BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780734|ref|YP_003065147.1| Flp/Fap pilin component
[Candidatus Liberibacter asiaticus str. psy62]
         (62 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780734|ref|YP_003065147.1| Flp/Fap pilin component [Candidatus Liberibacter asiaticus str.
          psy62]
 gi|254040411|gb|ACT57207.1| Flp/Fap pilin component [Candidatus Liberibacter asiaticus str.
          psy62]
          Length = 62

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/62 (100%), Positives = 62/62 (100%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA
Sbjct: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60

Query: 61 AS 62
          AS
Sbjct: 61 AS 62


>gi|254780733|ref|YP_003065146.1| hypothetical protein CLIBASIA_03100 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040410|gb|ACT57206.1| hypothetical protein CLIBASIA_03100 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 56

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/54 (79%), Positives = 47/54 (87%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          MKM+IVK+FL+DESGATAIEYGLL SLIAV II SVTTLGGKL K FE I+K I
Sbjct: 1  MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIEKGI 54


>gi|254780732|ref|YP_003065145.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040409|gb|ACT57205.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 58

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 42/50 (84%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          MKMHIVKNFLQDESGATAIEYGLL SLIAV II SVTTLGGKL   F  I
Sbjct: 1  MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADI 50


>gi|315121897|ref|YP_004062386.1| hypothetical protein CKC_00735 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
 gi|313495299|gb|ADR51898.1| hypothetical protein CKC_00735 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
          Length = 64

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 49/64 (76%), Gaps = 2/64 (3%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV--TTS 58
          MK++I++NFLQDESGATAIEYGLL +L++VVII +VTTLG KL   F  + ++ +   T+
Sbjct: 1  MKINIIRNFLQDESGATAIEYGLLAALVSVVIIGAVTTLGTKLSATFAKVGESFLPGPTA 60

Query: 59 PAAS 62
          P  S
Sbjct: 61 PGRS 64


>gi|167648155|ref|YP_001685818.1| Flp/Fap pilin component [Caulobacter sp. K31]
 gi|167350585|gb|ABZ73320.1| Flp/Fap pilin component [Caulobacter sp. K31]
          Length = 61

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 42/57 (73%), Gaps = 1/57 (1%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI-VTTSPAA 61
          V  FL DESGATAIEYGL+V+LIAVVI T VTTLGG LK  F+ +D ++     PAA
Sbjct: 5  VTRFLNDESGATAIEYGLIVALIAVVIATVVTTLGGSLKTTFKNVDDSVKAANGPAA 61


>gi|16127178|ref|NP_421742.1| pilus subunit protein PilA [Caulobacter crescentus CB15]
 gi|221235979|ref|YP_002518416.1| type IV pilin protein pilA [Caulobacter crescentus NA1000]
 gi|7208422|gb|AAF40189.1|AF229646_1 PilA [Caulobacter crescentus CB15]
 gi|13424576|gb|AAK24910.1| pilus subunit protein PilA [Caulobacter crescentus CB15]
 gi|220965152|gb|ACL96508.1| type IV pilin protein pilA [Caulobacter crescentus NA1000]
          Length = 59

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/51 (64%), Positives = 40/51 (78%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          V  FL+DESGATAIEYGL+V+LIAVVI+T+VTTLG  L+ AF     A+ T
Sbjct: 5  VTRFLKDESGATAIEYGLIVALIAVVIVTAVTTLGTNLRTAFTKAGAAVST 55


>gi|295690802|ref|YP_003594495.1| Flp/Fap pilin component [Caulobacter segnis ATCC 21756]
 gi|295432705|gb|ADG11877.1| Flp/Fap pilin component [Caulobacter segnis ATCC 21756]
          Length = 59

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 4/53 (7%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF----EAIDK 52
            V  FL+DESGATAIEYGL+V+LIAVVI+T+VTTLG KL  AF    +AI+K
Sbjct: 3  KFVTRFLKDESGATAIEYGLIVALIAVVIVTAVTTLGTKLGTAFGKAGDAIEK 55


>gi|254780730|ref|YP_003065143.1| hypothetical protein CLIBASIA_03085 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040407|gb|ACT57203.1| hypothetical protein CLIBASIA_03085 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 120

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 41/50 (82%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          MKM+I+K  L++ SGATAIEYGLL SL++V II++V+TLG ++K  ++ I
Sbjct: 1  MKMNIIKKILKNGSGATAIEYGLLASLVSVAIISAVSTLGDRMKGVYQTI 50


>gi|83859354|ref|ZP_00952875.1| hypothetical protein OA2633_13155 [Oceanicaulis alexandrii
          HTCC2633]
 gi|83852801|gb|EAP90654.1| hypothetical protein OA2633_13155 [Oceanicaulis alexandrii
          HTCC2633]
          Length = 69

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (71%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          ++V  FL+DESGATAIEYGL+ +LIAVVIIT+VTTLG  L   F  +   + T + A
Sbjct: 3  NLVSRFLKDESGATAIEYGLIAALIAVVIITAVTTLGTNLSTTFTNVGTQLSTANSA 59


>gi|220923697|ref|YP_002498999.1| Flp/Fap pilin protein [Methylobacterium nodulans ORS 2060]
 gi|219948304|gb|ACL58696.1| Flp/Fap pilin component [Methylobacterium nodulans ORS 2060]
          Length = 54

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 39/51 (76%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++   F++DESGATAIEYGL+  LIAVVIIT+VTT+G +L   F AI  A+
Sbjct: 3  NLFTRFVKDESGATAIEYGLIAGLIAVVIITAVTTIGTRLNTKFTAIGTAL 53


>gi|33593020|ref|NP_880664.1| hypothetical protein BP1991 [Bordetella pertussis Tohama I]
 gi|33563395|emb|CAE42271.1| putative membrane protein [Bordetella pertussis Tohama I]
 gi|332382432|gb|AEE67279.1| hypothetical protein BPTD_1961 [Bordetella pertussis CS]
          Length = 58

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          +KNF +DE GATAIEYGL+V LIAVVII SV+ LG  LK  F+ I   +   +P
Sbjct: 5  LKNFWRDEEGATAIEYGLIVGLIAVVIIGSVSLLGETLKGFFDTIQTELSAEAP 58


>gi|33596964|ref|NP_884607.1| hypothetical protein BPP2371 [Bordetella parapertussis 12822]
 gi|33600806|ref|NP_888366.1| hypothetical protein BB1821 [Bordetella bronchiseptica RB50]
 gi|33566415|emb|CAE37668.1| putative membrane protein [Bordetella parapertussis]
 gi|33568406|emb|CAE32318.1| putative membrane protein [Bordetella bronchiseptica RB50]
          Length = 58

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (68%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          +KNF  DE GATAIEYGL+V LIAVVII SV+ LG  LK  F+ I   +   +P
Sbjct: 5  LKNFWHDEEGATAIEYGLIVGLIAVVIIGSVSLLGETLKGFFDTIQTELSAEAP 58


>gi|90423865|ref|YP_532235.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB18]
 gi|90105879|gb|ABD87916.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB18]
          Length = 60

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 39/56 (69%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          +IV  FL+DESGATAIEYGL+ SLIA+ IIT++TT+G  L      +  A+ T  P
Sbjct: 3  NIVMKFLKDESGATAIEYGLIASLIALAIITALTTIGSNLSTKLGEVGAALTTPEP 58


>gi|159184218|ref|NP_353257.2| components of type IV pilus, pilin subunit [Agrobacterium
          tumefaciens str. C58]
 gi|159139547|gb|AAK86042.2| components of type IV pilus, pilin subunit [Agrobacterium
          tumefaciens str. C58]
          Length = 63

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 33/59 (55%), Positives = 41/59 (69%), Gaps = 1/59 (1%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
           I   FL+DESGATAIEYGL+ +LI+V II   +TLGGKLK  F  I K+  T S A++
Sbjct: 3  KIFARFLKDESGATAIEYGLIAALISVAIIGGASTLGGKLKDTFTFIGKSF-TDSKAST 60


>gi|187479019|ref|YP_787043.1| pilin subunit [Bordetella avium 197N]
 gi|115423605|emb|CAJ50144.1| putative pilin subunit [Bordetella avium 197N]
          Length = 71

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 1/55 (1%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT-SPAAS 62
          F +DE GATAIEYGL+  LIAVVII  +T LGG L   F  I+ A++   +PA+S
Sbjct: 8  FWRDEDGATAIEYGLIAGLIAVVIIAGLTALGGGLNGLFTRINNALINVGTPASS 62


>gi|161524909|ref|YP_001579921.1| Flp/Fap pilin component [Burkholderia multivorans ATCC 17616]
 gi|189350341|ref|YP_001945969.1| putative fimbriae assembly-related protein [Burkholderia
          multivorans ATCC 17616]
 gi|160342338|gb|ABX15424.1| Flp/Fap pilin component [Burkholderia multivorans ATCC 17616]
 gi|189334363|dbj|BAG43433.1| putative fimbriae assembly-related protein [Burkholderia
          multivorans ATCC 17616]
          Length = 69

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 37/54 (68%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          I+K FL++E G TAIEYGL+  LIAV II SV+T+G KL   FE I   + + S
Sbjct: 4  IIKCFLKEEDGVTAIEYGLIAGLIAVAIIASVSTIGSKLGTMFENISSCVSSPS 57


>gi|17549313|ref|NP_522653.1| putative pilin protein [Ralstonia solanacearum GMI1000]
 gi|17431565|emb|CAD18243.1| putative pilin protein [Ralstonia solanacearum GMI1000]
          Length = 58

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 36/51 (70%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          H +  FL+DE GATAIEYGLL  LIA VI  +VTTLG ++K AF  +  AI
Sbjct: 3  HAILQFLRDEQGATAIEYGLLAGLIAAVIAGTVTTLGTEIKTAFGNVCTAI 53


>gi|325291662|ref|YP_004277526.1| components of type IV pilus, pilin subunit [Agrobacterium sp.
          H13-3]
 gi|325059515|gb|ADY63206.1| components of type IV pilus, pilin subunit [Agrobacterium sp.
          H13-3]
          Length = 62

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          I   FL+DESGATAIEYGL+ +LI+V II   T +G +L   F A+ + I   +PAA+
Sbjct: 4  IFTRFLKDESGATAIEYGLIAALISVAIIGGATAVGTRLNAFFTALSQRINANAPAAT 61


>gi|152983319|ref|YP_001355010.1| pilus subunit protein PilA [Janthinobacterium sp. Marseille]
 gi|151283396|gb|ABR91806.1| pilus subunit protein PilA [Janthinobacterium sp. Marseille]
          Length = 59

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 39/56 (69%), Gaps = 1/56 (1%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          MK  I++ F++DE GATAIEYGL+V LI+VVI  SV  +GG L+  F  I  A+ T
Sbjct: 1  MKNQIIR-FMKDEEGATAIEYGLIVGLISVVIAVSVGLIGGNLQTLFTNISNALAT 55


>gi|315497469|ref|YP_004086273.1| flp/fap pilin component [Asticcacaulis excentricus CB 48]
 gi|315415481|gb|ADU12122.1| Flp/Fap pilin component [Asticcacaulis excentricus CB 48]
          Length = 57

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +++KNF  DESGATAIEYGL+ +LIAV +IT++  LG  L   F+ +   +V  S
Sbjct: 3  NLIKNFANDESGATAIEYGLIAALIAVALITTLGALGKNLDATFKGVSDKLVQAS 57


>gi|303247319|ref|ZP_07333592.1| Flp/Fap pilin component [Desulfovibrio fructosovorans JJ]
 gi|302491233|gb|EFL51122.1| Flp/Fap pilin component [Desulfovibrio fructosovorans JJ]
          Length = 56

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +  + NF+++E GATA+EYGL+ +LIA VI+T VTTLG  L   F++I  +I
Sbjct: 2  LRAITNFVRNEEGATAVEYGLMAALIAAVIVTVVTTLGQNLSTTFDSIATSI 53


>gi|221197777|ref|ZP_03570823.1| Flp/Fap pilin component [Burkholderia multivorans CGD2M]
 gi|221204665|ref|ZP_03577682.1| Flp/Fap pilin component [Burkholderia multivorans CGD2]
 gi|221175522|gb|EEE07952.1| Flp/Fap pilin component [Burkholderia multivorans CGD2]
 gi|221181709|gb|EEE14110.1| Flp/Fap pilin component [Burkholderia multivorans CGD2M]
          Length = 72

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 39/58 (67%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          I+K FL++E+G TAIEYGL+  LIAV I+  V+++GG L   F  + K I   S +A+
Sbjct: 4  IIKRFLKEETGVTAIEYGLIAGLIAVAIVAGVSSIGGSLGNMFNNLGKCITDPSNSAA 61


>gi|218680428|ref|ZP_03528325.1| Flp/Fap pilin component [Rhizobium etli CIAT 894]
          Length = 62

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          +   FL+DESGATAIEYGL+ +LI+V +IT  T+LGGK+   F  +   + T+  A+
Sbjct: 4  LFSRFLKDESGATAIEYGLIAALISVALITGATSLGGKIGNTFNGLSTKMDTSVTAS 60


>gi|241207154|ref|YP_002978250.1| Flp/Fap pilin component [Rhizobium leguminosarum bv. trifolii
          WSM1325]
 gi|240861044|gb|ACS58711.1| Flp/Fap pilin component [Rhizobium leguminosarum bv. trifolii
          WSM1325]
          Length = 62

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          +   FL+DESGATAIEYGL+ +LI+V +IT  T+LGGK+   F  +   + T+  A+
Sbjct: 4  LFSRFLKDESGATAIEYGLIAALISVALITGATSLGGKIGNVFNGLSTKMDTSVTAS 60


>gi|83747921|ref|ZP_00944953.1| putative pilin protein [Ralstonia solanacearum UW551]
 gi|207724793|ref|YP_002255190.1| pilin protein [Ralstonia solanacearum MolK2]
 gi|207739462|ref|YP_002257855.1| pilin protein [Ralstonia solanacearum IPO1609]
 gi|83725454|gb|EAP72600.1| putative pilin protein [Ralstonia solanacearum UW551]
 gi|206590018|emb|CAQ36979.1| pilin protein [Ralstonia solanacearum MolK2]
 gi|206592838|emb|CAQ59744.1| pilin protein [Ralstonia solanacearum IPO1609]
          Length = 58

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 36/51 (70%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          H +  FL+DE GATAIEYGL+  LIA VI  +VTTLG ++K AF  +  AI
Sbjct: 3  HAILKFLRDEQGATAIEYGLIAGLIAAVIAGTVTTLGTEIKTAFGNVCSAI 53


>gi|300697746|ref|YP_003748407.1| Flp/Fap pilin component [Ralstonia solanacearum CFBP2957]
 gi|299074470|emb|CBJ54020.1| putative Flp/Fap pilin component [Ralstonia solanacearum
          CFBP2957]
          Length = 58

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 36/51 (70%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          H +  FL+DE GATAIEYGL+  LIA VI  +VTTLG ++K AF  +  AI
Sbjct: 3  HAILKFLRDEQGATAIEYGLIAGLIAAVIAGTVTTLGTEIKTAFGNVCTAI 53


>gi|209551756|ref|YP_002283673.1| Flp/Fap pilin component [Rhizobium leguminosarum bv. trifolii
          WSM2304]
 gi|209537512|gb|ACI57447.1| Flp/Fap pilin component [Rhizobium leguminosarum bv. trifolii
          WSM2304]
          Length = 61

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 38/58 (65%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          +   FL+DESGATAIEYGL+ +LI+V +IT  T LGGK+   F  +   +   + AA+
Sbjct: 4  LFSRFLKDESGATAIEYGLIAALISVALITGATALGGKIGNTFNGLSTKMDGATSAAN 61


>gi|113866749|ref|YP_725238.1| flp pilus assembly protein, pilin Flp [Ralstonia eutropha H16]
 gi|113525525|emb|CAJ91870.1| flp pilus assembly protein, pilin Flp [Ralstonia eutropha H16]
          Length = 62

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          ++K F++DE G TAIEYGL+ +LIAVVII SVT +G  L   F+ I   +    PA
Sbjct: 7  MIKQFIRDEDGVTAIEYGLIAALIAVVIIVSVTLIGTNLNLIFKYIGDTLTNAVPA 62


>gi|302381760|ref|YP_003817583.1| Flp/Fap pilin component [Brevundimonas subvibrioides ATCC 15264]
 gi|302192388|gb|ADK99959.1| Flp/Fap pilin component [Brevundimonas subvibrioides ATCC 15264]
          Length = 55

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +  F QDESGATAIEYGL+ +LIAVVII ++TTLG K+   F  +  A+
Sbjct: 5  ITKFAQDESGATAIEYGLIAALIAVVIIGAITTLGTKITGTFTKVANAM 53


>gi|288956966|ref|YP_003447307.1| Flp/Fap pilin component [Azospirillum sp. B510]
 gi|288909274|dbj|BAI70763.1| Flp/Fap pilin component [Azospirillum sp. B510]
          Length = 75

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (63%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          I++   +D+ GATAIEYGLL +LIAV II  V+ +GG L   F AI   I   +P
Sbjct: 20 ILRRLRKDDRGATAIEYGLLAALIAVAIIGGVSAVGGNLNSMFNAISSKISAKTP 74


>gi|224824209|ref|ZP_03697317.1| Flp/Fap pilin component [Lutiella nitroferrum 2002]
 gi|224603628|gb|EEG09803.1| Flp/Fap pilin component [Lutiella nitroferrum 2002]
          Length = 66

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 35/51 (68%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          +K F QDE G TAIEYGL+ +LIAVVIITSV  +G +L   F  I  A+ T
Sbjct: 14 LKQFTQDEEGVTAIEYGLIAALIAVVIITSVQAVGNQLSLVFNNIATALNT 64


