      +     T T+   P    
Sbjct: 183 GAVYGQQGGLGQREGDQSKSALLLQDMQVLAVGPALSHQAGQVNAGARTVTVAAPPNALA 242

Query: 206 ALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAGV 253
            L  A  +  ++L +R+  D   +  E   + D++  G  +  ++A  
Sbjct: 243 RLALAGRLGHITLAIRNPGDREVAPGELVALDDLRPAGAAVAPVEAKS 290


>gi|91775996|ref|YP_545752.1| Flp pilus assembly CpaB [Methylobacillus flagellatus KT]
 gi|91709983|gb|ABE49911.1| Flp pilus assembly CpaB [Methylobacillus flagellatus KT]
          Length = 299

 Score =  119 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 57/282 (20%), Positives = 107/282 (37%), Gaps = 42/282 (14%)

Query: 10  VVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWV 69
           + + +  + A ++    +   H    +     PA    +++++ D+  G V+ P  L   
Sbjct: 8   ITAILLFIGAVLVGWYGIRAGHQPEIQAPAPLPAVLYPLVVARQDIPAGHVLLPEDLALE 67

Query: 70  AFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGK 129
                   +    +    +A  +L G +V   I K  PI       RG    + LL  G+
Sbjct: 68  --------ESESQNPLAYSATTDLVGRMVESSIEKNAPILSSHFAQRGPA--AQLLKHGE 117

Query: 130 RAATMDISISSAVGGMIKPNDHVDVVMVRSLSER---KPTVTVVLSNIRVI----AIDHN 182
           R   + +     VGG I+P DHVDV++  + S       +   +L ++RVI    A+  N
Sbjct: 118 RGVAIKVDEVVGVGGFIQPGDHVDVLVYINSSNGMTTDSSAQSILRDVRVISYGDALQQN 177

Query: 183 ID------------------SDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
           +                   S  + L G +A + +       L+ A S   L L LR  +
Sbjct: 178 VSSSNVSPGPASMLADNGSTSKPQALSGHSAVIAVKEEDVSRLMLAASGGTLRLSLRGAS 237

Query: 225 -DLNPSSSEDSDVWDVQEEGKEI------QIIKAGVIVNKDG 259
            D+   SS+   + ++    + +      +++KA       G
Sbjct: 238 PDVAKKSSDLVRLSEITGSQQPVKAPSLPKVVKAAPTKKNAG 279


>gi|269926136|ref|YP_003322759.1| Flp pilus assembly protein CpaB [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269789796|gb|ACZ41937.1| Flp pilus assembly protein CpaB [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 258

 Score =  119 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 56/254 (22%), Positives = 99/254 (38%), Gaps = 28/254 (11%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVV 61
           K   ++ ++V    A  AG+  +      +V       +   K + V+++  D+A G  +
Sbjct: 3   KRIGILLMIVGLALAAFAGLTVI------NVTRAAREAKPVIKQVQVVVAAQDIAQGSPI 56

Query: 62  TPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG- 120
           T ++LE   FP +      +      +++ +         I+KG  I    L D    G 
Sbjct: 57  TASMLETKPFPADFAPSEAV------SSINDAVNRYSATNIVKGQIITRPLLSDTKQVGK 110

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMV------------RSLSERKPTVT 168
           L+  +PKGK A  +  S   +  G I+P D VDV++             ++  E + T  
Sbjct: 111 LALSIPKGKVAFALPASDLLSGNGQIQPGDRVDVLVTFFVKMTSIGPDGQTSDEERATTQ 170

Query: 169 VVLSNIRVIAI-DHNIDSDERVLVGSTATLELTPMQAKALVAAQ--SVAKLSLVLRSIAD 225
             L ++ V+ +      SD          L + P QA  L  A+    A + L LR  +D
Sbjct: 171 TTLQDLEVLDVLGTGAGSDGGNAKSPAVVLLVDPQQAVTLKLAKDSDKAVIDLALRGSSD 230

Query: 226 LNPSSSEDSDVWDV 239
            +     D +  D 
Sbjct: 231 DHKQHETDGETEDS 244


