RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780732|ref|YP_003065145.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter asiaticus str. psy62] (58 letters) >gnl|CDD|113726 pfam04964, Flp_Fap, Flp/Fap pilin component. Length = 47 Score = 54.9 bits (133), Expect = 4e-09 Identities = 31/46 (67%), Positives = 35/46 (76%) Query: 9 FLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADISSKL 54 FL+DESGATAIEYGL+A+LIAV IIA VTTLG L F I + L Sbjct: 1 FLKDESGATAIEYGLIAALIAVVIIAYVTTLGTALKTKFTSIGTAL 46 >gnl|CDD|33638 COG3847, Flp, Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion]. Length = 58 Score = 54.5 bits (131), Expect = 7e-09 Identities = 28/53 (52%), Positives = 36/53 (67%) Query: 3 MHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADISSKLN 55 +++ FL+DE GATAIEYGL+A+LIAV IIA +TLG L F I + L Sbjct: 2 KKLLRRFLRDEDGATAIEYGLIAALIAVVIIAGGSTLGTALKGAFTAIGAALT 54 >gnl|CDD|100093 cd05800, PGM_like2, This PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily and is found in both archaea and bacteria. The alpha-D-phosphohexomutases include several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four structural domains (subdomains) with a centrally located active site formed by four loops, one from each subdomain. All four subdomains are included in this alignment model.. Length = 461 Score = 27.5 bits (62), Expect = 0.82 Identities = 9/35 (25%), Positives = 18/35 (51%), Gaps = 3/35 (8%) Query: 22 GLLASLIAVAIIASVTTLGGKLTAVFADISSKLNP 56 G+LA L+ + +A G L+ + A++ + P Sbjct: 342 GILAGLLLLEAVA---KTGKPLSELVAELEEEYGP 373 >gnl|CDD|34568 COG4961, TadG, Flp pilus assembly protein TadG [Intracellular trafficking and secretion]. Length = 185 Score = 27.0 bits (59), Expect = 1.3 Identities = 9/33 (27%), Positives = 19/33 (57%) Query: 4 HIVKNFLQDESGATAIEYGLLASLIAVAIIASV 36 +++ F +D GA A+E+ L+A + + + V Sbjct: 10 GLLRRFRRDRRGAAAVEFALVAPPLLLLVFGIV 42 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.130 0.338 Gapped Lambda K H 0.267 0.0631 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 563,411 Number of extensions: 18862 Number of successful extensions: 63 Number of sequences better than 10.0: 1 Number of HSP's gapped: 63 Number of HSP's successfully gapped: 9 Length of query: 58 Length of database: 6,263,737 Length adjustment: 30 Effective length of query: 28 Effective length of database: 5,615,467 Effective search space: 157233076 Effective search space used: 157233076 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.6 bits)