>gi|254293211|ref|YP_003059234.1| Flp/Fap pilin component [Hirschia baltica ATCC 49814]
 gi|254041742|gb|ACT58537.1| Flp/Fap pilin component [Hirschia baltica ATCC 49814]
          Length = 59

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 39/52 (75%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          +++K F +DESGATAIEYGL+ +LI+V II  V+T+G K    F+A+ + +V
Sbjct: 3  NLMKKFFKDESGATAIEYGLIAALISVAIIGGVSTVGTKTSATFDAVSEKLV 54


>gi|222084465|ref|YP_002542994.1| component of type IV pilus [Agrobacterium radiobacter K84]
 gi|221721913|gb|ACM25069.1| component of type IV pilus [Agrobacterium radiobacter K84]
          Length = 60

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 35/56 (62%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          +   FL+DESGATAIEYGL+ +LI+V II   TTLG  L   F  I   + T S A
Sbjct: 4  LFSRFLKDESGATAIEYGLIAALISVAIIAGATTLGNTLSTTFNGISTKMNTASVA 59


>gi|134295591|ref|YP_001119326.1| Flp/Fap pilin component [Burkholderia vietnamiensis G4]
 gi|134138748|gb|ABO54491.1| Flp/Fap pilin component [Burkholderia vietnamiensis G4]
          Length = 91

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          ++K FL++E+G TAIEYGL+  L+AV II  V++LGG L   F +I   + +   A++
Sbjct: 24 LIKRFLKEETGVTAIEYGLIAGLVAVAIIAGVSSLGGNLNTMFTSIGSCVSSLGSASA 81


>gi|171317109|ref|ZP_02906312.1| Flp/Fap pilin component [Burkholderia ambifaria MEX-5]
 gi|171097743|gb|EDT42570.1| Flp/Fap pilin component [Burkholderia ambifaria MEX-5]
          Length = 68

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 37/58 (63%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          ++K FL++E G TAIEYGL+  LIAV I+  VT++GG L   F  +   + T + AA 
Sbjct: 4  LIKRFLKEEDGVTAIEYGLIAGLIAVAIVAGVTSIGGSLGTMFTNLGTCVTTRTAAAC 61


>gi|221213143|ref|ZP_03586119.1| Flp/Fap pilin component [Burkholderia multivorans CGD1]
 gi|221167356|gb|EED99826.1| Flp/Fap pilin component [Burkholderia multivorans CGD1]
          Length = 73

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 39/58 (67%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          I+K FL++E+G TAIEYGL+  LIAV I+  V+++GG L   F+ +   I   S +A+
Sbjct: 4  IIKRFLKEETGVTAIEYGLIAGLIAVAIVAGVSSIGGSLGNMFKNLGSCITDPSNSAA 61


>gi|222084466|ref|YP_002542995.1| component of type IV pilus [Agrobacterium radiobacter K84]
 gi|221721914|gb|ACM25070.1| component of type IV pilus [Agrobacterium radiobacter K84]
          Length = 60

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (62%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          +   FL+DESGATAIEYGL+ +LI+V II   TTLG  L   F  +   + T S A
Sbjct: 4  LFSRFLKDESGATAIEYGLIAALISVAIIAGATTLGNTLSTTFNGVSDKMNTASVA 59


>gi|315121896|ref|YP_004062385.1| hypothetical protein CKC_00730 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
 gi|313495298|gb|ADR51897.1| hypothetical protein CKC_00730 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
          Length = 60

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/59 (55%), Positives = 44/59 (74%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          M+++I++ FLQDESGATAIEYGLL +L+AV II SVTTLG KL   F+ +  ++    P
Sbjct: 1  MRINIIRKFLQDESGATAIEYGLLAALVAVAIIASVTTLGTKLSATFKRVGDSLSDVKP 59


>gi|51245390|ref|YP_065274.1| pilus assembly protein pilin subunit [Desulfotalea psychrophila
          LSv54]
 gi|50876427|emb|CAG36267.1| related to pilus assembly protein pilin subunit [Desulfotalea
          psychrophila LSv54]
          Length = 59

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          + +++ F++DESG TAIEYGL+ +LIAVVII +VT +G  L   F+ I  A+
Sbjct: 5  LSMIRTFVKDESGVTAIEYGLIAALIAVVIIAAVTAVGVALNTTFQRIATAL 56


>gi|114568967|ref|YP_755647.1| Flp/Fap pilin component [Maricaulis maris MCS10]
 gi|114339429|gb|ABI64709.1| Flp/Fap pilin component [Maricaulis maris MCS10]
          Length = 52

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 36/52 (69%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M ++  F +DESGATAIEYGL+ +LIAVVII +VT LG  +   F  +  A+
Sbjct: 1  MKMISRFFKDESGATAIEYGLIAALIAVVIIGAVTALGTGVSDNFNTVAGAL 52


>gi|220922776|ref|YP_002498078.1| Flp/Fap pilin protein [Methylobacterium nodulans ORS 2060]
 gi|219947383|gb|ACL57775.1| Flp/Fap pilin component [Methylobacterium nodulans ORS 2060]
          Length = 56

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (67%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          ++K F +DESGATAIEYGLL +LIAV +IT+  ++GG L   F  +   + T 
Sbjct: 4  MLKRFAKDESGATAIEYGLLATLIAVALITAAKSVGGNLNSMFTKVAGNLATN 56


>gi|190889878|ref|YP_001976420.1| pilus subunit protein [Rhizobium etli CIAT 652]
 gi|190695157|gb|ACE89242.1| pilus subunit protein [Rhizobium etli CIAT 652]
 gi|327194697|gb|EGE61543.1| pilus subunit protein [Rhizobium etli CNPAF512]
          Length = 61

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 38/58 (65%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          +   FL+DESGATAIEYGL+ +LI+V +IT  T+LG K+   F  +   +   + AA+
Sbjct: 4  LFSRFLKDESGATAIEYGLIAALISVALITGATSLGSKIGNTFNGLSTKMDGATSAAN 61


>gi|299532816|ref|ZP_07046203.1| pilus subunit protein PilA [Comamonas testosteroni S44]
 gi|298719040|gb|EFI60010.1| pilus subunit protein PilA [Comamonas testosteroni S44]
          Length = 58

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 36/54 (66%), Gaps = 1/54 (1%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          MK  I+K F +DE GATAIEYGL+  LIA  ++ + T LGG LK  FE I  A+
Sbjct: 1  MKDQIIK-FWRDEEGATAIEYGLIAGLIAAGLVITFTDLGGALKTLFEKIKDAL 53


>gi|300021850|ref|YP_003754461.1| Flp/Fap pilin component [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523671|gb|ADJ22140.1| Flp/Fap pilin component [Hyphomicrobium denitrificans ATCC 51888]
          Length = 59

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 39/60 (65%), Gaps = 1/60 (1%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          M+I   F+ DESGATAIEYGL+ +LI V ++T +  +G  L   F  +D A+  T PAA+
Sbjct: 1  MNIFSRFMNDESGATAIEYGLIAALIGVALVTILGQVGTSLSGTFTKVDDALKGT-PAAN 59


>gi|218506996|ref|ZP_03504874.1| pilus subunit protein [Rhizobium etli Brasil 5]
          Length = 92

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (71%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +   FL+DESGATAIEYGL+ +LI+V +IT  T+LG K+   F  +
Sbjct: 4  LFSRFLKDESGATAIEYGLIAALISVALITGATSLGSKIGNTFNGL 49


>gi|170701748|ref|ZP_02892684.1| Flp/Fap pilin component [Burkholderia ambifaria IOP40-10]
 gi|170133331|gb|EDT01723.1| Flp/Fap pilin component [Burkholderia ambifaria IOP40-10]
          Length = 54

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/46 (56%), Positives = 34/46 (73%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          ++K FL++E G TAIEYGL+  LIA +IITSVTT+G K+   F  I
Sbjct: 4  LIKRFLKEEDGVTAIEYGLIAGLIAALIITSVTTIGTKISALFSTI 49


>gi|220913388|ref|YP_002488697.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6]
 gi|219860266|gb|ACL40608.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6]
          Length = 70

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 2/56 (3%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV--TTSP 59
          +K+    E GATA+EYG++V LIAVVII +V+TLGG L   F++I+  +   TT+P
Sbjct: 15 LKDRFSSEKGATAVEYGIMVGLIAVVIIVAVSTLGGTLDGFFDSINTELAPKTTTP 70


>gi|163757622|ref|ZP_02164711.1| component of type IV pilus, pilin subunit protein [Hoeflea
          phototrophica DFL-43]
 gi|162285124|gb|EDQ35406.1| component of type IV pilus, pilin subunit protein [Hoeflea
          phototrophica DFL-43]
          Length = 63

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 32/46 (69%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          I   F++DESGATAIEYGL+ +LI+V +IT  TTLG  L   F  +
Sbjct: 9  IFDRFVKDESGATAIEYGLIAALISVALITGATTLGNSLNNQFSGL 54


>gi|85859143|ref|YP_461345.1| flp/Fap pilin component [Syntrophus aciditrophicus SB]
 gi|85722234|gb|ABC77177.1| flp/fap pilin component [Syntrophus aciditrophicus SB]
          Length = 56

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (70%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          M ++K FL+DE G TAIEYGL+ +LIAVVII +VT +G  L   F  +
Sbjct: 1  MELIKRFLKDEEGVTAIEYGLIAALIAVVIIGAVTLVGKGLDGTFREV 48


>gi|89899599|ref|YP_522070.1| Flp/Fap pilin component [Rhodoferax ferrireducens T118]
 gi|89344336|gb|ABD68539.1| Flp/Fap pilin component [Rhodoferax ferrireducens T118]
          Length = 58

 Score = 53.9 bits (128), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (71%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          +H ++ F+++E G TAIEYGL+ +LIAVVII SVT +G +L   F  +  A++
Sbjct: 4  VHFIQKFVREEEGVTAIEYGLIAALIAVVIIASVTIVGTQLAVVFGKVSDALI 56


>gi|115351452|ref|YP_773291.1| Flp/Fap pilin component [Burkholderia ambifaria AMMD]
 gi|115281440|gb|ABI86957.1| Flp/Fap pilin component [Burkholderia ambifaria AMMD]
          Length = 54

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/46 (56%), Positives = 34/46 (73%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          ++K FL++E G TAIEYGL+  LIA +IITSVTT+G K+   F  I
Sbjct: 4  LIKRFLKEEDGVTAIEYGLIAGLIAALIITSVTTIGTKIAALFSTI 49


>gi|86355861|ref|YP_467753.1| component of type IV pilus, pilin subunit protein [Rhizobium etli
          CFN 42]
 gi|86279963|gb|ABC89026.1| component of type IV pilus, pilin subunit protein [Rhizobium etli
          CFN 42]
          Length = 91

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (71%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +   FL+DESGATAIEYGL+ +LI+V +I   T+LGGK+   F  +
Sbjct: 27 LFSRFLKDESGATAIEYGLIAALISVALIAGATSLGGKIGDTFNNL 72


>gi|303247320|ref|ZP_07333593.1| Flp/Fap pilin component [Desulfovibrio fructosovorans JJ]
 gi|302491234|gb|EFL51123.1| Flp/Fap pilin component [Desulfovibrio fructosovorans JJ]
          Length = 56

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 36/52 (69%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +  +  F++DE GATA+EYGL+ +LIA VI+  VTTLG  L   F++I  +I
Sbjct: 2  LRAITKFVRDEEGATAVEYGLMAALIAAVIVGVVTTLGQNLSTTFDSIATSI 53


>gi|170740624|ref|YP_001769279.1| Flp/Fap pilin component [Methylobacterium sp. 4-46]
 gi|168194898|gb|ACA16845.1| Flp/Fap pilin component [Methylobacterium sp. 4-46]
          Length = 54

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 34/46 (73%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          ++K F +DESGATAIEYGLL +LIAV +IT+  ++G  L   F+ +
Sbjct: 4  MLKRFAKDESGATAIEYGLLATLIAVALITAAQSVGSNLNSMFQKV 49


>gi|51245391|ref|YP_065275.1| pilus assembly protein pilin subunit [Desulfotalea psychrophila
          LSv54]
 gi|50876428|emb|CAG36268.1| related to pilus assembly protein pilin subunit [Desulfotalea
          psychrophila LSv54]
          Length = 61

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 38/52 (73%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +++++ F++DESG TAIEY L+ SLIA+ II +VT +GG L   F+ I  A+
Sbjct: 5  LNMIQTFVKDESGVTAIEYALIASLIAIGIIAAVTIIGGVLNTTFQRIATAL 56


>gi|153009816|ref|YP_001371031.1| Flp/Fap pilin component [Ochrobactrum anthropi ATCC 49188]
 gi|151561704|gb|ABS15202.1| Flp/Fap pilin component [Ochrobactrum anthropi ATCC 49188]
          Length = 59

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++  F + ESGATAIEYGL+ +LIAVVII + T+LG  ++  F AI  AI
Sbjct: 4  LIARFRKSESGATAIEYGLIAALIAVVIIGATTSLGTTIRTQFTAIATAI 53


>gi|220924565|ref|YP_002499867.1| Flp/Fap pilin protein [Methylobacterium nodulans ORS 2060]
 gi|219949172|gb|ACL59564.1| Flp/Fap pilin component [Methylobacterium nodulans ORS 2060]
          Length = 53

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/46 (56%), Positives = 34/46 (73%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +VK F+ DESGATAIEYGLL +LIAV +IT+ +++G  L   F  I
Sbjct: 1  MVKRFIVDESGATAIEYGLLATLIAVALITAASSVGTNLSSLFNKI 46


>gi|296156486|ref|ZP_06839324.1| Flp/Fap pilin component [Burkholderia sp. Ch1-1]
 gi|295893085|gb|EFG72865.1| Flp/Fap pilin component [Burkholderia sp. Ch1-1]
          Length = 62

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (66%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          + ++ FL++E G  AIEYGLL  LIAV II ++TT+G KL   F  +  A+
Sbjct: 3  NTIQQFLREEDGVAAIEYGLLAGLIAVAIIATITTVGSKLNNVFTYVQNAL 53


>gi|239905276|ref|YP_002952015.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
 gi|239905277|ref|YP_002952016.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
 gi|239905278|ref|YP_002952017.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
 gi|239905279|ref|YP_002952018.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
 gi|239905280|ref|YP_002952019.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
 gi|239795140|dbj|BAH74129.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
 gi|239795141|dbj|BAH74130.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
 gi|239795142|dbj|BAH74131.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
 gi|239795143|dbj|BAH74132.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
 gi|239795144|dbj|BAH74133.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
          Length = 55

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 33/45 (73%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +  F++DE GATA+EYGL+ +LIA VIIT+VT++G  L   F  +
Sbjct: 5  ITQFIRDEEGATAVEYGLMAALIAAVIITAVTSIGTNLTTTFNTV 49


>gi|116249978|ref|YP_765816.1| pilus subunit protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254626|emb|CAK05700.1| putative pilus subunit protein [Rhizobium leguminosarum bv.
          viciae 3841]
          Length = 61

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (71%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +   FL+DESGATAIEYGL+ +LI+V +IT  TTLG ++   F  +
Sbjct: 4  LFSRFLKDESGATAIEYGLIAALISVALITGATTLGDRIGTTFNNL 49


>gi|39936737|ref|NP_949013.1| Flp/Fap pilin protein [Rhodopseudomonas palustris CGA009]
 gi|192292563|ref|YP_001993168.1| Flp/Fap pilin component [Rhodopseudomonas palustris TIE-1]
 gi|39650593|emb|CAE29116.1| Flp/Fap pilin component [Rhodopseudomonas palustris CGA009]
 gi|192286312|gb|ACF02693.1| Flp/Fap pilin component [Rhodopseudomonas palustris TIE-1]
          Length = 54

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (70%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +IV  F++DESGATAIEYGL+ + I++ II +V  L GKL   F ++  A+
Sbjct: 3  NIVARFIKDESGATAIEYGLIAAGISLAIIAAVQGLAGKLNSTFTSVQNAL 53


>gi|94309598|ref|YP_582808.1| Flp/Fap pilin component [Cupriavidus metallidurans CH34]
 gi|93353450|gb|ABF07539.1| Flp/Fap pilin component; Putative pilus subunit protein
          [Cupriavidus metallidurans CH34]
          Length = 57

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/45 (57%), Positives = 32/45 (71%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +K F++DE G TAIEYGL+ +LIAVVII SV  +G  L K F  I
Sbjct: 8  LKRFVRDEDGVTAIEYGLIAALIAVVIIASVQLVGQNLSKVFSLI 52


>gi|148261013|ref|YP_001235140.1| Flp/Fap pilin component [Acidiphilium cryptum JF-5]
 gi|146402694|gb|ABQ31221.1| Flp/Fap pilin component [Acidiphilium cryptum JF-5]
          Length = 67

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (66%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          F +D  G TA+EYGL+ +L+AVVII + TTL G LK A + I  A+   +P
Sbjct: 16 FAKDNRGVTALEYGLIAALMAVVIIGAFTTLSGDLKGAIDGISNALSANTP 66


>gi|302381759|ref|YP_003817582.1| Flp/Fap pilin component [Brevundimonas subvibrioides ATCC 15264]
 gi|302192387|gb|ADK99958.1| Flp/Fap pilin component [Brevundimonas subvibrioides ATCC 15264]
          Length = 55

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 34/49 (69%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +  F  DESGATAIEYGL+ +LIAVVII ++T LG K+   F  +  A+
Sbjct: 5  ITKFAHDESGATAIEYGLIAALIAVVIIGAITVLGEKITGTFTKVSTAM 53