>gi|186473163|ref|YP_001860505.1| Flp pilus assembly protein CpaB [Burkholderia phymatum STM815]
 gi|184195495|gb|ACC73459.1| Flp pilus assembly protein CpaB [Burkholderia phymatum STM815]
          Length = 339

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 46/225 (20%), Positives = 96/225 (42%), Gaps = 16/225 (7%)

Query: 34  TEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQEL 93
             EV  +   + I V++ + D+  G  ++ +         + V     DD+ + +A    
Sbjct: 44  RAEVAGKLALRGIEVVVPRRDVPAGTPLSSDAFVSREIAADLV----YDDMVRVDAFDAF 99

Query: 94  DGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVD 153
               +   ++ G P+R            S +LP G+RA T +I   ++   M++P + VD
Sbjct: 100 RKAKLVRAVMHGRPLRTSDFDAPRGRDFSDMLPAGQRALTFEIDAVNSTASMLRPGNRVD 159

Query: 154 VVMVRSL----SERKPTVTVVLSNIRVIAIDHNI------DSDERVLVGS--TATLELTP 201
           +  V +     +  +  V ++L  + V+A   ++      D DE        T T+++  
Sbjct: 160 MYWVGTQAYASAGERKAVRLLLPGVLVLATGRSVNARDAGDVDEPASASRYDTVTMQVPA 219

Query: 202 MQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEI 246
             A  +V AQ +  L L+LR+ AD +  ++   ++ +    G ++
Sbjct: 220 ADAPRIVLAQKMGTLRLILRNAADDDDIAASPVELTEGDVFGAQL 264


>gi|319791193|ref|YP_004152833.1| flp pilus assembly protein cpab [Variovorax paradoxus EPS]
 gi|315593656|gb|ADU34722.1| Flp pilus assembly protein CpaB [Variovorax paradoxus EPS]
          Length = 319

 Score =  118 bits (297), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 47/235 (20%), Positives = 90/235 (38%), Gaps = 24/235 (10%)

Query: 24  MRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDD 83
             L +        +  +  ++  +V+++   L  G  V P ++   + P E V +  I  
Sbjct: 36  YYLRASEREIAASLEKDADSQRRDVVVANRALGDGTTVLPTMVAKRSVPNEYVHNDAIT- 94

Query: 84  VHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVG 143
              P    +  G  + VP+  G P+             +  + +G RA T+ +   S++ 
Sbjct: 95  ---PETFSQFAGRQLSVPVAAGKPLLASFFSAPRKVF-AQEIEQGVRAITIPVDEISSIS 150

Query: 144 GMIKPNDHVDVVMVRSLSERKPTVTVV--LSNIRVIAIDH---------------NIDSD 186
           GM++  D +D + +   S       VV  L ++ V A                  + D+D
Sbjct: 151 GMLRAGDRIDFMYMVEKSAANDPSVVVPLLQDVEVRATGQITSEQFAAMRKRSDVSADTD 210

Query: 187 ERV-LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQ 240
                  ST T+ + P  A+ L+ AQ + K+   LR+  D   + +   D  D+ 
Sbjct: 211 PYAQQRYSTVTVAIQPQDAQKLILAQRLGKIIATLRNPEDRA-TMTSGVDAVDLD 264


>gi|317403406|gb|EFV83919.1| flp pilus assembly protein CpaB [Achromobacter xylosoxidans C54]
          Length = 279

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 48/227 (21%), Positives = 94/227 (41%), Gaps = 17/227 (7%)

Query: 31  HVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAM 90
             + + +  E+    ++ L++  DL  G  +TP  L     P +      I    +P   
Sbjct: 36  RQRVDTLAGEHREAMVSRLVAARDLPAGTELTPAHLAIRDIPAQWAPAASI----EPRDG 91

Query: 91  QELDGVLVRVPILKGDPIRLEKLVDRGNGG---LSSLLPKGKRAATMDISISSAVGGMIK 147
             + G  + + + +GDP+    L    +     L++ L  G+RA  + ++    V  +++
Sbjct: 92  DSVLGTRLGLALAQGDPVLSGCLARADSASPPALAARLDPGQRALQVPVADLGTVADLLR 151

