RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780730|ref|YP_003065143.1| hypothetical protein CLIBASIA_03085 [Candidatus Liberibacter asiaticus str. psy62] (120 letters) >gnl|CDD|185477 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional. Length = 418 Score = 30.8 bits (70), Expect = 0.096 Identities = 13/65 (20%), Positives = 19/65 (29%), Gaps = 1/65 (1%) Query: 53 ELDKGDVPPTKPGSVPMQPESSNPSTRLQPPAKPTSIPVKTKSSKKSPK-RIQSPAKNKK 111 E+D G PP + ++ + A PT P + PA K Sbjct: 117 EIDTGGAPPAAAPAAAAAAKAEKTTPEKPKAAAPTPEPPAASKPTPPAAAKPPEPAPAAK 176 Query: 112 SYVKP 116 P Sbjct: 177 PPPTP 181 >gnl|CDD|150640 pfam09990, DUF2231, Predicted membrane protein (DUF2231). This domain, found in various hypothetical bacterial proteins, has no known function. Length = 100 Score = 29.1 bits (66), Expect = 0.29 Identities = 10/27 (37%), Positives = 13/27 (48%) Query: 21 YGLLASLVSVAIISAVSTLGDRMKGVY 47 GL SLV VA++ LG + Y Sbjct: 71 SGLALSLVVVALLGVQGWLGGELVYRY 97 >gnl|CDD|183848 PRK13024, PRK13024, bifunctional preprotein translocase subunit SecD/SecF; Reviewed. Length = 755 Score = 27.9 bits (63), Expect = 0.75 Identities = 9/37 (24%), Positives = 19/37 (51%) Query: 15 GATAIEYGLLASLVSVAIISAVSTLGDRMKGVYQTIS 51 G AI+ G++A ++ A+I + + G+ I+ Sbjct: 261 GQDAIDAGIIAGIIGFALIFLFMLVYYGLPGLIANIA 297 >gnl|CDD|130566 TIGR01502, B_methylAsp_ase, methylaspartate ammonia-lyase. This model describes methylaspartate ammonia-lyase, also called beta-methylaspartase (EC 4.3.1.2). It follows methylaspartate mutase (composed of S and E subunits) in one of several possible pathways of glutamate fermentation. Length = 408 Score = 26.4 bits (58), Expect = 1.7 Identities = 18/69 (26%), Positives = 32/69 (46%), Gaps = 11/69 (15%) Query: 5 IIKKILKNGSGATAIEYGLLASLVSVAIISAVSTLGDRMKGVYQTISTELDKGDVPPTKP 64 + +K+ N + TAI YG VS A++ A + R + + I E + P + Sbjct: 114 VFEKMTVNRNLHTAIRYG-----VSQALLDAAAKT--RKTTMAEVIRDEYN----PGAET 162 Query: 65 GSVPMQPES 73 +VP+ +S Sbjct: 163 NAVPVFAQS 171 >gnl|CDD|173181 PRK14718, PRK14718, ribonuclease III; Provisional. Length = 467 Score = 26.3 bits (57), Expect = 1.8 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 7/66 (10%) Query: 54 LDKGDVPPTKPGSVPMQPESSNPSTRLQPPAKPTSIPVKTKSSKKSPKRIQSPAKNKKSY 113 LDKG+ +KP P +T +PP K + P K+S+K+P + +K S Sbjct: 361 LDKGEPRASKPAEKPA------AATD-KPPEKASDKPSPEKTSEKTPDKSHEKQLDKSSE 413 Query: 114 VKPNKS 119 K+ Sbjct: 414 PVAEKA 419 >gnl|CDD|162310 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form. This model describes a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and per cent identity (UPGMA) trees. Members of this set include two or three copies of the lipoyl-binding domain. E. coli AceF is a member of this model, while mitochondrial and some other bacterial forms belong to a separate model. Length = 546 Score = 26.4 bits (58), Expect = 2.0 Identities = 14/53 (26%), Positives = 21/53 (39%), Gaps = 