>gi|160897519|ref|YP_001563101.1| Flp/Fap pilin component [Delftia acidovorans SPH-1]
 gi|160363103|gb|ABX34716.1| Flp/Fap pilin component [Delftia acidovorans SPH-1]
          Length = 68

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 30/47 (63%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
           I+KNF +DE GATAIEYGL+  LIAV I+   T LG  L   F  I
Sbjct: 13 DIIKNFWKDEEGATAIEYGLIAGLIAVGIVVGATALGTNLNGLFTRI 59


>gi|172060491|ref|YP_001808143.1| Flp/Fap pilin component [Burkholderia ambifaria MC40-6]
 gi|171993008|gb|ACB63927.1| Flp/Fap pilin component [Burkholderia ambifaria MC40-6]
          Length = 72

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          ++K FL++E G TAIEYGL+  LIAV II   +T+G  L   F  I   +  +SP+A+
Sbjct: 4  LIKRFLKEEDGVTAIEYGLIAGLIAVAIIAGASTVGSNLSSTFSKIGTCV--SSPSAT 59


>gi|73542324|ref|YP_296844.1| Flp/Fap pilin component [Ralstonia eutropha JMP134]
 gi|72119737|gb|AAZ62000.1| Flp/Fap pilin component [Ralstonia eutropha JMP134]
          Length = 61

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 36/52 (69%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          ++K F++DE G TAIEYGL+ +LIAVVII SV  +G +L   F  I  ++ +
Sbjct: 7  MLKQFIRDEEGVTAIEYGLIAALIAVVIIASVAIVGTQLNSTFSKIGTSLTS 58


>gi|218461609|ref|ZP_03501700.1| pilus subunit protein [Rhizobium etli Kim 5]
          Length = 61

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (71%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +   FL+DESGATAIEYGL+ +LI+V +IT  T+LG K+   F  +
Sbjct: 4  LFSRFLKDESGATAIEYGLIAALISVALITGATSLGTKIGNVFTGL 49


>gi|27379923|ref|NP_771452.1| fimbriae associated protein [Bradyrhizobium japonicum USDA 110]
 gi|27353076|dbj|BAC50077.1| bsl4812 [Bradyrhizobium japonicum USDA 110]
          Length = 69

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (68%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          + +KNFL DE GATAIEYGL+ + IA+ +IT V  +G KL   F +I  ++
Sbjct: 18 NTLKNFLADERGATAIEYGLIAAGIALAVITVVNGMGSKLNTKFGSISTSL 68


>gi|110636419|ref|YP_676627.1| Flp/Fap pilin component [Mesorhizobium sp. BNC1]
 gi|110287403|gb|ABG65462.1| Flp/Fap pilin component [Chelativorans sp. BNC1]
          Length = 60

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
           FL+DESGATA+EYGL+V+LIA  II  V ++GG++  AF
Sbjct: 7  RFLKDESGATAVEYGLIVALIAAGIIAVVGSIGGQITNAF 46


>gi|188581657|ref|YP_001925102.1| Flp/Fap pilin component [Methylobacterium populi BJ001]
 gi|179345155|gb|ACB80567.1| Flp/Fap pilin component [Methylobacterium populi BJ001]
          Length = 64

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          +I K F+ DESGATAIEYG++ +++ V I+   T  G KLK AF  +   + T
Sbjct: 3  NIAKRFIADESGATAIEYGMVAAMVGVAIVGIFTQFGSKLKDAFTTLGTGLNT 55


>gi|227823968|ref|YP_002827941.1| probable PilA pilus assembly protein [Sinorhizobium fredii
          NGR234]
 gi|227342970|gb|ACP27188.1| probable PilA pilus assembly protein [Sinorhizobium fredii
          NGR234]
          Length = 60

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          I    ++DESGATAIEYGL+ +LI+V +IT  T LG  L   F A+   + T
Sbjct: 4  IFARLMKDESGATAIEYGLIAALISVALITGATALGDSLDSMFNALSGQMTT 55


>gi|253996773|ref|YP_003048837.1| Flp/Fap pilin component [Methylotenera mobilis JLW8]
 gi|253983452|gb|ACT48310.1| Flp/Fap pilin component [Methylotenera mobilis JLW8]
          Length = 64

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 39/54 (72%), Gaps = 1/54 (1%)

Query: 2  KMHI-VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          K+++ V+ F+ DE G TAIEY L+ +LIAVVII +VTT G ++ + F ++  A+
Sbjct: 3  KLYLGVQRFINDEEGVTAIEYALIAALIAVVIIAAVTTTGTRVCETFRSVATAL 56


>gi|304392390|ref|ZP_07374331.1| Flp/Fap pilin component [Ahrensia sp. R2A130]
 gi|303295494|gb|EFL89853.1| Flp/Fap pilin component [Ahrensia sp. R2A130]
          Length = 53

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M  +K F +DESGATAIEYGLL +LI++V I ++TT+G  L     A   A+
Sbjct: 1  MTNIKRFFKDESGATAIEYGLLAALISIVAIGAMTTIGTNLNTKLGAAGTAL 52


>gi|160897518|ref|YP_001563100.1| Flp/Fap pilin component [Delftia acidovorans SPH-1]
 gi|160363102|gb|ABX34715.1| Flp/Fap pilin component [Delftia acidovorans SPH-1]
          Length = 58

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 33/56 (58%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
           ++KNF +DE GATAIEYGL+  LIAV I+   T LG  L   F  +   +   +P
Sbjct: 3  EMIKNFWKDEEGATAIEYGLIAGLIAVGIVVGATALGTDLNGLFNRLATKLNGLAP 58


>gi|146342483|ref|YP_001207531.1| putative Flp/Fap pilin component (modular protein)
          [Bradyrhizobium sp. ORS278]
 gi|146195289|emb|CAL79314.1| Putative Flp/Fap pilin component (modular protein)
          [Bradyrhizobium sp. ORS278]
          Length = 54

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 39/54 (72%), Gaps = 1/54 (1%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          MK  ++K FL+DESGATAIEYGL+ + I++ II +V  LG  L   F++I+ ++
Sbjct: 1  MKTFVLK-FLRDESGATAIEYGLIAAGISLAIIAAVNGLGTSLSSKFDSINSSL 53


>gi|94309597|ref|YP_582807.1| Flp/Fap pilin component [Cupriavidus metallidurans CH34]
 gi|93353449|gb|ABF07538.1| Flp/Fap pilin component; Putative pilus subunit protein
          [Cupriavidus metallidurans CH34]
          Length = 57

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 33/52 (63%), Gaps = 2/52 (3%)

Query: 1  MKMHIV--KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          M  H V  K FL+D+ G TAIEYGL+ +LIAVVII SV  +G  L   F  I
Sbjct: 1  MSNHFVSLKAFLRDDDGVTAIEYGLIAALIAVVIIASVQLVGTNLSSIFNTI 52


>gi|254293165|ref|YP_003059188.1| Flp/Fap pilin component [Hirschia baltica ATCC 49814]
 gi|254041696|gb|ACT58491.1| Flp/Fap pilin component [Hirschia baltica ATCC 49814]
          Length = 67

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (73%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +++ F  D+SGATAIEYGL+ SLIAV IITSV  +G +  K F+ +
Sbjct: 9  LLQKFCADKSGATAIEYGLIASLIAVAIITSVEVVGTENSKNFDNV 54


>gi|154250686|ref|YP_001411510.1| Flp/Fap pilin component [Parvibaculum lavamentivorans DS-1]
 gi|154154636|gb|ABS61853.1| Flp/Fap pilin component [Parvibaculum lavamentivorans DS-1]
          Length = 54

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 37/51 (72%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
            +K+F+++ESGATAIEYGL+ + IAVVII +V ++G  L   F AI  AI
Sbjct: 3  QFLKSFVKNESGATAIEYGLIAAGIAVVIIVAVDSVGAALITQFTAIATAI 53


>gi|110632962|ref|YP_673170.1| Flp/Fap pilin component [Mesorhizobium sp. BNC1]
 gi|110283946|gb|ABG62005.1| Flp/Fap pilin component [Chelativorans sp. BNC1]
          Length = 57

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 36/47 (76%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +++  F ++ESGATAIEYGL+  LIAVVIIT+   +G  ++ +F+AI
Sbjct: 3  NLLTRFAKNESGATAIEYGLIAGLIAVVIITAAGLVGTDVRDSFQAI 49


>gi|325525573|gb|EGD03363.1| Flp/Fap pilin component [Burkholderia sp. TJI49]
          Length = 60

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (70%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          M  V+ F++DE G TAIEYGL+ +LIAV II +++T+G  LK  F  I
Sbjct: 5  MLDVRRFVRDEDGVTAIEYGLIAALIAVGIIAALSTIGTDLKTVFSTI 52


>gi|254255251|ref|ZP_04948567.1| hypothetical protein BDAG_04584 [Burkholderia dolosa AUO158]
 gi|124900988|gb|EAY71738.1| hypothetical protein BDAG_04584 [Burkholderia dolosa AUO158]
          Length = 112

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 33/45 (73%)

Query: 6   VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
           V+ F++DE G TAIEYGL+ +LIAV II +++T+G  LK  F  I
Sbjct: 57  VRRFVRDEEGVTAIEYGLIAALIAVGIILALSTIGKDLKTVFSTI 101


>gi|119962026|ref|YP_948616.1| hypothetical protein AAur_2907 [Arthrobacter aurescens TC1]
 gi|119948885|gb|ABM07796.1| hypothetical protein AAur_2907 [Arthrobacter aurescens TC1]
          Length = 65

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (72%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
           F  +E GATA+EYGLLV+LIA +I+ +V  LG  + K F+ ++KA+V
Sbjct: 18 RFTNEEKGATAVEYGLLVALIAALIVGTVVLLGQDVLKGFDTVEKALV 65


>gi|254473429|ref|ZP_05086826.1| Flp/Fap pilin component superfamily protein [Pseudovibrio sp.
          JE062]
 gi|211957545|gb|EEA92748.1| Flp/Fap pilin component superfamily protein [Pseudovibrio sp.
          JE062]
          Length = 55

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
           FL+DESGATAIEYG+L +L+AV++I +V  LG K+   F+ I  +   T
Sbjct: 4  KFLKDESGATAIEYGILAALMAVIVIAAVPLLGDKIVTLFKGISTSFSYT 53


>gi|323136420|ref|ZP_08071502.1| Flp/Fap pilin component [Methylocystis sp. ATCC 49242]
 gi|322398494|gb|EFY01014.1| Flp/Fap pilin component [Methylocystis sp. ATCC 49242]
          Length = 54

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/42 (59%), Positives = 29/42 (69%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          +K F++DESGATAIEYGL+ SLI V II  V  LG  L   F
Sbjct: 5  LKTFIRDESGATAIEYGLIASLIGVAIIAGVRALGTNLSGTF 46


>gi|167584952|ref|ZP_02377340.1| hypothetical protein BuboB_06426 [Burkholderia ubonensis Bu]
          Length = 70

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 31/43 (72%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          NFL+D+SG TAIEYGL+ +LIAVVII +V  +G  L   F  I
Sbjct: 24 NFLRDDSGVTAIEYGLIAALIAVVIIGAVQIVGQDLNGVFTTI 66


>gi|222147186|ref|YP_002548143.1| component of type 4 pilus pilin subunit protein [Agrobacterium
          vitis S4]
 gi|221734176|gb|ACM35139.1| component of type 4 pilus pilin subunit protein [Agrobacterium
          vitis S4]
          Length = 61

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (69%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          I   F++DESGATAIEYGL+ +LI+V ++   T+LG  L   F
Sbjct: 4  IFARFMKDESGATAIEYGLIAALISVALVAGATSLGSSLNNTF 46


>gi|304392387|ref|ZP_07374328.1| Flp/Fap pilin component [Ahrensia sp. R2A130]
 gi|303295491|gb|EFL89850.1| Flp/Fap pilin component [Ahrensia sp. R2A130]
          Length = 53

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M  +K F +DESGATAIEYGLL +LI++V I ++TT+G  L     A   A+
Sbjct: 1  MTNLKKFFKDESGATAIEYGLLAALISIVAIGAMTTIGTNLNTKLGAAGSAL 52


>gi|39933982|ref|NP_946258.1| Flp/Fap pilin protein [Rhodopseudomonas palustris CGA009]
 gi|39647829|emb|CAE26349.1| Flp/Fap pilin component [Rhodopseudomonas palustris CGA009]
          Length = 57

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 1/54 (1%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          MK  ++K FL +ESGATAIEYGL+ + I++ IIT+VT LG KL   F ++   +
Sbjct: 1  MKRLVLK-FLSEESGATAIEYGLIAAGISLAIITAVTGLGDKLNSTFTSVKDGL 53


>gi|192289401|ref|YP_001990006.1| Flp/Fap pilin component [Rhodopseudomonas palustris TIE-1]
 gi|192283150|gb|ACE99530.1| Flp/Fap pilin component [Rhodopseudomonas palustris TIE-1]
          Length = 56

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 1/54 (1%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          MK  ++K FL +ESGATAIEYGL+ + I++ IIT+VT LG KL   F ++   +
Sbjct: 1  MKRLVLK-FLSEESGATAIEYGLIAAGISLAIITAVTGLGDKLNSTFTSVKDGL 53


>gi|187927693|ref|YP_001898180.1| Flp/Fap pilin component [Ralstonia pickettii 12J]
 gi|187724583|gb|ACD25748.1| Flp/Fap pilin component [Ralstonia pickettii 12J]
          Length = 55

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++ +K F +DE G TAIEYGL+ +LIAVVII SV  +G  L   F  I  A+
Sbjct: 4  LNALKQFARDEDGVTAIEYGLIAALIAVVIIASVKLVGQNLSTVFSNIAAAL 55


>gi|209884566|ref|YP_002288423.1| hypothetical protein OCAR_5426 [Oligotropha carboxidovorans OM5]
 gi|209872762|gb|ACI92558.1| conserved domain protein [Oligotropha carboxidovorans OM5]
          Length = 53

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M  +K FL+D+SGAT+IEY ++ + IAVVII +V  LG  L   +E I  ++
Sbjct: 1  MKTLKRFLRDQSGATSIEYAMIAAGIAVVIIVAVNNLGSALNGKYEMIRTSV 52


>gi|227818618|ref|YP_002822589.1| PilA2 pilus assembly protein [Sinorhizobium fredii NGR234]
 gi|36958874|gb|AAQ87299.1| pilA [Sinorhizobium fredii NGR234]
 gi|227337617|gb|ACP21836.1| PilA2 pilus assembly protein [Sinorhizobium fredii NGR234]
          Length = 53

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 39/54 (72%), Gaps = 1/54 (1%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          MK  +V+ F+++ESGATAIEYGL+  LIAVVII++V  +G  +   F AI  A+
Sbjct: 1  MKNLLVR-FVRNESGATAIEYGLIAGLIAVVIISAVQLVGTDIGAKFTAISTAL 53


>gi|116671474|ref|YP_832407.1| Flp/Fap pilin component [Arthrobacter sp. FB24]
 gi|116611583|gb|ABK04307.1| Flp/Fap pilin component [Arthrobacter sp. FB24]
          Length = 101

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/39 (61%), Positives = 30/39 (76%)

Query: 12 DESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          DE GATA+EYG++V+LIAVVII +V  LGG L   FE +
Sbjct: 36 DEKGATAVEYGIMVALIAVVIIVAVGLLGGTLTTMFEQV 74


>gi|85716621|ref|ZP_01047591.1| Flp/Fap pilin component [Nitrobacter sp. Nb-311A]
 gi|85696622|gb|EAQ34510.1| Flp/Fap pilin component [Nitrobacter sp. Nb-311A]
          Length = 59

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 32/48 (66%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAID 51
               FL DESGATAIEY L+ S I++VI+ +V  +GG LK  F+ ++
Sbjct: 8  RFASKFLWDESGATAIEYALIASGISIVIVAAVIGIGGSLKDRFDGLN 55


>gi|16263306|ref|NP_436099.1| PilA2 pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|307304375|ref|ZP_07584126.1| Flp/Fap pilin component [Sinorhizobium meliloti BL225C]
 gi|307318082|ref|ZP_07597518.1| Flp/Fap pilin component [Sinorhizobium meliloti AK83]
 gi|14523985|gb|AAK65511.1| PilA2 pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|306896123|gb|EFN26873.1| Flp/Fap pilin component [Sinorhizobium meliloti AK83]
 gi|306902577|gb|EFN33171.1| Flp/Fap pilin component [Sinorhizobium meliloti BL225C]
          Length = 56

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (70%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +++  F ++ESGATAIEYGL+  LI+VV+IT + T+G  L   F AI  A+
Sbjct: 3  NLLARFARNESGATAIEYGLIAGLISVVLITVMGTIGTGLTTRFTAIGTAL 53


>gi|134291862|ref|YP_001115631.1| Flp/Fap pilin component [Burkholderia vietnamiensis G4]
 gi|134135051|gb|ABO59376.1| Flp/Fap pilin component [Burkholderia vietnamiensis G4]
          Length = 60

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          V+ F+QDE G TAIEYGL+ +LIAV ++ ++T +G  LK  F  I
Sbjct: 8  VRGFVQDEQGVTAIEYGLIAALIAVGLVAALTLVGNDLKTVFNTI 52


>gi|221070071|ref|ZP_03546176.1| Flp/Fap pilin component [Comamonas testosteroni KF-1]
 gi|220715094|gb|EED70462.1| Flp/Fap pilin component [Comamonas testosteroni KF-1]
          Length = 54

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          MK  I+K F +DE GATAIEYGL+  LIA VI+ +VT LG ++      I  AI
Sbjct: 1  MKDQIIK-FWRDEEGATAIEYGLIAGLIAAVIVGTVTLLGTRINTLLNTILTAI 53