Query: 148 PNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDERVLVGSTATLELTPMQAKAL 207
             D VD+ +      R+   T +L  +RV+A+    D+          TL  TP QA   
Sbjct: 152 VGDLVDIYVSFPHRGRE-VTTPLLQGVRVLAV---PDAGGGTGPAQ-VTLAATPNQAMRY 206

Query: 208 VAAQSVAKLSLVLRSIADL-----NPSSSEDSDVWDVQEEGKEIQII 249
           +AA+    L+ ++R+ AD      +P     S +    E  +E  ++
Sbjct: 207 LAARRAGTLTGLVRNRADTARIPEDPPRDLASLIGLAPEAPREPAVV 253


>gi|167824271|ref|ZP_02455742.1| putative fimbriae-assembly related protein [Burkholderia
           pseudomallei 9]
          Length = 192

 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 40/165 (24%), Positives = 72/165 (43%), Gaps = 17/165 (10%)

Query: 88  NAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMI 146
               +L G L+R P+  G P+    ++     G L++ L  G RA ++ I   S   G+I
Sbjct: 28  EPKTDLKGDLLRHPVRAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLI 87

Query: 147 KPNDHVDVVMVRSL---------SERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVG 192
           +P D+VDV++ + L          +R      + + +RV+A+         D+ +     
Sbjct: 88  EPGDYVDVLLTQQLAAPGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRA 147

Query: 193 STATLELTPMQAKALVAAQSVAKLSLVLRSIA--DLNPSSSEDSD 235
            T T E++   A+ +     +  LSL LRS A  D     +  ++
Sbjct: 148 RTVTFEVSSRDAQVITVGAHLGALSLALRSFATSDRGAVGTAPAE 192


>gi|311105391|ref|YP_003978244.1| Flp pilus assembly protein CpaB 1 [Achromobacter xylosoxidans A8]
 gi|310760080|gb|ADP15529.1| Flp pilus assembly protein CpaB 1 [Achromobacter xylosoxidans A8]
          Length = 284

 Score =  115 bits (288), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 52/223 (23%), Positives = 93/223 (41%), Gaps = 10/223 (4%)

Query: 14  VFALVAGIIAMRLVSPHHVQTEEVI-TENPAKFINVLISKGDLAVGMVVTPNILEWVAFP 72
             AL+AG+++   V  H  Q  + +  E     ++ L++  DL  G  +    L     P
Sbjct: 19  AIALIAGLVSAWAVREHVQQRVQALEAEARTPMVSRLVAAYDLPAGTQLEELHLAVREIP 78

Query: 73  EENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRGNGGLSSLLPKGKRA 131
           E       ID    P  +  L G  +   +  G+P+    L        L+S L  G+RA
Sbjct: 79  EPWASRASID----PLDLSGLLGATLLADVANGEPLLRGHLTFTAPVPALASRLRSGQRA 134

Query: 132 ATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDERVLV 191
            T+  +    +  +++  D +D+ +  +  +++ TV  +L  +RV+ +    D + +   
Sbjct: 135 LTVAATDLGGLAEVLRVGDAIDIYVSFAHRQQELTV-PLLQGMRVLMVGGEADGENK--- 190

Query: 192 GSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDS 234
           G   TL  TP +A   VAA+    L+ +LR   D    S    
Sbjct: 191 GGNITLAATPDEAMRFVAARQSGVLTAMLRHRDDAAVVSGAAQ 233


>gi|167911034|ref|ZP_02498125.1| putative fimbriae-assembly related protein [Burkholderia
           pseudomallei 112]
          Length = 210

 Score =  115 bits (288), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 39/152 (25%), Positives = 68/152 (44%), Gaps = 15/152 (9%)

Query: 88  NAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMI 146
               +L G L+R P+  G P+    ++     G L++ L  G RA ++ I   S   G+I
Sbjct: 28  EPKTDLKGDLLRHPVRAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLI 87

