RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780732|ref|YP_003065145.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter asiaticus str. psy62] (58 letters) >gnl|CDD|183848 PRK13024, PRK13024, bifunctional preprotein translocase subunit SecD/SecF; Reviewed. Length = 755 Score = 25.6 bits (57), Expect = 2.8 Identities = 8/20 (40%), Positives = 13/20 (65%) Query: 15 GATAIEYGLLASLIAVAIIA 34 G AI+ G++A +I A+I Sbjct: 261 GQDAIDAGIIAGIIGFALIF 280 >gnl|CDD|150640 pfam09990, DUF2231, Predicted membrane protein (DUF2231). This domain, found in various hypothetical bacterial proteins, has no known function. Length = 100 Score = 24.4 bits (54), Expect = 6.9 Identities = 10/27 (37%), Positives = 15/27 (55%) Query: 21 YGLLASLIAVAIIASVTTLGGKLTAVF 47 GL SL+ VA++ LGG+L + Sbjct: 71 SGLALSLVVVALLGVQGWLGGELVYRY 97 >gnl|CDD|162214 TIGR01129, secD, protein-export membrane protein SecD. SecD from Mycobacterium tuberculosis has a long Pro-rich insert. Length = 397 Score = 24.2 bits (53), Expect = 9.1 Identities = 13/41 (31%), Positives = 22/41 (53%) Query: 15 GATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADISSKLN 55 GA +IE G+ A LI + ++ L +L + A I+ +N Sbjct: 243 GADSIEAGIKAGLIGLVLVLVFMILYYRLFGLIAAIALVIN 283 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.317 0.130 0.338 Gapped Lambda K H 0.267 0.0741 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 837,242 Number of extensions: 36622 Number of successful extensions: 125 Number of sequences better than 10.0: 1 Number of HSP's gapped: 125 Number of HSP's successfully gapped: 21 Length of query: 58 Length of database: 5,994,473 Length adjustment: 30 Effective length of query: 28 Effective length of database: 5,346,233 Effective search space: 149694524 Effective search space used: 149694524 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.0 bits)