>gi|254502369|ref|ZP_05114520.1| Flp/Fap pilin component superfamily [Labrenzia alexandrii DFL-11]
 gi|222438440|gb|EEE45119.1| Flp/Fap pilin component superfamily [Labrenzia alexandrii DFL-11]
          Length = 58

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (62%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +   F +DESGATAIEYGL+  L++V II  + T+G  L   F  ID A+ T S
Sbjct: 4  LFSRFAKDESGATAIEYGLIAGLLSVAIIGILVTMGDSLTSIFSQIDSALKTGS 57


>gi|221066742|ref|ZP_03542847.1| Flp/Fap pilin component [Comamonas testosteroni KF-1]
 gi|220711765|gb|EED67133.1| Flp/Fap pilin component [Comamonas testosteroni KF-1]
          Length = 61

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (70%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          + +K F +DE GATAIEYGL+  L+AV II ++T+LG +L   F+ + + +
Sbjct: 3  NFIKTFCKDEKGATAIEYGLIAGLVAVGIIFALTSLGTELSALFDRVSEKL 53


>gi|323529418|ref|YP_004231570.1| Flp/Fap pilin component [Burkholderia sp. CCGE1001]
 gi|323386420|gb|ADX58510.1| Flp/Fap pilin component [Burkholderia sp. CCGE1001]
          Length = 57

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 33/45 (73%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          ++  K F++DE G TAIEYGL+ +LIA+VIIT VT++G  L   F
Sbjct: 5  INTAKAFVRDEDGVTAIEYGLIATLIALVIITGVTSVGTNLAAKF 49


>gi|325964119|ref|YP_004242025.1| Flp pilus assembly protein, pilin Flp [Arthrobacter
          phenanthrenivorans Sphe3]
 gi|323470206|gb|ADX73891.1| Flp pilus assembly protein, pilin Flp [Arthrobacter
          phenanthrenivorans Sphe3]
          Length = 63

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 34/49 (69%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +KN L +E GATA+EYG++V LIAVVII +V  LG  L   F+ ++  I
Sbjct: 15 LKNRLSNEKGATAVEYGIMVGLIAVVIIVAVQLLGTTLDGMFDKVNVTI 63


>gi|170701158|ref|ZP_02892131.1| Flp/Fap pilin component [Burkholderia ambifaria IOP40-10]
 gi|170133939|gb|EDT02294.1| Flp/Fap pilin component [Burkholderia ambifaria IOP40-10]
          Length = 60

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          V+ F+QDE G TAIEYGL+ +LIAV ++ ++T +G  LK  F  I
Sbjct: 8  VRGFVQDEQGVTAIEYGLIAALIAVGLVAALTAVGTDLKTVFNTI 52


>gi|186474099|ref|YP_001861441.1| Flp/Fap pilin component [Burkholderia phymatum STM815]
 gi|184196431|gb|ACC74395.1| Flp/Fap pilin component [Burkholderia phymatum STM815]
          Length = 58

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 30/46 (65%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAID 51
          ++ FL +E G +AIEYGLL  LIAV IIT+V  +GG L   F  I 
Sbjct: 5  IQQFLGEEDGVSAIEYGLLAGLIAVAIITTVGLVGGSLNSVFNTIQ 50


>gi|186474098|ref|YP_001861440.1| Flp/Fap pilin component [Burkholderia phymatum STM815]
 gi|184196430|gb|ACC74394.1| Flp/Fap pilin component [Burkholderia phymatum STM815]
          Length = 58

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          +K FL++E G +AIEYGLL  LI+V IIT+V  +G  L   F  I   +    P
Sbjct: 5  IKQFLREEDGVSAIEYGLLAGLISVAIITTVGLIGTNLNTVFSTIQTKLAAVKP 58


>gi|239831632|ref|ZP_04679961.1| component of type IV pilus, pilin subunit protein [Ochrobactrum
          intermedium LMG 3301]
 gi|239823899|gb|EEQ95467.1| component of type IV pilus, pilin subunit protein [Ochrobactrum
          intermedium LMG 3301]
          Length = 62

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (65%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
           ++  F ++ESGATAIEY L+  LIAVVII    TLGG +   F+ I
Sbjct: 3  KLIARFRKNESGATAIEYALIAGLIAVVIIVGAQTLGGAINDKFDDI 49


>gi|218665735|ref|YP_002427087.1| pilin, putative [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|218517948|gb|ACK78534.1| pilin, putative [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 79

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 30/47 (63%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          H V  F+++E G TAIEYGL+  LIAV II SV  LG KL   F  I
Sbjct: 26 HAVARFVREEEGVTAIEYGLIAGLIAVAIIISVQALGLKLASLFSYI 72


>gi|198284419|ref|YP_002220740.1| Flp/Fap pilin component [Acidithiobacillus ferrooxidans ATCC
          53993]
 gi|198248940|gb|ACH84533.1| Flp/Fap pilin component [Acidithiobacillus ferrooxidans ATCC
          53993]
          Length = 69

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 30/47 (63%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          H V  F+++E G TAIEYGL+  LIAV II SV  LG KL   F  I
Sbjct: 6  HAVARFVREEEGVTAIEYGLIAGLIAVAIIISVQALGLKLASLFSYI 52


>gi|115361028|ref|YP_778165.1| Flp/Fap pilin component [Burkholderia ambifaria AMMD]
 gi|115286356|gb|ABI91831.1| Flp/Fap pilin component [Burkholderia ambifaria AMMD]
          Length = 60

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          V+ F+QDE G TAIEYGL+ +LIAV ++ ++T +G  LK  F  I
Sbjct: 8  VRGFVQDEQGVTAIEYGLIAALIAVGLVAALTAVGTDLKTVFNTI 52


>gi|323137422|ref|ZP_08072500.1| Flp/Fap pilin component [Methylocystis sp. ATCC 49242]
 gi|322397409|gb|EFX99932.1| Flp/Fap pilin component [Methylocystis sp. ATCC 49242]
          Length = 54

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 28/43 (65%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          I   F++DESGATAIEYGL+ SLI V II  V  LG  L   F
Sbjct: 4  IFSRFVKDESGATAIEYGLIASLIGVAIIAGVRALGTNLSGTF 46


>gi|46204006|ref|ZP_00209209.1| COG3847: Flp pilus assembly protein, pilin Flp [Magnetospirillum
          magnetotacticum MS-1]
          Length = 68

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 34/53 (64%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          +I K F+ DESGATAIEYGL+ +++ + ++      G KL  AFE +  ++ T
Sbjct: 7  NIAKRFIADESGATAIEYGLVAAMMGIAVVAVFKAFGSKLTTAFETLGTSLNT 59


>gi|222147185|ref|YP_002548142.1| component of type 4 pilus pilin subunit protein [Agrobacterium
          vitis S4]
 gi|221734175|gb|ACM35138.1| component of type 4 pilus pilin subunit protein [Agrobacterium
          vitis S4]
          Length = 61

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 30/44 (68%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFE 48
          I   F++DESGATAIEYGL+ +LI+V ++   TTLG  +   F 
Sbjct: 4  IFSRFMKDESGATAIEYGLIAALISVALVAGATTLGTSIGNTFN 47


>gi|307726370|ref|YP_003909583.1| Flp/Fap pilin component [Burkholderia sp. CCGE1003]
 gi|307586895|gb|ADN60292.1| Flp/Fap pilin component [Burkholderia sp. CCGE1003]
          Length = 57

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/41 (58%), Positives = 30/41 (73%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          K F++DE G TAIEYGL+ +LIA+VIIT VT +G  L   F
Sbjct: 9  KAFIRDEDGVTAIEYGLIATLIALVIITGVTAVGTNLAAKF 49


>gi|167587320|ref|ZP_02379708.1| Flp/Fap pilin component [Burkholderia ubonensis Bu]
          Length = 58

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 38/58 (65%), Gaps = 1/58 (1%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          MK  +++ FL++E G TAIEYGL+  LIAV I+TSVT +G +L   F  I   + T +
Sbjct: 1  MKAMMIR-FLKEEDGVTAIEYGLIAGLIAVAIMTSVTDIGTRLGLVFTNIYNQLATAA 57


>gi|254420002|ref|ZP_05033726.1| Flp/Fap pilin component superfamily [Brevundimonas sp. BAL3]
 gi|196186179|gb|EDX81155.1| Flp/Fap pilin component superfamily [Brevundimonas sp. BAL3]
          Length = 56

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 35/49 (71%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +  F +DESGATAIEYGL+ +LIAVVIIT + T+G +L    + + K +
Sbjct: 5  ISRFAKDESGATAIEYGLIAALIAVVIITVLGTIGTQLDIKLKEVAKGL 53


>gi|150377238|ref|YP_001313833.1| Flp/Fap pilin component [Sinorhizobium medicae WSM419]
 gi|150031785|gb|ABR63900.1| Flp/Fap pilin component [Sinorhizobium medicae WSM419]
          Length = 55

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 37/54 (68%), Gaps = 1/54 (1%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          MK  +V+ F ++ESGATAIEYGL+  LI+VVII  + T+G  L   F AI  A+
Sbjct: 1  MKNLLVR-FARNESGATAIEYGLIAGLISVVIIAVMATVGTGLTTRFTAIGTAL 53


>gi|304392389|ref|ZP_07374330.1| Flp/Fap pilin component [Ahrensia sp. R2A130]
 gi|303295493|gb|EFL89852.1| Flp/Fap pilin component [Ahrensia sp. R2A130]
          Length = 51

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (71%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          FL+DESGATAIEYGLL +LI++V I ++TT+G  L     A   A+
Sbjct: 5  FLKDESGATAIEYGLLAALISIVAIGAMTTIGTNLNTKLGAAGTAL 50


>gi|254488860|ref|ZP_05102065.1| Flp/Fap pilin component family [Roseobacter sp. GAI101]
 gi|214045729|gb|EEB86367.1| Flp/Fap pilin component family [Roseobacter sp. GAI101]
          Length = 67

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 31/49 (63%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          V+ F +DE GATAIEYGL  +L+  VI+ SV  LG +  K F  +  A+
Sbjct: 12 VRTFCKDEDGATAIEYGLFAALVGAVIVGSVAGLGKQTDKGFTTMASAL 60


>gi|187927692|ref|YP_001898179.1| Flp/Fap pilin component [Ralstonia pickettii 12J]
 gi|187724582|gb|ACD25747.1| Flp/Fap pilin component [Ralstonia pickettii 12J]
          Length = 56

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +++ FL DE   TAIEYGL+ +LIAVVII SV  +G  L   F  I  A+
Sbjct: 7  LLQQFLYDEQAVTAIEYGLIAALIAVVIIASVQLVGTNLSTVFSNIAAAL 56


>gi|172065268|ref|YP_001815980.1| Flp/Fap pilin component [Burkholderia ambifaria MC40-6]
 gi|171997510|gb|ACB68427.1| Flp/Fap pilin component [Burkholderia ambifaria MC40-6]
          Length = 60

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 31/45 (68%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          V+ F+QDE G TAIEYGL+ +LIAV ++ ++T +G  L   F  I
Sbjct: 8  VRGFVQDEQGVTAIEYGLIAALIAVTLVAALTLVGKDLNDVFNTI 52


>gi|197103822|ref|YP_002129199.1| pilus subunit protein PilA [Phenylobacterium zucineum HLK1]
 gi|196477242|gb|ACG76770.1| pilus subunit protein PilA [Phenylobacterium zucineum HLK1]
          Length = 58

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
            V  FL+DESGATAIEYGL+ +LIAVV++ ++  +G  L   F  I   + T
Sbjct: 3  KFVTRFLKDESGATAIEYGLIAALIAVVLVGALQLVGTSLDTKFRDISTKVST 55


>gi|107028252|ref|YP_625347.1| Flp/Fap pilin component [Burkholderia cenocepacia AU 1054]
 gi|116687163|ref|YP_840410.1| Flp/Fap pilin component [Burkholderia cenocepacia HI2424]
 gi|105897416|gb|ABF80374.1| Flp/Fap pilin component [Burkholderia cenocepacia AU 1054]
 gi|116652878|gb|ABK13517.1| Flp/Fap pilin component [Burkholderia cenocepacia HI2424]
          Length = 68

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 31/48 (64%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          M + + ++ DE G T+IEY LL S+ AV ++ SV TL G L  A+E I
Sbjct: 5  MRVARGWIADEQGVTSIEYALLASMFAVAVLGSVVTLKGSLGDAYEMI 52


>gi|218530651|ref|YP_002421467.1| Flp/Fap pilin component [Methylobacterium chloromethanicum CM4]
 gi|218522954|gb|ACK83539.1| Flp/Fap pilin component [Methylobacterium chloromethanicum CM4]
          Length = 61

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          +I K F+ DESGATAIEYGL+ +++ + ++T     G  L  AF  I  A+ T
Sbjct: 3  NITKRFIADESGATAIEYGLVAAMMGIAVVTIFKAFGTSLGNAFSTIGTALNT 55


>gi|206559890|ref|YP_002230654.1| flp type pilus subunit [Burkholderia cenocepacia J2315]
 gi|198035931|emb|CAR51823.1| flp type pilus subunit [Burkholderia cenocepacia J2315]
          Length = 56

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 34/46 (73%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          I+K FL++E G TA+EYGL+  LIAV ++++++TL G +  AF  I
Sbjct: 4  IIKRFLKEEDGVTAVEYGLIAGLIAVALVSAMSTLTGGISGAFTYI 49


>gi|307943139|ref|ZP_07658484.1| Flp/Fap pilin component [Roseibium sp. TrichSKD4]
 gi|307773935|gb|EFO33151.1| Flp/Fap pilin component [Roseibium sp. TrichSKD4]
          Length = 60

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (58%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          +++  F +DESGATAIEYGL+  LI++ II  VT +G  L   F  I   +     A+
Sbjct: 3  NVISRFAKDESGATAIEYGLIAGLISITIIGVVTAVGTNLNSLFTTISSTLAGVGSAS 60


>gi|56477533|ref|YP_159122.1| Flp/Fap pilin component [Aromatoleum aromaticum EbN1]
 gi|56313576|emb|CAI08221.1| INTERPRO: probable Flp/Fap pilin component [Aromatoleum
          aromaticum EbN1]
          Length = 56

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 33/53 (62%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          + ++K F++D+ G TAIEYGLL SLIA+ II     LG KL   F  I   +V
Sbjct: 2  LEMMKQFVRDDEGVTAIEYGLLASLIALAIIVGAGALGTKLNTMFNFIAGKLV 54


>gi|315121898|ref|YP_004062387.1| hypothetical protein CKC_00740 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
 gi|313495300|gb|ADR51899.1| hypothetical protein CKC_00740 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
          Length = 35

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/32 (68%), Positives = 27/32 (84%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVI 32
          MK++I++ FLQDESGATAIEYGLL +LI   I
Sbjct: 1  MKVNIIRKFLQDESGATAIEYGLLAALIIFCI 32


>gi|78060320|ref|YP_366895.1| Flp/Fap pilin component [Burkholderia sp. 383]
 gi|77964870|gb|ABB06251.1| Flp/Fap pilin component [Burkholderia sp. 383]
          Length = 63

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 32/45 (71%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +  F+QD+ G TAIEYGL+ +LIA+ I+ ++TT+G  LK  F  I
Sbjct: 8  IAWFVQDQDGVTAIEYGLIAALIAIGIVVALTTIGTDLKTVFSTI 52


>gi|187927691|ref|YP_001898178.1| Flp/Fap pilin component [Ralstonia pickettii 12J]
 gi|187724581|gb|ACD25746.1| Flp/Fap pilin component [Ralstonia pickettii 12J]
          Length = 56

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (68%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          + +L+D+ G T+IEY LL SLIA+VI+ SV  LG  +K  +E I  AI
Sbjct: 8  RKWLRDDQGVTSIEYALLGSLIAIVILGSVVALGSGVKSLYEMIAAAI 55


>gi|300694115|ref|YP_003750088.1| flp/fap pilin component [Ralstonia solanacearum PSI07]
 gi|299076152|emb|CBJ35465.1| putative Flp/Fap pilin component [Ralstonia solanacearum PSI07]
          Length = 58

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (62%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          H +  FL+DE GATAIEYGL+  LIA VI  +V  LG ++   F  +  A+
Sbjct: 3  HAILQFLRDEQGATAIEYGLIAGLIAAVIAVAVGKLGTEINTVFGTVCTAV 53


>gi|27376661|ref|NP_768190.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
 gi|27349802|dbj|BAC46815.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
          Length = 53

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M  + +FL+DESGATAIEYGL+ + I++ II  V  LG KL   F +I  ++
Sbjct: 1  MKTLVHFLRDESGATAIEYGLIAAGISLAIIAVVNGLGTKLNTKFASISSSL 52


>gi|299132284|ref|ZP_07025479.1| Flp/Fap pilin component [Afipia sp. 1NLS2]
 gi|298592421|gb|EFI52621.1| Flp/Fap pilin component [Afipia sp. 1NLS2]
          Length = 56

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 34/48 (70%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAID 51
          +++  F++DESGATAIEY L+ + I+VVII +V TLG  L   F  I+
Sbjct: 3  NLLARFVKDESGATAIEYALIAAGISVVIIGAVQTLGSTLNGVFTTIN 50


>gi|170734872|ref|YP_001773986.1| Flp/Fap pilin component [Burkholderia cenocepacia MC0-3]
 gi|169820910|gb|ACA95491.1| Flp/Fap pilin component [Burkholderia cenocepacia MC0-3]
          Length = 68

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 31/48 (64%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          M + + ++ DE G T+IEY LL S+ AV ++ SV TL G L  A+E I
Sbjct: 5  MRVARGWIVDEQGVTSIEYALLASMFAVAVLGSVVTLKGSLGDAYEMI 52