Query: 147 KPNDHVDVVMVRSLSERKPT---------VTVVLSNIRVIAIDHNI-----DSDERVLVG 192
           +P D+VDV++ + L+    T            + + +RV+A+         D+ +     
Sbjct: 88  EPGDYVDVLLTQQLAAPGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRA 147

Query: 193 STATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
            T T E++   A+ +     +  LSL LRS A
Sbjct: 148 RTVTFEVSSRDAQVITVGAHLGALSLALRSFA 179


>gi|257791505|ref|YP_003182111.1| Flp pilus assembly protein CpaB [Eggerthella lenta DSM 2243]
 gi|257475402|gb|ACV55722.1| Flp pilus assembly protein CpaB [Eggerthella lenta DSM 2243]
          Length = 243

 Score =  115 bits (288), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 56/229 (24%), Positives = 96/229 (41%), Gaps = 20/229 (8%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
             R + +V +   A+    +    ++  +VQ+E             +I+   ++ G  ++
Sbjct: 33  SARKLSLVTAASVAIAVIAVVYAFLTSSNVQSEIATLRENTSST--VITTTAISQGTTIS 90

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG-GL 121
           P++L+ V  P   +    I D       Q+L G +    I     +    L    N   L
Sbjct: 91  PDMLKVVDIPASFLNSEAIADT------QDLVGKIALYNIAANSQVTSGMLSAMDNAATL 144

Query: 122 SSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDH 181
           +S L  G  A ++ +   S + G+IK ND+VD++             V++ N+RV A+D 
Sbjct: 145 ASSLQAGNVAISIAVDSESGLSGLIKQNDYVDIL---------GNGEVIVQNVRVAALDS 195

Query: 182 NIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
           N+     V   +T TLE+ P QA A+  AQS   L  VLR   +     
Sbjct: 196 NLS--GSVSQYATVTLEVAPTQATAIQEAQSENPLRFVLRPAVERTAPG 242


>gi|167845817|ref|ZP_02471325.1| putative fimbriae-assembly related protein [Burkholderia
           pseudomallei B7210]
          Length = 181

 Score =  115 bits (288), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 40/164 (24%), Positives = 71/164 (43%), Gaps = 17/164 (10%)

Query: 88  NAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMI 146
               +L G L+R P+  G P+    ++     G L++ L  G RA ++ I   S   G+I
Sbjct: 18  EPKTDLKGDLLRHPVRAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLI 77

Query: 147 KPNDHVDVVMVRSL---------SERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVG 192
           +P D+VDV++ + L          +R      + + +RV+A+         D+ +     
Sbjct: 78  EPGDYVDVLLTQQLAAPGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRA 137

Query: 193 STATLELTPMQAKALVAAQSVAKLSLVLRSIA--DLNPSSSEDS 234
            T T E++   A+ +     +  LSL LRS A  D     +  +
Sbjct: 138 RTVTFEVSSRDAQVITVGAHLGALSLALRSFATSDRGAVGTAPA 181


>gi|161524906|ref|YP_001579918.1| Flp pilus assembly protein CpaB [Burkholderia multivorans ATCC
           17616]
 gi|189350344|ref|YP_001945972.1| pilus assembly protein [Burkholderia multivorans ATCC 17616]
 gi|160342335|gb|ABX15421.1| Flp pilus assembly protein CpaB [Burkholderia multivorans ATCC
           17616]
 gi|189334366|dbj|BAG43436.1| pilus assembly protein [Burkholderia multivorans ATCC 17616]
          Length = 313

 Score =  114 bits (287), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 49/246 (19%), Positives = 98/246 (39%), Gaps = 35/246 (14%)

Query: 2   KLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVV 61
           K+   + I ++ +  + A ++     +PH    +  +  NP   ++V+++   L VG  +
Sbjct: 7   KIIAGLLIAIAVLLGIYAWMLGR--STPHPAPVQPTVAANP---VSVVVATRTLPVGQPI 61

Query: 62  TPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGL 121
             + L+    P  +V  G   D         L G +    I    P+  + LV     GL
Sbjct: 62  AADALKVQ--PIASVPAGAFADPAV------LVGRVPARDIPASAPVVSDALVS----GL 109

