BLAST/PSIBLAST alignment of GI: 254780734 and GI: 315121897 at iteration 1
>gi|315121897|ref|YP_004062386.1| hypothetical protein CKC_00735 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 64
>gi|313495299|gb|ADR51898.1| hypothetical protein CKC_00735 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 64
 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 49/64 (76%), Gaps = 2/64 (3%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV--TTS 58
          MK++I++NFLQDESGATAIEYGLL +L++VVII +VTTLG KL   F  + ++ +   T+
Sbjct: 1  MKINIIRNFLQDESGATAIEYGLLAALVSVVIIGAVTTLGTKLSATFAKVGESFLPGPTA 60

Query: 59 PAAS 62
          P  S
Sbjct: 61 PGRS 64