>gi|329847249|ref|ZP_08262277.1| flp/Fap pilin component family protein [Asticcacaulis
          biprosthecum C19]
 gi|328842312|gb|EGF91881.1| flp/Fap pilin component family protein [Asticcacaulis
          biprosthecum C19]
          Length = 59

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (62%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
            F +DESGATAIEYGL+ +LIAV +I+ + TL G L   F+ +   +   + A
Sbjct: 6  NRFAKDESGATAIEYGLIAALIAVALISILGTLSGSLTGTFQRVSDDLTAANGA 59


>gi|150398538|ref|YP_001329005.1| Flp/Fap pilin protein [Sinorhizobium medicae WSM419]
 gi|150030053|gb|ABR62170.1| Flp/Fap pilin component [Sinorhizobium medicae WSM419]
          Length = 61

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 29/44 (65%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFE 48
          I    ++DESGATAIEYGL+ +LI+V +I    TLGG L   F 
Sbjct: 4  IFTRLMKDESGATAIEYGLIAALISVALIGGAQTLGGALDTQFN 47


>gi|167584951|ref|ZP_02377339.1| hypothetical protein BuboB_06421 [Burkholderia ubonensis Bu]
          Length = 56

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (68%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +K F++DE G TAIEYGL+ +LIAVVII +V  +G  L   F  I
Sbjct: 8  LKQFVRDEDGVTAIEYGLIAALIAVVIIGAVRIVGQDLNGVFTTI 52


>gi|15963891|ref|NP_384244.1| putative pilin subunit protein [Sinorhizobium meliloti 1021]
 gi|307315788|ref|ZP_07595302.1| Flp/Fap pilin component [Sinorhizobium meliloti BL225C]
 gi|307320423|ref|ZP_07599840.1| Flp/Fap pilin component [Sinorhizobium meliloti AK83]
 gi|15073066|emb|CAC41525.1| Putative pilin subunit [Sinorhizobium meliloti 1021]
 gi|306893989|gb|EFN24758.1| Flp/Fap pilin component [Sinorhizobium meliloti AK83]
 gi|306898556|gb|EFN29229.1| Flp/Fap pilin component [Sinorhizobium meliloti BL225C]
          Length = 60

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          I    ++DESGATAIEYGL+ +LI+V +I    TLGG L   F
Sbjct: 4  IFARLMKDESGATAIEYGLIAALISVALIGGAQTLGGALSTQF 46


>gi|296444399|ref|ZP_06886364.1| Flp/Fap pilin component [Methylosinus trichosporium OB3b]
 gi|296258046|gb|EFH05108.1| Flp/Fap pilin component [Methylosinus trichosporium OB3b]
          Length = 54

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 35/47 (74%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          ++  +F+++ESGATAIEYGL+ +LI+VVII +V  +G  L   F+ I
Sbjct: 3  NLFASFVENESGATAIEYGLIGALISVVIIVAVKMVGTNLSNTFDKI 49


>gi|167570110|ref|ZP_02362984.1| pilin, putative [Burkholderia oklahomensis C6786]
          Length = 65

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (63%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
           ++  FL +E+G TAIEYGL+  LIAV I T+V TLG  L   F  I
Sbjct: 12 QLMNRFLTEEAGVTAIEYGLIAGLIAVAIATTVGTLGTDLSNLFSTI 58


>gi|197295149|ref|YP_002153690.1| flp type pilus subunit [Burkholderia cenocepacia J2315]
 gi|195944628|emb|CAR57232.1| flp type pilus subunit [Burkholderia cenocepacia J2315]
          Length = 72

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 31/48 (64%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          M + + ++ DE G T+IEY LL S+ A+ ++ SV TL G L  A+E I
Sbjct: 5  MRVARCWIADERGVTSIEYALLASMFAIAVLGSVVTLKGSLGAAYEMI 52


>gi|197295148|ref|YP_002153689.1| flp type pilus subunit [Burkholderia cenocepacia J2315]
 gi|195944627|emb|CAR57231.1| flp type pilus subunit [Burkholderia cenocepacia J2315]
          Length = 63

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
           F++DE G TAIEYGL+ +LIAV II +++T+G  LK  F  I
Sbjct: 10 RFVRDEDGVTAIEYGLIAALIAVGIILALSTIGKDLKTVFSTI 52


>gi|78060319|ref|YP_366894.1| Flp/Fap pilin component [Burkholderia sp. 383]
 gi|77964869|gb|ABB06250.1| Flp/Fap pilin component [Burkholderia sp. 383]
          Length = 63

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
           F++DE G TAIEYGL+ +LIAV II +++T+G  LK  F  I
Sbjct: 10 RFVRDEDGVTAIEYGLIAALIAVGIILALSTIGKDLKTVFSTI 52


>gi|167562919|ref|ZP_02355835.1| pilin, putative [Burkholderia oklahomensis EO147]
          Length = 65

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (63%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
           ++  FL +E+G TAIEYGL+  LIAV I T+V TLG  L   F  I
Sbjct: 12 QLMNRFLTEEAGVTAIEYGLIAGLIAVAIATTVGTLGTDLSNLFTTI 58


>gi|307726371|ref|YP_003909584.1| Flp/Fap pilin component [Burkholderia sp. CCGE1003]
 gi|307586896|gb|ADN60293.1| Flp/Fap pilin component [Burkholderia sp. CCGE1003]
          Length = 57

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          +  F++DE G TAIEYGL+ +LIA+ IIT VT +G  L+  F
Sbjct: 8  IDAFVRDEEGVTAIEYGLIATLIALAIITGVTAIGTNLEAKF 49


>gi|107022590|ref|YP_620917.1| Flp/Fap pilin component [Burkholderia cenocepacia AU 1054]
 gi|116689539|ref|YP_835162.1| Flp/Fap pilin component [Burkholderia cenocepacia HI2424]
 gi|170732843|ref|YP_001764790.1| Flp/Fap pilin component [Burkholderia cenocepacia MC0-3]
 gi|105892779|gb|ABF75944.1| Flp/Fap pilin component [Burkholderia cenocepacia AU 1054]
 gi|116647628|gb|ABK08269.1| Flp/Fap pilin component [Burkholderia cenocepacia HI2424]
 gi|169816085|gb|ACA90668.1| Flp/Fap pilin component [Burkholderia cenocepacia MC0-3]
          Length = 56

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 33/46 (71%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          I+K FL++E G TA+EYGL+  LIAV ++T+++TL   +  AF  I
Sbjct: 4  IIKRFLKEEDGVTAVEYGLIAGLIAVALVTAMSTLTTGISGAFSYI 49


>gi|222087312|ref|YP_002545849.1| component of type IV pilus [Agrobacterium radiobacter K84]
 gi|221724760|gb|ACM27916.1| component of type IV pilus [Agrobacterium radiobacter K84]
          Length = 60

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M  V+ F  D +GAT +EYGL+ +L++V I++ +   GG L   F  +   +
Sbjct: 1  MRSVRRFFNDRTGATVVEYGLIAALMSVAIVSGLGAFGGSLTNVFNLVSNTL 52


>gi|209886528|ref|YP_002290385.1| hypothetical protein OCAR_7417 [Oligotropha carboxidovorans OM5]
 gi|209874724|gb|ACI94520.1| conserved domain protein [Oligotropha carboxidovorans OM5]
          Length = 54

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (66%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++   F++DESGATAIEY L+ + IAVVII +V  +G  +   FE I  ++
Sbjct: 3  NLFARFVKDESGATAIEYALIAAGIAVVIIAAVNGVGSAISSKFETIKSSL 53


>gi|27378229|ref|NP_769758.1| PilA2 pilus assembly protein [Bradyrhizobium japonicum USDA 110]
 gi|27351376|dbj|BAC48383.1| bsl3118 [Bradyrhizobium japonicum USDA 110]
          Length = 54

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 1/52 (1%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGK-LKKAFEAIDKA 53
          M ++K+FL DES ATAIEY L+ + IA+VI+T V   G   L   F +ID A
Sbjct: 1  MALLKSFLADESAATAIEYCLIAAGIALVIVTVVNNTGSALLNNKFNSIDAA 52


>gi|323529417|ref|YP_004231569.1| Flp/Fap pilin component [Burkholderia sp. CCGE1001]
 gi|323386419|gb|ADX58509.1| Flp/Fap pilin component [Burkholderia sp. CCGE1001]
          Length = 57

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 31/42 (73%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          F++DE G TAIEYGL+ +LIA+ I+  VT++G  L+  F AI
Sbjct: 11 FVRDEEGVTAIEYGLIATLIALAIVVGVTSIGTNLEAKFMAI 52


>gi|325673443|ref|ZP_08153134.1| hypothetical protein HMPREF0724_10916 [Rhodococcus equi ATCC
          33707]
 gi|325555464|gb|EGD25135.1| hypothetical protein HMPREF0724_10916 [Rhodococcus equi ATCC
          33707]
          Length = 67

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 34/53 (64%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKA 53
          M + +     +D+ GATA+EYGL+V+ IA+VII +V   GG+L   F+  + A
Sbjct: 11 MGLDVKDRLTRDDRGATAVEYGLMVAGIAMVIIIAVFAFGGRLSTLFQNFNFA 63


>gi|329890999|ref|ZP_08269342.1| flp/Fap pilin component family protein [Brevundimonas diminuta
          ATCC 11568]
 gi|328846300|gb|EGF95864.1| flp/Fap pilin component family protein [Brevundimonas diminuta
          ATCC 11568]
          Length = 59

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (65%), Gaps = 1/58 (1%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          + +  F +DESGATAIEYGL+ +L+AV+II  +  L   L+ AF+ +   + +  PAA
Sbjct: 3  NFITRFAKDESGATAIEYGLIAALMAVIIIAGIGFLKPGLEGAFKNVGGQM-SKVPAA 59


>gi|167841420|ref|ZP_02468104.1| putative pilus subunit protein [Burkholderia thailandensis
          MSMB43]
          Length = 56

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          K F++DE G +AIEYGL+ +LIAVVII +V  +G  L   F  I
Sbjct: 9  KQFVRDEGGVSAIEYGLIAALIAVVIIGAVKAVGTDLNSVFTTI 52


>gi|296444400|ref|ZP_06886365.1| Flp/Fap pilin component [Methylosinus trichosporium OB3b]
 gi|296258047|gb|EFH05109.1| Flp/Fap pilin component [Methylosinus trichosporium OB3b]
          Length = 54

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 1/50 (2%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          MK  I + F+ +ESGATAIEYGL+ +LI+VVII +V  +G  L   F+ I
Sbjct: 1  MKSMIAR-FVGNESGATAIEYGLIGALISVVIIVAVKMVGTNLSNTFDKI 49


>gi|187919321|ref|YP_001888352.1| Flp/Fap pilin component [Burkholderia phytofirmans PsJN]
 gi|187717759|gb|ACD18982.1| Flp/Fap pilin component [Burkholderia phytofirmans PsJN]
          Length = 58

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          + +K FL++E G  AIEY LL  LIAV II +V  +   LK  F AI  A+  T+ AA
Sbjct: 3  NTIKKFLREEDGVAAIEYALLAGLIAVAIIVTVQNMTTNLKAMFNAIGTAL--TNAAA 58


>gi|113866748|ref|YP_725237.1| flp pilus assembly protein, pilin Flp [Ralstonia eutropha H16]
 gi|113525524|emb|CAJ91869.1| flp pilus assembly protein, pilin Flp [Ralstonia eutropha H16]
          Length = 57

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          K+FL+D+ G ++IEY LL SLIA+ I+ SV TL   +K  +E I
Sbjct: 9  KDFLRDDWGVSSIEYALLGSLIAMAIVVSVATLSNAVKAMYELI 52


>gi|75675346|ref|YP_317767.1| Flp/Fap pilin component [Nitrobacter winogradskyi Nb-255]
 gi|74420216|gb|ABA04415.1| Flp/Fap pilin component [Nitrobacter winogradskyi Nb-255]
          Length = 57

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 32/43 (74%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAID 51
           L D SGATAIEY L+ S I++VI+ +V+ +GG L+  F+A++
Sbjct: 11 LLWDTSGATAIEYALIASGISIVIVAAVSGIGGSLRDRFDALN 53


>gi|332716312|ref|YP_004443778.1| fimbriae associated protein [Agrobacterium sp. H13-3]
 gi|325062997|gb|ADY66687.1| fimbriae associated protein [Agrobacterium sp. H13-3]
          Length = 63

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +H    F +DE+GATA+EYGL+V +I+  II   T + G +   F+ +  A 
Sbjct: 9  LHCFIRFFKDENGATAVEYGLIVGVISAAIIGGATAISGNINTVFQFLADAF 60


>gi|219883043|ref|YP_002478207.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6]
 gi|219862049|gb|ACL42390.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6]
          Length = 70

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 1/55 (1%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          K  L  ESGATA+EYGLLV LIAV II ++  LG +L   F ++ +++   +PAA
Sbjct: 16 KKRLSGESGATAVEYGLLVGLIAVGIIAALVILGPQLAGLFTSVTESL-PGAPAA 69


>gi|91976437|ref|YP_569096.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB5]
 gi|91682893|gb|ABE39195.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB5]
          Length = 55

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 34/54 (62%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M   ++  F+ D SGATAIEY +L   I++VII  V  LG KL  +++++  AI
Sbjct: 1  MLRRLISRFVSDTSGATAIEYAILAVGISIVIIGVVNGLGTKLNSSYDSVSSAI 54


>gi|116254028|ref|YP_769866.1| pilus component protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258676|emb|CAK09780.1| putative pilus component protein [Rhizobium leguminosarum bv.
          viciae 3841]
          Length = 55

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDK 52
          M I+K FL D+ GATAIEYGL+ +LI   +++ +    G L+  F  I+ 
Sbjct: 1  MRILKAFLADDRGATAIEYGLIAALICGALVSGLGVFTGALQGVFNVINN 50


>gi|91788407|ref|YP_549359.1| Flp/Fap pilin component [Polaromonas sp. JS666]
 gi|91697632|gb|ABE44461.1| Flp/Fap pilin component [Polaromonas sp. JS666]
          Length = 97

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 33/54 (61%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M+ H ++N L DE+G TAIEY LL SLI VVI+ +V  +G  +   +  +   +
Sbjct: 33 MQHHPLENLLADEAGVTAIEYALLSSLIVVVILGAVGAVGSSVLSLWRLVSNCV 86


>gi|197295147|ref|YP_002153688.1| flp type pilus subunit [Burkholderia cenocepacia J2315]
 gi|195944626|emb|CAR57230.1| flp type pilus subunit [Burkholderia cenocepacia J2315]
          Length = 63

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          F+QD+ G TAIEYGL+ +LIA+ I+ ++ T+G  LK  F  I
Sbjct: 11 FVQDQDGVTAIEYGLIAALIAIGIVAALATVGTDLKTVFSTI 52


>gi|147677780|ref|YP_001211995.1| flp pilus assembly protein, pilin Flp, pilin Flp [Pelotomaculum
          thermopropionicum SI]
 gi|146273877|dbj|BAF59626.1| flp pilus assembly protein, pilin Flp, pilin Flp [Pelotomaculum
          thermopropionicum SI]
          Length = 59

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 34/50 (68%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++K  L++E+G    EYGL+++LIAVV+I ++TTLG  +K   E +   I
Sbjct: 4  LIKRLLREENGQGMAEYGLILALIAVVVIAALTTLGTNIKTKLETVGNKI 53


>gi|304322119|ref|YP_003855762.1| hypothetical protein PB2503_12914 [Parvularcula bermudensis
          HTCC2503]
 gi|303301021|gb|ADM10620.1| hypothetical protein PB2503_12914 [Parvularcula bermudensis
          HTCC2503]
          Length = 54

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (76%), Gaps = 1/43 (2%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVT-TLGGKLKKAF 47
          +K FL DE GATA+EYGL+V++IAV ++ +V    G +L+KAF
Sbjct: 1  MKWFLSDEEGATAMEYGLIVAIIAVALVVAVQGETGTRLQKAF 43


>gi|116694136|ref|YP_728347.1| fimbriae associated protein [Ralstonia eutropha H16]
 gi|113528635|emb|CAJ94982.1| fimbriae associated protein [Ralstonia eutropha H16]
          Length = 58

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
           ++  F++DE GATAIEYGL+V L+A+ I      LG +L  +F   D+  VT S
Sbjct: 3  RLIARFIKDERGATAIEYGLIVGLVALAIAVGAGKLGTELNASF---DRLSVTVS 54


>gi|220918099|ref|YP_002493403.1| Flp/Fap pilin component [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219955953|gb|ACL66337.1| Flp/Fap pilin component [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 66

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 40/58 (68%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          +++   +D+ GATA+EYGL+V+ IA VI+  V +LGG++  AF+ +D  I +  PAA 
Sbjct: 9  MLRKLWKDDEGATAVEYGLMVAAIAAVIVVVVFSLGGRVNTAFQTVDTTIGSHQPAAQ 66


>gi|56477532|ref|YP_159121.1| pilus assembly protein, pilin component [Aromatoleum aromaticum
          EbN1]
 gi|56313575|emb|CAI08220.1| pilus assembly protein, pilin component [Aromatoleum aromaticum
          EbN1]
          Length = 56

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          + +++ F+ DE G TAIEYGL+ SL+A+ II     LG KL   F  I
Sbjct: 2  LKMLQQFIVDEDGVTAIEYGLIASLVALAIIVGAGALGTKLNDVFNFI 49