Query: 122 SSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER--------KPTVTVVLSN 173
           +  +  G+RA  + +  ++AVG  ++P + VDV +               +    +++S 
Sbjct: 110 AEDVQPGERAIAVRVDETNAVGNRLRPGNFVDVFLNLKREGNSMLDGEVSQTQARLLMSK 169

Query: 174 IRVIAIDHNI----------DSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSI 223
           +RV++                S+ +      A L +   Q  AL   +S  +L+L LR+ 
Sbjct: 170 VRVLSFGDATPDRDSGNNTNGSNGQPSGVRIAVLAVPTAQVDALTLGESSGRLTLALRNP 229

Query: 224 ADLNPS 229
            D   +
Sbjct: 230 RDDELA 235


>gi|239817411|ref|YP_002946321.1| Flp pilus assembly protein CpaB [Variovorax paradoxus S110]
 gi|239803988|gb|ACS21055.1| Flp pilus assembly protein CpaB [Variovorax paradoxus S110]
          Length = 331

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 51/285 (17%), Positives = 93/285 (32%), Gaps = 38/285 (13%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTE-------EVITENPAKFINVLISKG 53
           M     +   +  + A+  G  A  L      +T        E      A    V+++  
Sbjct: 1   MINLTKIVAAILVLLAIALGGYAWMLGRQAPAKTAVTATAPSEQPQSQQAPTYPVVVAAK 60

Query: 54  DLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL 113
            L  G  +  + L            G   +V          G +  + + +G P+   +L
Sbjct: 61  PLPAGQAIPADALRVERLTVN--PAGAFQEVATA------TGRVPVIDLSEGSPLMDNQL 112

Query: 114 VDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSE---RKPTVTVV 170
           V     GL+  + +G+RA  +       VG  I+P D VDV +          +    ++
Sbjct: 113 VS----GLALRVGEGERAVAIKADEIMGVGNKIQPGDFVDVFITLKSDGKDVDRSQARLL 168

Query: 171 LSNIRVIA-------------IDHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLS 217
           LS  RV+A              D      +R     TA L ++      L    +  +L 
Sbjct: 169 LSRKRVLAFGSASVDGLPSKTTDKQQQQAQRTEAPRTAVLAVSVDDVNRLTIGDATGRLM 228

Query: 218 LVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAGVIVNKDGEGI 262
           L LR+  D+     +   ++       +   ++ G       EG+
Sbjct: 229 LALRNPNDVAEPDPK---LFADLPTALQPASVRPGEPRRASLEGL 270


>gi|296158793|ref|ZP_06841622.1| Flp pilus assembly protein CpaB [Burkholderia sp. Ch1-1]
 gi|295890998|gb|EFG70787.1| Flp pilus assembly protein CpaB [Burkholderia sp. Ch1-1]
          Length = 316

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/243 (20%), Positives = 87/243 (35%), Gaps = 28/243 (11%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M     +   V    ALV G+ A  L           +T        V+++   LA G  
Sbjct: 1   MPNLTRIFAGVLIAVALVLGLFAWTLSRR---PAPVAVTPATHASFPVVVATRALAPGKP 57

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +T + L   + P     +G   +  Q      L G +    I    P+   +L    + G
Sbjct: 58  ITVDDLRIQSLPIN--PNGAFTEPAQ------LAGRVPNAEIGADSPVLESQL----SSG 105

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER---------KPTVTVVL 171
           L+  +  G+RA  + +   +AVG  ++P + VDV                  +    +++
Sbjct: 106 LAERVEAGERALAVRVDEGNAVGNRLRPGNFVDVFFTLKRDGGSMGNGGEIDRTQARLLM 165

Query: 172 SNIRVIAIDHNIDSDERV----LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLN 227
           S +RV+A  +   S +       +  TA L +       L  A+S  +L   LR+  D  
Sbjct: 166 SKVRVLAFGNATASGDSAGDPNGMVRTAVLAVPVADVDRLTLAESAGRLIFALRNPKDTE 225

