RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780729|ref|YP_003065142.1| peptidase A24A prepilin type IV [Candidatus Liberibacter asiaticus str. psy62] (176 letters) >gnl|CDD|180550 PRK06382, PRK06382, threonine dehydratase; Provisional. Length = 406 Score = 27.5 bits (61), Expect = 1.9 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 8/66 (12%) Query: 113 GGILSVFILTVRMITNHIPIFGMFVPKSFLMK-----NKI-PY--GIAISMGGLISYPDS 164 GG++S L + I ++ I G+ S MK KI + G++I G + YP Sbjct: 184 GGLISGIALAAKHINPNVKIIGIESELSDSMKASLREGKIVAHTSGVSICDGISVKYPGD 243 Query: 165 YLFKVA 170 F +A Sbjct: 244 LTFDIA 249 >gnl|CDD|163113 TIGR03030, CelA, cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils. Length = 713 Score = 26.9 bits (60), Expect = 2.9 Identities = 24/120 (20%), Positives = 38/120 (31%), Gaps = 25/120 (20%) Query: 7 VFSAVFLIPPFCLVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIALHLLVGL 66 AV + + A L + +I + +FLL L + + L LL+ L Sbjct: 11 FIIAVAGLLALLALITAPVTLETQLI------IAGSAFLLLLILKRFNGKRPRL-LLLVL 63 Query: 67 IVFIICFCFFAFNIMGGGDVKLLTSTAVWFGWTPSFLSFLFFVA--------ILGGILSV 118 VFI + LT T + L +A +LG +V Sbjct: 64 SVFISLRYLWW----------RLTETLPFDNTLNFIFGTLLLLAELYSITILLLGYFQTV 113 >gnl|CDD|181246 PRK08136, PRK08136, glycosyl transferase family protein; Provisional. Length = 317 Score = 25.2 bits (56), Expect = 9.5 Identities = 8/21 (38%), Positives = 13/21 (61%) Query: 26 DLFSAMIPNRVSIVMLGSFLL 46 L+ AM+ RV + LG+ L+ Sbjct: 27 ALYGAMLDGRVPDLELGAILI 47 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.337 0.149 0.463 Gapped Lambda K H 0.267 0.0744 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,948,989 Number of extensions: 195689 Number of successful extensions: 1233 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1208 Number of HSP's successfully gapped: 186 Length of query: 176 Length of database: 5,994,473 Length adjustment: 87 Effective length of query: 89 Effective length of database: 4,114,577 Effective search space: 366197353 Effective search space used: 366197353 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.7 bits) S2: 54 (24.5 bits)