>gi|107028254|ref|YP_625349.1| Flp/Fap pilin component [Burkholderia cenocepacia AU 1054]
 gi|116686247|ref|YP_839494.1| Flp/Fap pilin component [Burkholderia cenocepacia HI2424]
 gi|170734874|ref|YP_001773988.1| Flp/Fap pilin component [Burkholderia cenocepacia MC0-3]
 gi|105897418|gb|ABF80376.1| Flp/Fap pilin component [Burkholderia cenocepacia AU 1054]
 gi|116651962|gb|ABK12601.1| Flp/Fap pilin component [Burkholderia cenocepacia HI2424]
 gi|169820912|gb|ACA95493.1| Flp/Fap pilin component [Burkholderia cenocepacia MC0-3]
          Length = 63

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 31/42 (73%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          F++D+ G TAIEYGL+ +LIA+ I+ ++TT+G  LK  F  +
Sbjct: 11 FVEDQDGVTAIEYGLIAALIAIGIVGALTTVGTDLKTVFNTV 52


>gi|170696790|ref|ZP_02887899.1| Flp/Fap pilin component [Burkholderia graminis C4D1M]
 gi|170138306|gb|EDT06525.1| Flp/Fap pilin component [Burkholderia graminis C4D1M]
          Length = 55

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (69%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +FL+D  G TA+EYGL+  LI VVI ++V  LG +L  AF+ I
Sbjct: 7  SFLRDNRGVTALEYGLIAGLIVVVIGSTVQGLGTQLNTAFQTI 49


>gi|187923641|ref|YP_001895283.1| Flp/Fap pilin component [Burkholderia phytofirmans PsJN]
 gi|187714835|gb|ACD16059.1| Flp/Fap pilin component [Burkholderia phytofirmans PsJN]
          Length = 59

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          + FL D  G TAIEYGL+  L+ +VI T+VT +G  +    + +   I  T+PAAS
Sbjct: 6  QRFLADNKGVTAIEYGLIAGLVVLVIATAVTNVGTNVSTVLQQVADKI--TAPAAS 59


>gi|309778773|ref|ZP_07673546.1| conserved domain protein [Ralstonia sp. 5_7_47FAA]
 gi|308922481|gb|EFP68105.1| conserved domain protein [Ralstonia sp. 5_7_47FAA]
          Length = 59

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          MK  I+K FL+DE GATA+EYG++  LIA  I   V  LG +L   F  I  A+
Sbjct: 1  MKNAILK-FLRDEQGATAVEYGMIAGLIAAAITVIVGKLGTQLNTVFTNICTAV 53


>gi|83717974|ref|YP_440452.1| Flp/Fap pilin component superfamily protein [Burkholderia
          thailandensis E264]
 gi|167579109|ref|ZP_02371983.1| Flp/Fap pilin component superfamily protein [Burkholderia
          thailandensis TXDOH]
 gi|167617224|ref|ZP_02385855.1| Flp/Fap pilin component superfamily protein [Burkholderia
          thailandensis Bt4]
 gi|257141099|ref|ZP_05589361.1| Flp/Fap pilin component superfamily protein [Burkholderia
          thailandensis E264]
 gi|83651799|gb|ABC35863.1| Flp/Fap pilin component superfamily [Burkholderia thailandensis
          E264]
          Length = 72

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 30/47 (63%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          H    +L+DES  +AIEY L+ SLIA+VII +V  +G  L+  F  +
Sbjct: 22 HAFMCWLRDESAVSAIEYALIASLIAIVIIGAVQVVGTNLQSVFSTV 68


>gi|296134301|ref|YP_003641548.1| Flp/Fap pilin component [Thermincola sp. JR]
 gi|296032879|gb|ADG83647.1| Flp/Fap pilin component [Thermincola potens JR]
          Length = 54

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++K   ++ESG    EYGL+++LI + +I  + T+GG LK  FE +  A+
Sbjct: 4  MIKKLWKEESGQGMTEYGLILALIVIAVIAIMATMGGNLKNKFENVSNAL 53


>gi|149179075|ref|ZP_01857647.1| hypothetical protein PM8797T_30414 [Planctomyces maris DSM 8797]
 gi|148842066|gb|EDL56457.1| hypothetical protein PM8797T_30414 [Planctomyces maris DSM 8797]
          Length = 57

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 32/49 (65%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +KNFL  E G TA+EY ++++LI +V +T++  +G      FEA+  A+
Sbjct: 8  IKNFLVSEDGPTAVEYAVMLALIVIVCLTAIQAVGTNANAKFEAVRDAL 56


>gi|254255250|ref|ZP_04948566.1| hypothetical protein BDAG_04583 [Burkholderia dolosa AUO158]
 gi|124900987|gb|EAY71737.1| hypothetical protein BDAG_04583 [Burkholderia dolosa AUO158]
          Length = 241

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 30/42 (71%)

Query: 9   FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
            +++E G TAIEYGL+ +LIA+ I+ ++TT+G  LK  F  +
Sbjct: 189 LVRNEDGVTAIEYGLIAALIAIGIVAALTTIGTDLKTVFSTL 230


>gi|328952518|ref|YP_004369852.1| Flp/Fap pilin component [Desulfobacca acetoxidans DSM 11109]
 gi|328452842|gb|AEB08671.1| Flp/Fap pilin component [Desulfobacca acetoxidans DSM 11109]
          Length = 65

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 32/44 (72%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAID 51
          +  +DE+GATAIEYGL+V ++A  +IT++ T   KL+  F AI+
Sbjct: 7  SLWRDEAGATAIEYGLIVGIMAATLITALGTFSEKLESLFSAIN 50


>gi|83721334|ref|YP_443063.1| pilin [Burkholderia thailandensis E264]
 gi|167582067|ref|ZP_02374941.1| pilin, putative [Burkholderia thailandensis TXDOH]
 gi|167620228|ref|ZP_02388859.1| pilin, putative [Burkholderia thailandensis Bt4]
 gi|167836799|ref|ZP_02463682.1| pilin, putative [Burkholderia thailandensis MSMB43]
 gi|257139293|ref|ZP_05587555.1| pilin, putative [Burkholderia thailandensis E264]
 gi|83655159|gb|ABC39222.1| pilin, putative [Burkholderia thailandensis E264]
          Length = 65

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 30/47 (63%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
           ++  F ++E+G TAIEYGL+  LIAV I T+V T+G  L   F  I
Sbjct: 12 QLMHRFFKEEAGVTAIEYGLIAGLIAVAIATTVGTVGTDLSSLFSTI 58


>gi|148253065|ref|YP_001237650.1| putative Flp/Fap pilin component [Bradyrhizobium sp. BTAi1]
 gi|146405238|gb|ABQ33744.1| putative Flp/Fap pilin component [Bradyrhizobium sp. BTAi1]
          Length = 56

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/41 (58%), Positives = 28/41 (68%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +  ESG TAIEYGLL +LIAVVII  VT +G  L+  F  I
Sbjct: 7  IDSESGVTAIEYGLLAALIAVVIIVGVTLIGTNLQAIFNYI 47


>gi|307943142|ref|ZP_07658487.1| Flp/Fap pilin component [Roseibium sp. TrichSKD4]
 gi|307773938|gb|EFO33154.1| Flp/Fap pilin component [Roseibium sp. TrichSKD4]
          Length = 56

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 38/54 (70%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          ++   F +DESGATAIEYGL+  LIAVVII +VTTLG  L   FE I+  + T+
Sbjct: 3  NVFARFAKDESGATAIEYGLIAGLIAVVIIGTVTTLGTTLNGIFETINTDLTTS 56


>gi|197118223|ref|YP_002138650.1| Flp/Fap pilin [Geobacter bemidjiensis Bem]
 gi|197087583|gb|ACH38854.1| Flp/Fap pilin [Geobacter bemidjiensis Bem]
          Length = 63

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 41/60 (68%), Gaps = 4/60 (6%)

Query: 2  KMHI-VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          KM + +++ LQD+ GAT +EYGL+++LIA V +T V ++G + +  F+ I  A+   +PA
Sbjct: 6  KMFVQMRSKLQDQKGATMVEYGLMLALIAAVCVTVVGSIGTQAESTFQTIVDAL---TPA 62


>gi|78060318|ref|YP_366893.1| Flp/Fap pilin component [Burkholderia sp. 383]
 gi|77964868|gb|ABB06249.1| Flp/Fap pilin component [Burkholderia sp. 383]
          Length = 68

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 30/46 (65%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFE 48
          M +V+ ++ DE G T+IEY LL ++ AV ++ +V TL G L   +E
Sbjct: 5  MRVVRRWISDEQGVTSIEYALLGAMFAVAVLGTVVTLKGSLADVYE 50


>gi|76811746|ref|YP_333336.1| putative fimbriae assembly-like protein [Burkholderia
          pseudomallei 1710b]
 gi|126441443|ref|YP_001058803.1| pilin family protein [Burkholderia pseudomallei 668]
 gi|126452952|ref|YP_001066054.1| pilin family protein [Burkholderia pseudomallei 1106a]
 gi|134282265|ref|ZP_01768970.1| pilin, flp/fap family [Burkholderia pseudomallei 305]
 gi|167719791|ref|ZP_02403027.1| pilin, flp/fap family protein [Burkholderia pseudomallei DM98]
 gi|167738792|ref|ZP_02411566.1| pilin, flp/fap family protein [Burkholderia pseudomallei 14]
 gi|167824391|ref|ZP_02455862.1| pilin, flp/fap family protein [Burkholderia pseudomallei 9]
 gi|167845922|ref|ZP_02471430.1| pilin, flp/fap family protein [Burkholderia pseudomallei B7210]
 gi|167894498|ref|ZP_02481900.1| pilin, flp/fap family protein [Burkholderia pseudomallei 7894]
 gi|167902903|ref|ZP_02490108.1| pilin, flp/fap family protein [Burkholderia pseudomallei NCTC
          13177]
 gi|167911141|ref|ZP_02498232.1| pilin, flp/fap family protein [Burkholderia pseudomallei 112]
 gi|217423683|ref|ZP_03455184.1| pilin, flp/fap family [Burkholderia pseudomallei 576]
 gi|226199682|ref|ZP_03795235.1| pilin, flp/fap family [Burkholderia pseudomallei Pakistan 9]
 gi|237812063|ref|YP_002896514.1| hypothetical protein GBP346_A1805 [Burkholderia pseudomallei
          MSHR346]
 gi|242317113|ref|ZP_04816129.1| pilin, flp/fap family [Burkholderia pseudomallei 1106b]
 gi|254179961|ref|ZP_04886560.1| pilin, flp/fap family [Burkholderia pseudomallei 1655]
 gi|254188629|ref|ZP_04895140.1| pilin, flp/fap family [Burkholderia pseudomallei Pasteur 52237]
 gi|254197897|ref|ZP_04904319.1| pilin, flp/fap family [Burkholderia pseudomallei S13]
 gi|254259877|ref|ZP_04950931.1| pilin, flp/fap family [Burkholderia pseudomallei 1710a]
 gi|254297797|ref|ZP_04965250.1| pilin, flp/fap family [Burkholderia pseudomallei 406e]
 gi|76581199|gb|ABA50674.1| putative fimbriae assembly related protein [Burkholderia
          pseudomallei 1710b]
 gi|126220936|gb|ABN84442.1| pilin, flp/fap family [Burkholderia pseudomallei 668]
 gi|126226594|gb|ABN90134.1| pilin, flp/fap family [Burkholderia pseudomallei 1106a]
 gi|134246303|gb|EBA46392.1| pilin, flp/fap family [Burkholderia pseudomallei 305]
 gi|157806937|gb|EDO84107.1| pilin, flp/fap family [Burkholderia pseudomallei 406e]
 gi|157936308|gb|EDO91978.1| pilin, flp/fap family [Burkholderia pseudomallei Pasteur 52237]
 gi|169654638|gb|EDS87331.1| pilin, flp/fap family [Burkholderia pseudomallei S13]
 gi|184210501|gb|EDU07544.1| pilin, flp/fap family [Burkholderia pseudomallei 1655]
 gi|217393541|gb|EEC33562.1| pilin, flp/fap family [Burkholderia pseudomallei 576]
 gi|225928268|gb|EEH24302.1| pilin, flp/fap family [Burkholderia pseudomallei Pakistan 9]
 gi|237504579|gb|ACQ96897.1| conserved domain protein [Burkholderia pseudomallei MSHR346]
 gi|242140352|gb|EES26754.1| pilin, flp/fap family [Burkholderia pseudomallei 1106b]
 gi|254218566|gb|EET07950.1| pilin, flp/fap family [Burkholderia pseudomallei 1710a]
          Length = 65

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 30/47 (63%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
           ++  F ++E+G TAIEYGL+  LIAV I T+V T+G  L   F  I
Sbjct: 12 QLMHRFFKEEAGVTAIEYGLIAGLIAVAIATTVGTVGTDLSALFSTI 58


>gi|92116959|ref|YP_576688.1| Flp/Fap pilin component [Nitrobacter hamburgensis X14]
 gi|91799853|gb|ABE62228.1| Flp/Fap pilin component [Nitrobacter hamburgensis X14]
          Length = 54

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 33/46 (71%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +  +FL+DESGATAIEY L+ + I+++I+ +VT +G  +   F A+
Sbjct: 4  LTSDFLRDESGATAIEYALIATGISILIVVAVTGIGSSVNGRFTAV 49


>gi|320101689|ref|YP_004177280.1| Flp/Fap pilin component [Isosphaera pallida ATCC 43644]
 gi|319748971|gb|ADV60731.1| Flp/Fap pilin component [Isosphaera pallida ATCC 43644]
          Length = 62

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 33/47 (70%), Gaps = 1/47 (2%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          ++ HIV +FL+ E G TA+EY ++V+LI VV I ++TTLG    + F
Sbjct: 3  IRKHIV-DFLKAEDGPTAVEYAVMVALIIVVCIAAITTLGQSANETF 48


>gi|283852354|ref|ZP_06369625.1| Flp/Fap pilin component [Desulfovibrio sp. FW1012B]
 gi|283572311|gb|EFC20300.1| Flp/Fap pilin component [Desulfovibrio sp. FW1012B]
          Length = 56

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          + NF++DE GATA+EYGL+V+LIA VI+  VTTLG  L+  F  I  AI
Sbjct: 5  ITNFVRDEEGATAVEYGLMVALIAAVIVGVVTTLGTTLQGTFTNITTAI 53


>gi|168701154|ref|ZP_02733431.1| hypothetical protein GobsU_16634 [Gemmata obscuriglobus UQM 2246]
 gi|168701155|ref|ZP_02733432.1| hypothetical protein GobsU_16639 [Gemmata obscuriglobus UQM 2246]
 gi|168703133|ref|ZP_02735410.1| hypothetical protein GobsU_26621 [Gemmata obscuriglobus UQM 2246]
 gi|168705822|ref|ZP_02738099.1| hypothetical protein GobsU_40192 [Gemmata obscuriglobus UQM 2246]
          Length = 66

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 30/47 (63%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          NFL+ E G TA+EY ++++LI VV I ++TTLG      F  +  +I
Sbjct: 10 NFLKAEDGPTAVEYAVMLALIVVVCIAAITTLGSNANSTFSFVGSSI 56


>gi|283769327|ref|ZP_06342226.1| Flp/Fap pilin component [Bulleidia extructa W1219]
 gi|283103984|gb|EFC05368.1| Flp/Fap pilin component [Bulleidia extructa W1219]
          Length = 56

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 36/53 (67%), Gaps = 4/53 (7%)

Query: 6  VKNFL----QDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +KNF+    ++ESG   +EYGL+++LIAVV+I ++  + G +   F+AI  A+
Sbjct: 1  MKNFMNWFTEEESGQGMVEYGLIIALIAVVLIVALQAMQGGIANTFQAITNAL 53


>gi|307730010|ref|YP_003907234.1| Flp/Fap pilin component [Burkholderia sp. CCGE1003]
 gi|307584545|gb|ADN57943.1| Flp/Fap pilin component [Burkholderia sp. CCGE1003]
          Length = 59

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 30/43 (69%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +FL+D  G TA+EYGL+  LI VVI ++V  LG +L  AF+ +
Sbjct: 7  SFLRDNRGVTALEYGLIAGLIVVVIGSTVQGLGTQLNTAFQTV 49


>gi|53719513|ref|YP_108499.1| putative fimbriae assembly related protein [Burkholderia
          pseudomallei K96243]
 gi|167816015|ref|ZP_02447695.1| pilin, flp/fap family protein [Burkholderia pseudomallei 91]
 gi|167919164|ref|ZP_02506255.1| pilin, flp/fap family protein [Burkholderia pseudomallei BCC215]
 gi|52209927|emb|CAH35899.1| putative fimbriae assembly related protein [Burkholderia
          pseudomallei K96243]
          Length = 56

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 30/47 (63%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
           ++  F ++E+G TAIEYGL+  LIAV I T+V T+G  L   F  I
Sbjct: 3  QLMHRFFKEEAGVTAIEYGLIAGLIAVAIATTVGTVGTDLSALFSTI 49


>gi|146338126|ref|YP_001203174.1| putative Flp/Fap pilin component [Bradyrhizobium sp. ORS278]
 gi|146190932|emb|CAL74937.1| putative Flp/Fap pilin component [Bradyrhizobium sp. ORS278]
          Length = 46

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 32/45 (71%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++DESGATAIEYGL+ + I++ II +V  LG  L   F +I+ ++
Sbjct: 1  MKDESGATAIEYGLIAAGISLAIIAAVNGLGSSLSSKFGSINSSL 45


>gi|323525742|ref|YP_004227895.1| Flp/Fap pilin component [Burkholderia sp. CCGE1001]
 gi|323382744|gb|ADX54835.1| Flp/Fap pilin component [Burkholderia sp. CCGE1001]
          Length = 57

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 30/43 (69%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +FL+D  G TA+EYGL+  LI VVI ++V  LG +L  AF+ +
Sbjct: 7  SFLRDNRGVTALEYGLIAGLIVVVIGSTVQGLGTQLNTAFQTV 49