Query: 228 PSS 230
              
Sbjct: 226 VVD 228


>gi|187923644|ref|YP_001895286.1| Flp pilus assembly protein CpaB [Burkholderia phytofirmans PsJN]
 gi|187714838|gb|ACD16062.1| Flp pilus assembly protein CpaB [Burkholderia phytofirmans PsJN]
          Length = 316

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 45/228 (19%), Positives = 86/228 (37%), Gaps = 24/228 (10%)

Query: 10  VVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWV 69
           +++GV   VA ++ +   S         +T        V+++   L  G  +T + +   
Sbjct: 7   ILAGVLIAVALVLGLFAWSLSRRPALVAVTPATQASFRVVVATHTLPAGKAITVDDVRVQ 66

Query: 70  AFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGK 129
           + P     +G   D  Q      L G +    I    P+   +L    + GL+  +  G+
Sbjct: 67  SLPIN--PNGAFTDPAQ------LAGRVPNAEIGAESPVLESQL----SSGLAERVEPGE 114

Query: 130 RAATMDISISSAVGGMIKPNDHVDVVMVRSLSE--------RKPTVTVVLSNIRVIAIDH 181
           RA  + +   +AV   ++P + VDV                 +    +++S +RV+A  +
Sbjct: 115 RALAVRVDEGNAVANRLRPGNFVDVFFTLKRDASIGNGGEIDRTQARLLMSKVRVLAFGN 174

Query: 182 NIDSDERV----LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAD 225
              S +       +  TA L +       L  A+S  +L   LR+  D
Sbjct: 175 ATASGDSAGDPNGMVRTAVLAVPVADIDRLTLAESAGRLIFALRNPKD 222


>gi|76810330|ref|YP_333339.1| CpaB family Flp pilus assembly protein [Burkholderia pseudomallei
           1710b]
 gi|76579783|gb|ABA49258.1| Flp pilus assembly protein CpaB family [Burkholderia pseudomallei
           1710b]
          Length = 348

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 51/265 (19%), Positives = 96/265 (36%), Gaps = 27/265 (10%)

Query: 11  VSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVA 70
           +    A++ GI A  L                   + V+++   L  G  +  + L+   
Sbjct: 61  LLIGIAILLGIYAWLLGRKPAPVAPGAAPAVATAMVPVVVAARALPAGQPIPADALKVQQ 120

Query: 71  FPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKR 130
            P      G   +         + G +    I    P+   +L+     GL+  +  G+R
Sbjct: 121 TPTPIA--GAFPNPML------VTGRIPASDIGAQAPVLESELMS----GLADQIAPGER 168

Query: 131 AATMDISISSAVGGMIKPNDHVDVVMVRSLSER---------KPTVTVVLSNIRVIAI-D 180
           A  + +  ++AVG  ++P + VDV +                +    ++LS +RV++  D
Sbjct: 169 AVAIKVDDTNAVGNRLRPGNFVDVFVNLKREGGFGATGSEIAQTQARLLLSRVRVLSFGD 228

Query: 181 HNIDSDERVLV----GSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDV 236
             ++ D           TA L +   Q  AL  A++  +L L LRS  D + + ++   +
Sbjct: 229 ATVERDGTPGPTGAGARTAVLAVPTAQVDALTLAEASGRLVLALRSPRDEDIA-AQTVAI 287

Query: 237 WDVQEEGKEIQIIKAGVIVNKDGEG 261
                 G   Q     V+    G G
Sbjct: 288 RAPAGAGPSNQAATGLVLSELSGSG 312


>gi|323341956|ref|ZP_08082189.1| flp pilus assembly CpaB [Erysipelothrix rhusiopathiae ATCC 19414]
 gi|322464381|gb|EFY09574.1| flp pilus assembly CpaB [Erysipelothrix rhusiopathiae ATCC 19414]
          Length = 269

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 51/265 (19%), Positives = 106/265 (40%), Gaps = 58/265 (21%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   +L+ +VV+      AG+  + L++P     +E+  ++      V+++   L     
Sbjct: 1   MDKNKLISVVVA------AGVFLLALMNPIQGLKKEIPKKD---LTQVVVALKPLTAQTR 51

