BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780729|ref|YP_003065142.1| peptidase A24A prepilin type IV [Candidatus Liberibacter asiaticus str. psy62] (176 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780729|ref|YP_003065142.1| peptidase A24A prepilin type IV [Candidatus Liberibacter asiaticus str. psy62] Length = 176 Score = 341 bits (875), Expect = 4e-96, Method: Compositional matrix adjust. Identities = 176/176 (100%), Positives = 176/176 (100%) Query: 1 MKESKMVFSAVFLIPPFCLVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIAL 60 MKESKMVFSAVFLIPPFCLVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIAL Sbjct: 1 MKESKMVFSAVFLIPPFCLVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIAL 60 Query: 61 HLLVGLIVFIICFCFFAFNIMGGGDVKLLTSTAVWFGWTPSFLSFLFFVAILGGILSVFI 120 HLLVGLIVFIICFCFFAFNIMGGGDVKLLTSTAVWFGWTPSFLSFLFFVAILGGILSVFI Sbjct: 61 HLLVGLIVFIICFCFFAFNIMGGGDVKLLTSTAVWFGWTPSFLSFLFFVAILGGILSVFI 120 Query: 121 LTVRMITNHIPIFGMFVPKSFLMKNKIPYGIAISMGGLISYPDSYLFKVALMGLSA 176 LTVRMITNHIPIFGMFVPKSFLMKNKIPYGIAISMGGLISYPDSYLFKVALMGLSA Sbjct: 121 LTVRMITNHIPIFGMFVPKSFLMKNKIPYGIAISMGGLISYPDSYLFKVALMGLSA 176 >gi|254780442|ref|YP_003064855.1| pyruvate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 480 Score = 23.1 bits (48), Expect = 3.1, Method: Compositional matrix adjust. Identities = 12/29 (41%), Positives = 19/29 (65%) Query: 143 MKNKIPYGIAISMGGLISYPDSYLFKVAL 171 +K K+ GI+I+ IS+PD++L AL Sbjct: 143 IKCKVIAGISIADRKGISFPDTFLTTQAL 171 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.337 0.149 0.463 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 110,839 Number of Sequences: 1233 Number of extensions: 4513 Number of successful extensions: 19 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 8 length of query: 176 length of database: 328,796 effective HSP length: 68 effective length of query: 108 effective length of database: 244,952 effective search space: 26454816 effective search space used: 26454816 T: 11 A: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.7 bits) S2: 35 (18.1 bits)