5/53 (9%) Query: 57 GDVPPTKPGSVPMQPESSNPSTRLQPPAKPTSIPVKTKSSKKSPKRIQSPAKN 109 G P T P QP + +P+ PA P K+ +P Q+ +N Sbjct: 193 GSTPATAPAPASAQPAAQSPAATQPEPAAA---PAAAKAQAPAP--QQAGTQN 240 >gnl|CDD|178158 PLN02543, PLN02543, pfkB-type carbohydrate kinase family protein. Length = 496 Score = 26.0 bits (57), Expect = 2.2 Identities = 14/60 (23%), Positives = 22/60 (36%), Gaps = 8/60 (13%) Query: 56 KGDVPPTKPGSVP--------MQPESSNPSTRLQPPAKPTSIPVKTKSSKKSPKRIQSPA 107 K + P+ S P PES PS R + +S P + +++ K Q Sbjct: 38 KASLHPSIKRSRPGRCSTNGAAVPESPKPSRRGRKKKPTSSPPKAKTTRRRTKKTDQELD 97 >gnl|CDD|183727 PRK12757, PRK12757, cell division protein FtsN; Provisional. Length = 256 Score = 25.4 bits (56), Expect = 3.4 Identities = 8/57 (14%), Positives = 20/57 (35%) Query: 63 KPGSVPMQPESSNPSTRLQPPAKPTSIPVKTKSSKKSPKRIQSPAKNKKSYVKPNKS 119 + + QP ++ + P + T+ PV+ ++ + +P K Sbjct: 122 QQQAQQQQPPATTAQPQPVTPPRQTTAPVQPQTPAPVRTQPAAPVTQAVEAPKVEAE 178 >gnl|CDD|184912 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional. Length = 620 Score = 25.3 bits (56), Expect = 3.6 Identities = 12/47 (25%), Positives = 18/47 (38%) Query: 60 PPTKPGSVPMQPESSNPSTRLQPPAKPTSIPVKTKSSKKSPKRIQSP 106 PP P P ++ + Q PA + P + SP + SP Sbjct: 548 PPPTPPPPPPTATQASSNAPAQIPADSSPPPPIPEEPTPSPTKDSSP 594 >gnl|CDD|150740 pfam10100, DUF2338, Uncharacterized protein conserved in bacteria (DUF2338). Members of this family of hypothetical bacterial proteins have no known function. Length = 429 Score = 25.5 bits (56), Expect = 3.7 Identities = 10/44 (22%), Positives = 19/44 (43%) Query: 7 KKILKNGSGATAIEYGLLASLVSVAIISAVSTLGDRMKGVYQTI 50 K+L G+G AI+ + L A + R K +++ + Sbjct: 2 SKVLILGTGPVAIQLAVDLKLHGDARLGIAGRPSTRSKRLFEAL 45 >gnl|CDD|182271 PRK10153, PRK10153, DNA-binding transcriptional activator CadC; Provisional. Length = 517 Score = 25.4 bits (56), Expect = 3.7 Identities = 10/40 (25%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Query: 61 PTKPGSVPMQPESSNPSTR--LQPPAKPTSIPVKTKSSKK 98 + P P ++ PS Q PA P + V +K Sbjct: 118 SSPPPIPEAVPATAEPSESANAQFPAPPLTRAVCQSPAKS 157 >gnl|CDD|162151 TIGR00996, Mtu_fam_mce, virulence factor Mce family protein. Members of this paralogous family are found as six tandem homologous proteins in the same orientation per cassette, in four separate cassettes in Mycobacterium tuberculosis. The six members of each cassette represent six subfamilies. One subfamily includes the protein mce (mycobacterial cell entry), a virulence protein required for invasion of non-phagocytic cells. Length = 291 Score = 25.3 bits (56), Expect = 3.9 Identities = 21/81 (25%), Positives = 31/81 (38%), Gaps = 15/81 (18%) Query: 6 IKKILKNGSGAT---AIEYGLLASLVSVAIISAVSTLGDRMKGVYQTISTELDKGDVPPT 62 + I G+GA +++ G+ + A I + + LG R EL PP Sbjct: 61 VTAISLPGNGARVTFSLDRGVTIPANATAAIRSTTLLGSR--------YVEL----TPPK 108 Query: 63 KPGSVPMQPESSNPSTRLQPP 83 PG P+ P P R P Sbjct: 109 GPGGPPLPPGGVIPLARTSVP 129 >gnl|CDD|165506 