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKL--VDRGN 118
           +T +++E     ++   +G   D       + + G +    +  GD    EK+  V +G+
Sbjct: 52  ITQDMIEVKNVHKDAAPEGAFADA------ERVVGKVTTTKMSVGDMFTGEKVEVVGQGS 105

Query: 119 GGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPT------------ 166
            GLS++L    RA T+ +     + G+I+  + +D++ V      + T            
Sbjct: 106 SGLSTVLTDNMRAYTVKLEGQYGMQGLIRVGNKIDIITVLDSDLPEDTLQKYDYLKKNYP 165

Query: 167 --------------------------VTVVLSNIRVIAIDHNIDSDERVL---VGSTATL 197
                                       ++L N  V+AID +   D++ +   + +T TL
Sbjct: 166 QLYAGSVETAVDGKERIPVLGLKEKKAVLLLQNKEVLAIDQDTLPDDKKVADKMYTTVTL 225

Query: 198 ELTPMQAKALVAAQSVAKLSLVLRS 222
            ++   A  L  ++SV     +LRS
Sbjct: 226 AVSAEDALKLAVSESVGTNRAILRS 250


>gi|39936739|ref|NP_949015.1| hypothetical protein RPA3677 [Rhodopseudomonas palustris CGA009]
 gi|192292565|ref|YP_001993170.1| Flp pilus assembly protein CpaB [Rhodopseudomonas palustris TIE-1]
 gi|39650595|emb|CAE29118.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
 gi|192286314|gb|ACF02695.1| Flp pilus assembly protein CpaB [Rhodopseudomonas palustris TIE-1]
          Length = 193

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 42/145 (28%), Positives = 67/145 (46%), Gaps = 6/145 (4%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M   R+    V    A+ AG +A  L S    Q         A+ + VL++K D+ +G  
Sbjct: 7   MNPARI----VVLTIAVGAGGVAAYLASSTGPQ-PGAPAAPVAQTVEVLVAKNDIPLGQA 61

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLV-DRGNG 119
           VTP  L+W  +P       FI     P A  ++ G + R P + G+PIR +KLV   G+ 
Sbjct: 62  VTPGDLQWQTWPAATASSNFIRRDLHPGATTDIGGSITRAPFIAGEPIRRQKLVQADGSS 121

Query: 120 GLSSLLPKGKRAATMDISISSAVGG 144
            + + +P G RA + + ++     G
Sbjct: 122 SVPAFVPTGMRAISTETALEPGATG 146


>gi|167815899|ref|ZP_02447579.1| putative fimbriae-assembly related protein [Burkholderia
           pseudomallei 91]
          Length = 166

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/152 (25%), Positives = 68/152 (44%), Gaps = 15/152 (9%)

Query: 88  NAMQELDGVLVRVPILKGDPIRLEKLVDRGN-GGLSSLLPKGKRAATMDISISSAVGGMI 146
               +L G L+R P+  G P+    ++     G L++ L  G RA ++ I   S   G+I
Sbjct: 4   EPKTDLKGDLLRHPVRAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLI 63

Query: 147 KPNDHVDVVMVRSL---------SERKPTVTVVLSNIRVIAIDHNI-----DSDERVLVG 192
           +P D+VDV++ + L          +R      + + +RV+A+         D+ +     
Sbjct: 64  EPGDYVDVLLTQQLAAPGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRA 123

Query: 193 STATLELTPMQAKALVAAQSVAKLSLVLRSIA 224
            T T E++   A+ +     +  LSL LRS A
Sbjct: 124 RTVTFEVSSRDAQVITVGAHLGALSLALRSFA 155


>gi|167620225|ref|ZP_02388856.1| Flp pilus assembly protein CpaB family [Burkholderia thailandensis
           Bt4]
          Length = 266

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 47/234 (20%), Positives = 88/234 (37%), Gaps = 26/234 (11%)

Query: 11  VSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVA 70
           +    A++ GI A  L                   + V+++   L  G  +  + L+   
Sbjct: 12  LLIGIAILLGIYAWLLGRKPAPVAPGAAPAVATALVPVVVATRALPAGQPIPADALKVQQ 71