>gi|146342539|ref|YP_001207587.1| putative Flp/Fap pilin component [Bradyrhizobium sp. ORS278]
 gi|146195345|emb|CAL79370.1| putative Flp/Fap pilin component [Bradyrhizobium sp. ORS278]
          Length = 53

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 37/52 (71%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M ++  FL+DESGATAIEYGL+ + I++ II SV  LG KL   F +I+ ++
Sbjct: 1  MSVILRFLKDESGATAIEYGLIAAGISIAIIASVNGLGSKLNTKFTSINSSL 52


>gi|154250533|ref|YP_001411357.1| Flp/Fap pilin component [Parvibaculum lavamentivorans DS-1]
 gi|154154483|gb|ABS61700.1| Flp/Fap pilin component [Parvibaculum lavamentivorans DS-1]
          Length = 96

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTT--LGGKLKKAFEAIDKAIVTTSPAA 61
           ++ F++DESG +A+EYGLL + IAV +   V    +GG L+  FE++   +   +PA+
Sbjct: 36 FLRRFMKDESGISAVEYGLLAAGIAVGLWAFVGPDGIGGTLQGVFESVSDDLSEAAPAS 94


>gi|315121899|ref|YP_004062388.1| hypothetical protein CKC_00745 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
 gi|313495301|gb|ADR51900.1| hypothetical protein CKC_00745 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
          Length = 55

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 31/48 (64%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          ++  K  L+DESG   +EYGLL +L+A+V I ++T LG KL   F  +
Sbjct: 2  VNCFKKMLKDESGTAFLEYGLLAALVAIVAIGAITNLGTKLTGTFTTV 49


>gi|330816711|ref|YP_004360416.1| Flp/Fap pilin component [Burkholderia gladioli BSR3]
 gi|327369104|gb|AEA60460.1| Flp/Fap pilin component [Burkholderia gladioli BSR3]
          Length = 57

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 29/43 (67%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          ++  FL++E G TA+EYGL+  L+AV ++  VT L G ++  F
Sbjct: 4  LINRFLKEEDGVTAVEYGLIAGLMAVALVAGVTALSGSIQNLF 46


>gi|209551110|ref|YP_002283027.1| Flp/Fap pilin component [Rhizobium leguminosarum bv. trifolii
          WSM2304]
 gi|209536866|gb|ACI56801.1| Flp/Fap pilin component [Rhizobium leguminosarum bv. trifolii
          WSM2304]
          Length = 55

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDK 52
          M I K FL D+ GATA+EYGL+ ++I   +++ +    G L+  F  I+ 
Sbjct: 1  MRIFKAFLADDVGATAVEYGLIAAIICTALVSGLGFFTGALQNVFNVINN 50


>gi|187926423|ref|YP_001892768.1| Flp/Fap pilin component [Ralstonia pickettii 12J]
 gi|241665910|ref|YP_002984269.1| Flp/Fap pilin component [Ralstonia pickettii 12D]
 gi|187728177|gb|ACD29341.1| Flp/Fap pilin component [Ralstonia pickettii 12J]
 gi|240867937|gb|ACS65597.1| Flp/Fap pilin component [Ralstonia pickettii 12D]
          Length = 59

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          MK  I+K F++DE GATA+EYG++  LIA  I   V  LG +L   F  I  A+
Sbjct: 1  MKNAILK-FIRDEQGATAVEYGMIAGLIAAAITVIVGKLGTQLNTVFTNICTAV 53


>gi|325108086|ref|YP_004269154.1| Flp/Fap pilin component [Planctomyces brasiliensis DSM 5305]
 gi|324968354|gb|ADY59132.1| Flp/Fap pilin component [Planctomyces brasiliensis DSM 5305]
          Length = 57

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 33/49 (67%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          VK+F++ E G TA+EY ++++LI VV +T+V  +G      FE++  A+
Sbjct: 8  VKHFIECEDGPTAVEYAVMLALIVVVCLTAVRAIGTNANTQFESVRDAL 56


>gi|302381311|ref|YP_003817134.1| Flp/Fap pilin component [Brevundimonas subvibrioides ATCC 15264]
 gi|302191939|gb|ADK99510.1| Flp/Fap pilin component [Brevundimonas subvibrioides ATCC 15264]
          Length = 57

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 4/55 (7%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGK----LKKAFEAIDKA 53
          M +++ FL DE GATAIEYG++V  I +VI+   T    K      +A EA+  A
Sbjct: 1  MSLIRRFLSDERGATAIEYGMIVGAIFLVIVAGATAFSDKVIVMFNRASEAMTAA 55


>gi|53723203|ref|YP_112188.1| pilus subunit protein [Burkholderia pseudomallei K96243]
 gi|76818831|ref|YP_336464.1| putative pilus subunit protein [Burkholderia pseudomallei 1710b]
 gi|52213617|emb|CAH39671.1| putative pilus subunit protein [Burkholderia pseudomallei K96243]
 gi|76583304|gb|ABA52778.1| putative pilus subunit protein [Burkholderia pseudomallei 1710b]
          Length = 72

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 29/43 (67%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
           +L+DES  +AIEY L+ SLIA+VII +V  +G  L+  F  +
Sbjct: 26 RWLRDESAVSAIEYALIASLIAIVIIGAVQVVGTNLQSVFSTV 68


>gi|167566929|ref|ZP_02359845.1| hypothetical protein BoklE_30496 [Burkholderia oklahomensis
          EO147]
 gi|167573998|ref|ZP_02366872.1| hypothetical protein BoklC_29450 [Burkholderia oklahomensis
          C6786]
          Length = 48

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 30/43 (69%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          ++L+DES  +AIEY L+ SLIA+VII +V  +G  L+  F  +
Sbjct: 2  SWLRDESAVSAIEYALIASLIAIVIIGAVQVVGTNLQSVFSTV 44


>gi|323700356|ref|ZP_08112268.1| Flp/Fap pilin component [Desulfovibrio sp. ND132]
 gi|323460288|gb|EGB16153.1| Flp/Fap pilin component [Desulfovibrio desulfuricans ND132]
          Length = 60

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 32/48 (66%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          M  + N ++DE GATAIEYGL+ +LIA  I+ + + LG ++   F+ I
Sbjct: 1  MTKLMNLIRDEEGATAIEYGLIAALIAAGIVAATSALGDQVVSTFDYI 48


>gi|294102195|ref|YP_003554053.1| Flp/Fap pilin component [Aminobacterium colombiense DSM 12261]
 gi|293617175|gb|ADE57329.1| Flp/Fap pilin component [Aminobacterium colombiense DSM 12261]
          Length = 53

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 32/46 (69%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAID 51
          ++N + DE G   +EYGLL++LIAVV+I ++ TLG K+   F  ++
Sbjct: 5  LRNLVTDEEGQGMVEYGLLLALIAVVVIAALLTLGPKVAGIFTEVE 50


>gi|188592028|ref|YP_001796626.1| flp/fap pilin component [Cupriavidus taiwanensis LMG 19424]
 gi|170938402|emb|CAP63389.1| putative Flp/Fap pilin component [Cupriavidus taiwanensis LMG
          19424]
          Length = 58

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 31/47 (65%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
           ++  F++DE GATAIEYGL+V LIA+ +      LG +L  ++E +
Sbjct: 3  RLIARFIKDERGATAIEYGLIVGLIALGLTVGAGKLGDELNLSYERL 49


>gi|144898052|emb|CAM74916.1| hypothetical protein MGR_1741 [Magnetospirillum gryphiswaldense
          MSR-1]
          Length = 59

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%)

Query: 11 QDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +DE GATAIEYGL+ +L+A+VII  +  L G L   F+ +
Sbjct: 14 RDERGATAIEYGLIAALVAIVIIGGLQALSGGLNTLFQTV 53


>gi|115361029|ref|YP_778166.1| Flp/Fap pilin component [Burkholderia ambifaria AMMD]
 gi|115286357|gb|ABI91832.1| Flp/Fap pilin component [Burkholderia ambifaria AMMD]
          Length = 68

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 29/45 (64%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +  ++ DE G TAIEY LL ++ A V++ SV TL G L+  ++ I
Sbjct: 10 ISRWIDDEQGVTAIEYALLAAMFATVVLGSVVTLKGSLQDMYDMI 54


>gi|126442904|ref|YP_001064072.1| Flp/Fap pilin [Burkholderia pseudomallei 668]
 gi|126456583|ref|YP_001076984.1| Flp/Fap pilin [Burkholderia pseudomallei 1106a]
 gi|134281737|ref|ZP_01768444.1| Flp/Fap pilin [Burkholderia pseudomallei 305]
 gi|167725241|ref|ZP_02408477.1| hypothetical protein BpseD_39846 [Burkholderia pseudomallei DM98]
 gi|167744171|ref|ZP_02416945.1| hypothetical protein Bpse14_39228 [Burkholderia pseudomallei 14]
 gi|167829709|ref|ZP_02461180.1| hypothetical protein Bpseu9_38880 [Burkholderia pseudomallei 9]
 gi|167851178|ref|ZP_02476686.1| hypothetical protein BpseB_38421 [Burkholderia pseudomallei
          B7210]
 gi|167908125|ref|ZP_02495330.1| hypothetical protein BpseN_38236 [Burkholderia pseudomallei NCTC
          13177]
 gi|167916472|ref|ZP_02503563.1| hypothetical protein Bpse112_38727 [Burkholderia pseudomallei
          112]
 gi|217424381|ref|ZP_03455880.1| Flp/Fap pilin [Burkholderia pseudomallei 576]
 gi|226194001|ref|ZP_03789602.1| Flp/Fap pilin [Burkholderia pseudomallei Pakistan 9]
 gi|237507574|ref|ZP_04520289.1| conserved domain protein [Burkholderia pseudomallei MSHR346]
 gi|242313440|ref|ZP_04812457.1| Flp/Fap pilin [Burkholderia pseudomallei 1106b]
 gi|254182588|ref|ZP_04889182.1| Flp/Fap pilin [Burkholderia pseudomallei 1655]
 gi|254192452|ref|ZP_04898891.1| Flp/Fap pilin [Burkholderia pseudomallei S13]
 gi|254264094|ref|ZP_04954959.1| Flp/Fap pilin [Burkholderia pseudomallei 1710a]
 gi|126222395|gb|ABN85900.1| Flp/Fap pilin [Burkholderia pseudomallei 668]
 gi|126230351|gb|ABN93764.1| Flp/Fap pilin [Burkholderia pseudomallei 1106a]
 gi|134246799|gb|EBA46886.1| Flp/Fap pilin [Burkholderia pseudomallei 305]
 gi|169649210|gb|EDS81903.1| Flp/Fap pilin [Burkholderia pseudomallei S13]
 gi|184213123|gb|EDU10166.1| Flp/Fap pilin [Burkholderia pseudomallei 1655]
 gi|217392846|gb|EEC32869.1| Flp/Fap pilin [Burkholderia pseudomallei 576]
 gi|225933946|gb|EEH29932.1| Flp/Fap pilin [Burkholderia pseudomallei Pakistan 9]
 gi|234999779|gb|EEP49203.1| conserved domain protein [Burkholderia pseudomallei MSHR346]
 gi|242136679|gb|EES23082.1| Flp/Fap pilin [Burkholderia pseudomallei 1106b]
 gi|254215096|gb|EET04481.1| Flp/Fap pilin [Burkholderia pseudomallei 1710a]
          Length = 48

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 29/43 (67%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
           +L+DES  +AIEY L+ SLIA+VII +V  +G  L+  F  +
Sbjct: 2  RWLRDESAVSAIEYALIASLIAIVIIGAVQVVGTNLQSVFSTV 44


>gi|241206511|ref|YP_002977607.1| Flp/Fap pilin component [Rhizobium leguminosarum bv. trifolii
          WSM1325]
 gi|240860401|gb|ACS58068.1| Flp/Fap pilin component [Rhizobium leguminosarum bv. trifolii
          WSM1325]
          Length = 55

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDK 52
          M ++K F+ D  GATAIEYGL+ +LI   +++++    G L+  F  I+ 
Sbjct: 1  MRLLKAFVADNRGATAIEYGLVAALIGGALVSALGIFSGSLQDVFNVINN 50


>gi|118589700|ref|ZP_01547105.1| flp/fap pilin component [Stappia aggregata IAM 12614]
 gi|118437786|gb|EAV44422.1| flp/fap pilin component [Stappia aggregata IAM 12614]
          Length = 62

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 30/47 (63%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAID 51
          ++  F+ DESGATAIEYGL+  L+++VI+ +V   G  +   F  I 
Sbjct: 4  LINRFVNDESGATAIEYGLIAGLLSIVIVGAVAATGTSISGIFTKIQ 50


>gi|134299956|ref|YP_001113452.1| Flp/Fap pilin component [Desulfotomaculum reducens MI-1]
 gi|134052656|gb|ABO50627.1| Flp/Fap pilin component [Desulfotomaculum reducens MI-1]
          Length = 59

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 3/59 (5%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
           ++ N L++E+G    EYGL+++LIAVV + ++TTLG  L   F  ++  +   +PAA+
Sbjct: 3  QMLMNLLKEENGQGMAEYGLILALIAVVCVGALTTLGNGLTAKFTDVNAKL---TPAAT 58


>gi|258405295|ref|YP_003198037.1| Flp/Fap pilin component [Desulfohalobium retbaense DSM 5692]
 gi|257797522|gb|ACV68459.1| Flp/Fap pilin component [Desulfohalobium retbaense DSM 5692]
          Length = 56

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/32 (65%), Positives = 25/32 (78%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLG 40
          F  DE GATA EY +++SLIAVVII +VT LG
Sbjct: 8  FFFDEQGATATEYAIMISLIAVVIIVAVTALG 39


>gi|167841421|ref|ZP_02468105.1| hypothetical protein Bpse38_32405 [Burkholderia thailandensis
          MSMB43]
          Length = 48

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 29/42 (69%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +L+DES  +AIEY L+ SLIA+VII +V  +G  L+  F  +
Sbjct: 3  WLRDESAVSAIEYALIASLIAIVIIGAVQVVGTNLQSVFSTV 44


>gi|94312583|ref|YP_585792.1| Flp/Fap pilin component [Cupriavidus metallidurans CH34]
 gi|93356435|gb|ABF10523.1| Flp/Fap pilin component [Cupriavidus metallidurans CH34]
          Length = 63

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 28/48 (58%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          F + + GATAIEYGL+  LIAV I+  VT LG  L   F  +   + T
Sbjct: 9  FRKAQRGATAIEYGLIAGLIAVAIVAGVTNLGQNLGTGFSNLATKVTT 56


>gi|311107636|ref|YP_003980489.1| Flp/Fap pilin component family protein [Achromobacter
          xylosoxidans A8]
 gi|310762325|gb|ADP17774.1| Flp/Fap pilin component family protein [Achromobacter
          xylosoxidans A8]
          Length = 65

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 31/59 (52%), Gaps = 6/59 (10%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAID------KAIVTTSPA 60
           F  DE G TA+EYGL+  ++AV +I +V    G LK  FE +       K   TT PA
Sbjct: 7  QFWNDEDGITALEYGLIAGMVAVALIVAVGAFTGSLKGMFEELGTKLDNAKTGTTTPPA 65


>gi|312139252|ref|YP_004006588.1| flp/fap pilin component [Rhodococcus equi 103S]
 gi|311888591|emb|CBH47903.1| putative Flp/Fap pilin component [Rhodococcus equi 103S]
          Length = 68

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (62%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAID 51
          M + +     +D+ GATA+EYGL+V+ IA+VII +V   G K+   F+  +
Sbjct: 11 MGLDVKDRLTRDDRGATAVEYGLMVAGIAMVIIVAVFAFGDKITDLFDGFN 61


>gi|118588530|ref|ZP_01545939.1| hypothetical protein SIAM614_24652 [Stappia aggregata IAM 12614]
 gi|118439236|gb|EAV45868.1| hypothetical protein SIAM614_24652 [Stappia aggregata IAM 12614]
          Length = 75

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 29/38 (76%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLK 44
          K F++DE GAT IEYGL+V  I+++I+ ++T +G  ++
Sbjct: 20 KEFVRDERGATMIEYGLIVGFISIIILITMTAIGTTMR 57


>gi|23016176|ref|ZP_00055935.1| COG3847: Flp pilus assembly protein, pilin Flp [Magnetospirillum
          magnetotacticum MS-1]
          Length = 57

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 27/41 (65%)

Query: 11 QDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAID 51
          +DE GATAIEYGL+ +LI+VV I  +  LG KL   F  I 
Sbjct: 14 RDEQGATAIEYGLIAALISVVAIPGMLVLGPKLSTLFTTIS 54


>gi|295690801|ref|YP_003594494.1| hypothetical protein Cseg_3444 [Caulobacter segnis ATCC 21756]
 gi|295432704|gb|ADG11876.1| hypothetical protein Cseg_3444 [Caulobacter segnis ATCC 21756]
          Length = 56

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG 40
          H++K F +DESG   I+YGL V++IAV+    VT LG
Sbjct: 3  HLIKAFAKDESGVAGIQYGLFVAVIAVITTVCVTGLG 39


>gi|330953051|gb|EGH53311.1| hypothetical protein PSYCIT7_17084 [Pseudomonas syringae Cit 7]
          Length = 68

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 33/45 (73%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +++FL+D+ GA+AIEY ++V+++A+V+   VT +G  +K  F  I
Sbjct: 14 IQSFLKDKEGASAIEYAVIVAMVALVLFAMVTPMGDAVKAQFNKI 58