PHA03247, PHA03247, large tegument protein UL36; Provisional. Length = 3151 Score = 25.3 bits (55), Expect = 3.9 Identities = 11/53 (20%), Positives = 16/53 (30%) Query: 64 PGSVPMQPESSNPSTRLQPPAKPTSIPVKTKSSKKSPKRIQSPAKNKKSYVKP 116 P SVP + P++ PPA P +P + P Sbjct: 412 PASVPTPAPTPVPASAPPPPATPLPSAEPGSDDGPAPPPERQPPAPATEPAPD 464 Score = 24.1 bits (52), Expect = 7.9 Identities = 8/36 (22%), Positives = 12/36 (33%) Query: 55 DKGDVPPTKPGSVPMQPESSNPSTRLQPPAKPTSIP 90 D D P P +++P+ L PP Sbjct: 2803 DPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPTA 2838 >gnl|CDD|151262 pfam10812, DUF2561, Protein of unknown function (DUF2561). This family of proteins with unknown function appears to be restricted to Mycobacterium spp. Length = 207 Score = 25.2 bits (55), Expect = 3.9 Identities = 14/80 (17%), Positives = 25/80 (31%), Gaps = 9/80 (11%) Query: 28 VSVAIISAVSTLGDRMKGVYQTISTELDKGDVPPTKPGSVPMQPESSNPSTRLQPPAKPT 87 VS +I+ L R + + D PP + + +P + + Sbjct: 72 VSALVIAGAVPLLLRARRMAD---------DEPPPRSQGLRRRPGQPVRAGYAAARTEKE 122 Query: 88 SIPVKTKSSKKSPKRIQSPA 107 S+P S+ S A Sbjct: 123 SVPATHAPSRTDAGEWSSAA 142 >gnl|CDD|183479 PRK12373, PRK12373, NADH dehydrogenase subunit E; Provisional. Length = 400 Score = 24.8 bits (54), Expect = 5.2 Identities = 13/55 (23%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 63 KPGSVPMQPESSNPSTRLQPPAKPTSIPVKTKSSKKSPKRIQ-SPAKNKKSYVKP 116 P P Q +++ A+P S +T ++ K+P + AKN K+ Sbjct: 228 VPLLAPWQGDAAPVPP--SEAARPKSADAETNAALKTPATAPKAAAKNAKAPEAQ 280 >gnl|CDD|184793 PRK14696, tynA, tyramine oxidase; Provisional. Length = 721 Score = 24.8 bits (54), Expect = 5.2 Identities = 8/23 (34%), Positives = 10/23 (43%) Query: 67 VPMQPESSNPSTRLQPPAKPTSI 89 VPM + R+ P KP I Sbjct: 280 VPMTARPYDGRDRVAPAVKPLQI 302 >gnl|CDD|185300 PRK15402, PRK15402, multidrug efflux system translocase MdfA; Provisional. Length = 406 Score = 24.9 bits (55), Expect = 5.3 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Query: 9 ILKNGSGATAIEYGLLASLVSVAIISAVSTLG---DRMKGVYQTI 50 IL +G ++ EYGLL V A+I+ TL R + I Sbjct: 241 ILISGEQLSSYEYGLLQVPVFGALIAGNLTLARLTSRRP-LRSLI 284 >gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional. Length = 943 Score = 24.7 bits (53), Expect = 6.3 Identities = 20/64 (31%), Positives = 26/64 (40%), Gaps = 6/64 (9%) Query: 61 PTKPGSVPMQPESSNPSTRLQPPAKPTS--IPVKTKSSK--KSPKRIQSPAKNKKSYVKP 116 P P P PE R + +PT P + KSPKR +SP K+ K P Sbjct: 582 PKDPKH-PKDPEEPKKPKRPRSAQRPTRPKSPKLPELLDIPKSPKRPESP-KSPKRPPPP 639 Query: 117 NKSS 120 + S Sbjct: 640 QRPS 643 >gnl|CDD|168338 PRK05996, motB, flagellar motor protein MotB; Validated. Length = 423 Score = 24.7 bits (54), Expect = 7.0 Identities = 10/30 (33%), Positives = 14/30 (46%) Query: 90 PVKTKSSKKSPKRIQSPAKNKKSYVKPNKS 119 P+K K S K ++ P + KP KS Sbjct: 70 PIKLTDRKPSEKGLKDPVDGAEGEQKPGKS 99 >gnl|CDD|129053 smart00817, Amelin, Ameloblastin precursor (Amelin). This family consists of several