Query: 71  FPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKR 130
            P      G   +         + G +    I+   P+   +L+     GL+  +  G+R
Sbjct: 72  TPAPIA--GAFPNPTL------VTGRIPANDIVAQAPVLESELMS----GLADQIAPGER 119

Query: 131 AATMDISISSAVGGMIKPNDHVDVVMVRSLSER---------KPTVTVVLSNIRVIAI-D 180
           A  + +  ++AVG  ++P + VDV +                +    ++LS +RV++  D
Sbjct: 120 AVAIKVDDTNAVGNRLRPGNFVDVFVNLKRESGFGATGSEISQTQARLLLSRVRVLSFGD 179

Query: 181 HNIDSDERVLV----GSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSS 230
              D D           TA L +   Q  AL  A++  +L L LRS  D + ++
Sbjct: 180 ATADRDGTPGPTGAGARTAVLAVPTAQVDALTLAEASGRLVLALRSPRDDDVAT 233


>gi|296122068|ref|YP_003629846.1| Flp pilus assembly protein CpaB [Planctomyces limnophilus DSM 3776]
 gi|296014408|gb|ADG67647.1| Flp pilus assembly protein CpaB [Planctomyces limnophilus DSM 3776]
          Length = 334

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 47/222 (21%), Positives = 90/222 (40%), Gaps = 14/222 (6%)

Query: 3   LTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVT 62
           + RL   +++ V   V G++ +  +    +  EE   +      NV ++  D+  G ++T
Sbjct: 1   MRRLTPALLTLVMFGVVGLLVVAYIGKSLLAREE--KKPVIATRNVPMAISDIEPGTLIT 58

Query: 63  PNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLS 122
              +         +    +       A + + G + R  I   +PIR  +L   G     
Sbjct: 59  EGHIGLGPVQNSQLKPDMLL------ANRVIVGRVARTKIRAAEPIRAGQLYQPGEL-PD 111

Query: 123 SLLPKGKRAATMDISISSA-VGGMIKPNDHVDVVMVRSLSE----RKPTVTVVLSNIRVI 177
             +  G RA ++ ++     V GMIKP ++VDV+           +      +   ++VI
Sbjct: 112 LRVADGMRAVSISVAEMVGIVDGMIKPGNYVDVLFTVESQSNADLQGGVTMRLFEGVKVI 171

Query: 178 AIDHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLV 219
           AI+ +          +  TLELT  QA  +  A++   L+L+
Sbjct: 172 AINRSFTQSRVERGVNRVTLELTQAQANIITLAEAKGALTLI 213


>gi|91783010|ref|YP_558216.1| putative signal peptide protein, CpaB like [Burkholderia xenovorans
           LB400]
 gi|91686964|gb|ABE30164.1| Putative signal peptide protein, CpaB like protein [Burkholderia
           xenovorans LB400]
          Length = 316

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 50/243 (20%), Positives = 87/243 (35%), Gaps = 28/243 (11%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           M     +   V    ALV G+ A  L           +T        V+++   LA G  
Sbjct: 1   MPNLTRIFAGVLIAVALVLGLFAWTLSRR---PAPVAVTPAVHASFPVVVATRALAPGKP 57

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +T + L   + P     +G   +  Q      L G +    I    P+   +L    + G
Sbjct: 58  ITVDDLRIQSLPIN--PNGAFTEPAQ------LAGRVPNAEIGADSPVLESQL----SSG 105

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSER---------KPTVTVVL 171
           L+  +  G+RA  + +   +AVG  ++P + VDV                  +    +++
Sbjct: 106 LAERVEVGERALAVRVDEGNAVGNRLRPGNFVDVFFTLKRDGGSMGNGGEIDRTQARLLM 165

Query: 172 SNIRVIAIDHNIDSDERV----LVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLN 227
           S +RV+A  +   S +       +  TA L +       L  A+S  +L   LR+  D  
Sbjct: 166 SKVRVLAFGNATASGDSAGDPNGMVRTAVLAVPVADVDRLTLAESAGRLIFALRNPKDTE 225

Query: 228 PSS 230
              
Sbjct: 226 VVD 228


>gi|170696787|ref|ZP_02887896.1| Fl