mammalian Ameloblastin precursor (Amelin) proteins. Matrix proteins of tooth enamel consist mainly of amelogenin but also of non-amelogenin proteins, which, although their volumetric percentage is low, have an important role in enamel mineralisation. One of the non-amelogenin proteins is ameloblastin, also known as amelin and sheathlin. Ameloblastin (AMBN) is one of the enamel sheath proteins which is though to have a role in determining the prismatic structure of growing enamel crystals. Length = 411 Score = 24.5 bits (53), Expect = 7.3 Identities = 11/28 (39%), Positives = 13/28 (46%) Query: 60 PPTKPGSVPMQPESSNPSTRLQPPAKPT 87 PP P +QP+ LQP A PT Sbjct: 97 PPPLPSQPSLQPQQPGLKPFLQPTALPT 124 >gnl|CDD|149670 pfam08688, ASD1, Apx/Shroom domain ASD1. This region is found in the actin binding protein Shroom which mediates apical contriction in epithelial cells and is required for neural tube closure. ASD1 has been implicated directly in F-actin binding. Length = 181 Score = 24.5 bits (53), Expect = 7.6 Identities = 13/55 (23%), Positives = 23/55 (41%) Query: 64 PGSVPMQPESSNPSTRLQPPAKPTSIPVKTKSSKKSPKRIQSPAKNKKSYVKPNK 118 S P +P + KP+ K + S+ ++ + + KKSY +P K Sbjct: 90 LSSAPSEPAHTPRFNSEGLAKKPSVTVAKPQVSRIGGRKRFTAEQKKKSYSEPEK 144 >gnl|CDD|162214 TIGR01129, secD, protein-export membrane protein SecD. SecD from Mycobacterium tuberculosis has a long Pro-rich insert. Length = 397 Score = 24.6 bits (54), Expect = 7.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Query: 15 GATAIEYGLLASLVSVAIISAVSTLGDRMKGVYQTIS 51 GA +IE G+ A L+ + ++ L R+ G+ I+ Sbjct: 243 GADSIEAGIKAGLIGLVLVLVFMILYYRLFGLIAAIA 279 >gnl|CDD|179871 PRK04663, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional. Length = 438 Score = 24.4 bits (53), Expect = 7.8 Identities = 7/23 (30%), Positives = 13/23 (56%) Query: 37 STLGDRMKGVYQTISTELDKGDV 59 + D M+ ++IS +L GD+ Sbjct: 385 ARRFDTMEDAIESISPQLKSGDM 407 >gnl|CDD|184914 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional. Length = 585 Score = 24.0 bits (52), Expect = 9.2 Identities = 10/60 (16%), Positives = 15/60 (25%) Query: 60 PPTKPGSVPMQPESSNPSTRLQPPAKPTSIPVKTKSSKKSPKRIQSPAKNKKSYVKPNKS 119 E++ P P P + K + I K K + P K Sbjct: 393 AAANIPPKEPVRETATPPPVPPRPVAPPVPHTPESAPKLTRAAIPVDEKPKYTPPAPPKE 452 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.305 0.123 0.329 Gapped Lambda K H 0.267 0.0448 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,769,654 Number of extensions: 93213 Number of successful extensions: 245 Number of sequences better than 10.0: 1 Number of HSP's gapped: 235 Number of HSP's successfully gapped: 77 Length of query: 120 Length of database: 5,994,473 Length adjustment: 81 Effective length of query: 39 Effective length of database: 4,244,225 Effective search space: 165524775 Effective search space used: 165524775 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.9 bits) S2: 51 (24.1 bits)