>gi|328542085|ref|YP_004302194.1| hypothetical protein SL003B_0463 [polymorphum gilvum SL003B-26A1]
 gi|326411835|gb|ADZ68898.1| hypothetical protein SL003B_0463 [Polymorphum gilvum SL003B-26A1]
          Length = 71

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 36/55 (65%)

Query: 2  KMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          +   ++ FL DE G TA+EYGL++++I+V I+ +V ++G ++   F  + + + T
Sbjct: 15 RRSTLRRFLADERGVTAVEYGLILAMISVAIMATVLSIGEEIAADFTLLSEKLAT 69


>gi|46201036|ref|ZP_00055934.2| COG3847: Flp pilus assembly protein, pilin Flp [Magnetospirillum
          magnetotacticum MS-1]
          Length = 57

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 27/41 (65%)

Query: 11 QDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAID 51
          +DE GATAIEYGL+ +LI+VV I  +  LG KL   F  I 
Sbjct: 14 RDEQGATAIEYGLIAALISVVAIPGMLVLGPKLSTLFTTIS 54


>gi|114705460|ref|ZP_01438368.1| probable PilA2 pilus assembly protein [Fulvimarina pelagi
          HTCC2506]
 gi|114540245|gb|EAU43365.1| probable PilA2 pilus assembly protein [Fulvimarina pelagi
          HTCC2506]
          Length = 62

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 30/46 (65%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          FL++ESGATAIEY L+  +IAV +IT + TLG  +   F  I   +
Sbjct: 15 FLKNESGATAIEYALIAGMIAVGLITILGTLGSNMVAGFTKISDEV 60


>gi|190893600|ref|YP_001980142.1| pilus component protein [Rhizobium etli CIAT 652]
 gi|190698879|gb|ACE92964.1| putative pilus component protein [Rhizobium etli CIAT 652]
          Length = 55

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M ++K F  D++GATA+EYGL+ ++I   +++ +    G L+  F  +   I
Sbjct: 1  MRLLKAFFADDTGATAVEYGLIAAVICTALVSGLGFFTGSLQNVFSVVSNNI 52


>gi|94497282|ref|ZP_01303853.1| hypothetical protein SKA58_07008 [Sphingomonas sp. SKA58]
 gi|94423145|gb|EAT08175.1| hypothetical protein SKA58_07008 [Sphingomonas sp. SKA58]
          Length = 54

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (72%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          M  V+  L++E GATAIEYGL+ +LIAV  I ++T+LGG LK  F ++
Sbjct: 1  MQFVRKMLKNEKGATAIEYGLIAALIAVAAIGAMTSLGGNLKNTFNSV 48


>gi|167821370|ref|ZP_02453050.1| hypothetical protein Bpse9_39988 [Burkholderia pseudomallei 91]
 gi|167899809|ref|ZP_02487210.1| hypothetical protein Bpse7_39160 [Burkholderia pseudomallei 7894]
 gi|167924328|ref|ZP_02511419.1| hypothetical protein BpseBC_37578 [Burkholderia pseudomallei
          BCC215]
 gi|254187139|ref|ZP_04893654.1| Flp/Fap pilin [Burkholderia pseudomallei Pasteur 52237]
 gi|254296480|ref|ZP_04963936.1| Flp/Fap pilin [Burkholderia pseudomallei 406e]
 gi|157806473|gb|EDO83643.1| Flp/Fap pilin [Burkholderia pseudomallei 406e]
 gi|157934822|gb|EDO90492.1| Flp/Fap pilin [Burkholderia pseudomallei Pasteur 52237]
          Length = 48

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 28/41 (68%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          L+DES  +AIEY L+ SLIA+VII +V  +G  L+  F  +
Sbjct: 4  LRDESAVSAIEYALIASLIAIVIIGAVQVVGTNLQSVFSTV 44


>gi|84385687|ref|ZP_00988718.1| hypothetical protein V12B01_26174 [Vibrio splendidus 12B01]
 gi|84379667|gb|EAP96519.1| hypothetical protein V12B01_26174 [Vibrio splendidus 12B01]
          Length = 68

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG--GKLKKAFEAIDKAIVTTSP 59
           +  F  DE G TAIEYGL+   +AV++ T+V   G  GKL+ AF  +  AI T S 
Sbjct: 12 FLSQFKNDERGVTAIEYGLIAVAMAVLVTTAVGADGFIGKLEAAFTKVGDAITTASS 68


>gi|153833206|ref|ZP_01985873.1| conserved domain protein [Vibrio harveyi HY01]
 gi|148870477|gb|EDL69392.1| conserved domain protein [Vibrio harveyi HY01]
          Length = 68

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG--GKLKKAFEAIDKAIVTTS 58
           +  F  DE G TAIEYGL+   +AV++ T+V + G  GKL+ AF+ +  AI T S
Sbjct: 12 FLSKFKNDERGVTAIEYGLIAVAMAVLVTTAVGSDGFIGKLEGAFDQVAGAIDTAS 67


>gi|304393805|ref|ZP_07375730.1| phosphoribosyl-AMP cyclohydrolase [Ahrensia sp. R2A130]
 gi|303294004|gb|EFL88379.1| phosphoribosyl-AMP cyclohydrolase [Ahrensia sp. R2A130]
          Length = 65

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          +K    K F  DE GATAIEYGL   +IA+  I  ++  G   K+      + +  +S  
Sbjct: 2  LKRGFTKRFAGDERGATAIEYGLAAGMIALAAIGGMSAAGEGTKRPLNCAGETLQASSKG 61

Query: 61 AS 62
          +S
Sbjct: 62 SS 63


>gi|225872751|ref|YP_002754208.1| hypothetical protein ACP_1103 [Acidobacterium capsulatum ATCC
           51196]
 gi|225793767|gb|ACO33857.1| hypothetical protein ACP_1103 [Acidobacterium capsulatum ATCC
           51196]
          Length = 106

 Score = 43.1 bits (100), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 33/54 (61%)

Query: 5   IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
           ++ N LQDESG   IEY L+ +LI +  + +++ +   +K AF +++  + T +
Sbjct: 52  VLNNLLQDESGQDLIEYALVAALIGLAAVAAMSGVANGIKNAFNSVNNQLTTAT 105


>gi|319795777|ref|YP_004157417.1| flp/fap pilin component [Variovorax paradoxus EPS]
 gi|315598240|gb|ADU39306.1| Flp/Fap pilin component [Variovorax paradoxus EPS]
          Length = 61

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVT---TLGGKLKKAFEAIDKAIVTTSP 59
          +  F++DE GATAIEYG++  ++AV+++   +   TL G ++  F  I  A+ T +P
Sbjct: 5  ITRFIRDEEGATAIEYGIIAGMMAVLLVAVFSPSGTLYGAIEGVFGRISTALDTVTP 61


>gi|326387192|ref|ZP_08208802.1| hypothetical protein Y88_1242 [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326208373|gb|EGD59180.1| hypothetical protein Y88_1242 [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 69

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 30/52 (57%), Gaps = 4/52 (7%)

Query: 1  MKMHIVKNFL----QDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFE 48
          M M  + + L     DESGATAIEYGL+ +LIA   I ++ +LG  L   F 
Sbjct: 4  MTMRFLGDLLARIGNDESGATAIEYGLIAALIATGAIVAMGSLGNSLSNTFS 55


>gi|162147488|ref|YP_001601949.1| Flp/Fap pilin component [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545595|ref|YP_002277824.1| Flp/Fap pilin component [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786065|emb|CAP55647.1| putative Flp/Fap pilin component [Gluconacetobacter
          diazotrophicus PAl 5]
 gi|209533272|gb|ACI53209.1| Flp/Fap pilin component [Gluconacetobacter diazotrophicus PAl 5]
          Length = 56

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 27/40 (67%)

Query: 11 QDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
              G TA+EYGL+ +LIA VI+T+V T+G KL   F +I
Sbjct: 13 NSRRGVTALEYGLIAALIAAVIMTAVGTIGSKLNTVFSSI 52


>gi|163851900|ref|YP_001639943.1| Flp/Fap pilin component [Methylobacterium extorquens PA1]
 gi|163663505|gb|ABY30872.1| Flp/Fap pilin component [Methylobacterium extorquens PA1]
          Length = 65

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          +I K F+ DESGATAIEYG++ ++I + I+    +    L  AF  +   + T
Sbjct: 3  NIAKRFISDESGATAIEYGMVAAMIGIAIVGIFASFKTNLTTAFTTLGTGLNT 55


>gi|317122050|ref|YP_004102053.1| Flp/Fap pilin component [Thermaerobacter marianensis DSM 12885]
 gi|315592030|gb|ADU51326.1| Flp/Fap pilin component [Thermaerobacter marianensis DSM 12885]
          Length = 63

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 33/53 (62%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          VK  L+DE+G   +EYGL+++LIAVV+I ++  L G L   F  + + +  T 
Sbjct: 11 VKFRLRDEAGQGMVEYGLIIALIAVVLIGALVALSGGLGSIFSRVTQQLNNTQ 63


>gi|312882141|ref|ZP_07741890.1| Flp pilus assembly protein [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309370187|gb|EFP97690.1| Flp pilus assembly protein [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 68

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (62%), Gaps = 2/54 (3%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG--GKLKKAFEAIDKAIVT 56
           +  F  DE G TAIEYGL+   +AV++ T+V T G  G+L+ AF ++  AI T
Sbjct: 12 FLSQFKNDERGVTAIEYGLIAVAMAVLVTTAVGTEGFIGRLETAFTSVATAIET 65


>gi|218462815|ref|ZP_03502906.1| putative pilus component protein [Rhizobium etli Kim 5]
 gi|218661044|ref|ZP_03516974.1| putative pilus component protein [Rhizobium etli IE4771]
          Length = 55

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M ++K F  D +GATA+EYGL+ +LI   +++ +    G L+  F  +   I
Sbjct: 1  MRLLKAFFADGTGATAVEYGLIAALICTALVSGLGFFTGSLQNVFSLLSNNI 52


>gi|148258232|ref|YP_001242817.1| putative Flp/Fap pilin component [Bradyrhizobium sp. BTAi1]
 gi|146410405|gb|ABQ38911.1| Putative Flp/Fap pilin component [Bradyrhizobium sp. BTAi1]
          Length = 54

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKL 43
          +++  F++DESGATAIEYGL+ + I++ II +V  LG  L
Sbjct: 3  NLLARFVKDESGATAIEYGLIAAGISLAIIAAVNGLGTSL 42


>gi|313902399|ref|ZP_07835802.1| Flp/Fap pilin component [Thermaerobacter subterraneus DSM 13965]
 gi|313467330|gb|EFR62841.1| Flp/Fap pilin component [Thermaerobacter subterraneus DSM 13965]
          Length = 66

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 31/45 (68%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          VK  L+DE+G   +EYGL+++LIAVV+I ++  + G L   FE +
Sbjct: 11 VKFRLRDEAGQGMVEYGLIIALIAVVLIGALVAMQGGLSAIFERV 55


>gi|121534393|ref|ZP_01666217.1| Flp/Fap pilin component [Thermosinus carboxydivorans Nor1]
 gi|121307163|gb|EAX48081.1| Flp/Fap pilin component [Thermosinus carboxydivorans Nor1]
          Length = 57

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 33/50 (66%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          M   ++K +L+ + G   +EYGL+++LIAVV+I ++T +G  L+  F  +
Sbjct: 3  MWWEMIKTYLRCQKGQGMVEYGLILALIAVVVIGALTLMGTNLQGMFNNV 52


>gi|28871964|ref|NP_794583.1| hypothetical protein PSPTO_4849 [Pseudomonas syringae pv. tomato
          str. DC3000]
 gi|213968018|ref|ZP_03396164.1| hypothetical protein PSPTOT1_4617 [Pseudomonas syringae pv.
          tomato T1]
 gi|301383666|ref|ZP_07232084.1| hypothetical protein PsyrptM_13578 [Pseudomonas syringae pv.
          tomato Max13]
 gi|302059965|ref|ZP_07251506.1| hypothetical protein PsyrptK_08235 [Pseudomonas syringae pv.
          tomato K40]
 gi|302131631|ref|ZP_07257621.1| hypothetical protein PsyrptN_09572 [Pseudomonas syringae pv.
          tomato NCPPB 1108]
 gi|28855217|gb|AAO58278.1| conserved protein of unknown function [Pseudomonas syringae pv.
          tomato str. DC3000]
 gi|213927361|gb|EEB60910.1| hypothetical protein PSPTOT1_4617 [Pseudomonas syringae pv.
          tomato T1]
 gi|331014710|gb|EGH94766.1| hypothetical protein PLA106_02360 [Pseudomonas syringae pv.
          lachrymans str. M302278PT]
          Length = 68

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 35/49 (71%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +++FL+D+  A+AIEY ++V+++A+V+   VT +G  +K  F  I +A+
Sbjct: 14 IQSFLKDKEAASAIEYAVIVAMVALVLFAMVTPMGTAIKARFNEIIEAL 62


>gi|307943137|ref|ZP_07658482.1| Flp/Fap pilin component [Roseibium sp. TrichSKD4]
 gi|307773933|gb|EFO33149.1| Flp/Fap pilin component [Roseibium sp. TrichSKD4]
          Length = 59

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 36/54 (66%), Gaps = 1/54 (1%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          MK  +V+  L+DE+G T+IEY L+  L+++++I +VT +G  L   FE ++  +
Sbjct: 1  MKNLLVR-LLKDEAGTTSIEYALIGVLLSIIMIGAVTMMGTSLNSMFEGVESGL 53


>gi|89899598|ref|YP_522069.1| Flp/Fap pilin component [Rhodoferax ferrireducens T118]
 gi|89344335|gb|ABD68538.1| Flp/Fap pilin component [Rhodoferax ferrireducens T118]
          Length = 72

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 31/48 (64%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
           +L DESG TA+EYGLL +LIAV II +++  G  L   ++   + ++
Sbjct: 22 EWLIDESGVTAMEYGLLAALIAVTIIGAISATGTSLTTIYDYWSETVI 69


>gi|329888706|ref|ZP_08267304.1| flp/Fap pilin component family protein [Brevundimonas diminuta
          ATCC 11568]
 gi|328847262|gb|EGF96824.1| flp/Fap pilin component family protein [Brevundimonas diminuta
          ATCC 11568]
          Length = 60

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          MK  I + F +DE GATAIEYGL+  LI +VII +V+    +    ++ I   I
Sbjct: 1  MKGFICR-FHRDEGGATAIEYGLICGLIFLVIIAAVSAFAARSTAMYDYISTTI 53


>gi|240139023|ref|YP_002963498.1| Flp/Fap pilin component [Methylobacterium extorquens AM1]
 gi|240008995|gb|ACS40221.1| Flp/Fap pilin component [Methylobacterium extorquens AM1]
          Length = 69

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          +I K F+ DESGATAIEYG++ ++I + I+    +    L  AF  +   + T
Sbjct: 7  NIAKRFISDESGATAIEYGMVAAMIGIAIVGIFASFKTNLTTAFTTLGTGLNT 59


>gi|299131747|ref|ZP_07024942.1| Flp/Fap pilin component [Afipia sp. 1NLS2]
 gi|298591884|gb|EFI52084.1| Flp/Fap pilin component [Afipia sp. 1NLS2]
          Length = 53

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 33/52 (63%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M  +K F  D+SGAT+IEY ++ + +++VI+ +V  +G  L   +E I  A+
Sbjct: 1  MKTLKRFFLDQSGATSIEYAIIAAGLSIVILVAVNGIGSALNGKYEMIRAAV 52


>gi|254561618|ref|YP_003068713.1| Flp/Fap pilin component [Methylobacterium extorquens DM4]
 gi|254268896|emb|CAX24857.1| Flp/Fap pilin component [Methylobacterium extorquens DM4]
          Length = 68

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 28/44 (63%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          +I K F+ DESGATAIEYG++ ++I + I+    +    L  AF
Sbjct: 7  NIAKRFISDESGATAIEYGMVAAMIGIAIVGIFASFKTNLTTAF 50


>gi|167584953|ref|ZP_02377341.1| hypothetical protein BuboB_06431 [Burkholderia ubonensis Bu]
          Length = 60

 Score = 42.4 bits (98), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 27/42 (64%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          V  ++ D+ G TAIEY LL SLIA+ I+ +V TLG  L   +
Sbjct: 8  VARWIDDKGGVTAIEYALLASLIAMAIVVAVATLGTTLDGVY 49


>gi|156977412|ref|YP_001448318.1| Flp pilus assembly protein [Vibrio harveyi ATCC BAA-1116]
 gi|156529006|gb|ABU74091.1| hypothetical protein VIBHAR_06199 [Vibrio harveyi ATCC BAA-1116]
          Length = 68

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 36/60 (60%), Gaps = 7/60 (11%)

Query: 2  KMHIVKN-----FLQDESGATAIEYGLLVSLIAVVIITSVTTLG--GKLKKAFEAIDKAI 54
          K+++  N     F  DE G TAIEYGL+   +AV++ T+V+  G  G L+ AFE +  AI
Sbjct: 4  KLYVQTNLFLSKFKNDERGVTAIEYGLIAVAMAVLVTTAVSPSGFIGSLEAAFEQVATAI 63


>gi|146343301|ref|YP_001208349.1| putative Flp/Fap pilin component [Bradyrhizobium sp. ORS278]
 gi|146196107|emb|CAL80134.1| putative Flp/Fap pilin component [Bradyrhizobium sp. ORS278]
          Length = 53

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (71%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          F +DESGATAIEYGL+ + IA+ IIT +  LG  L+  F
Sbjct: 5  FYEDESGATAIEYGLICAGIALAIITILNKLGLTLEGIF 43


>gi|218508205|ref|ZP_03506083.1| putative pilus component protein [Rhizobium etli Brasil 5]
 gi|327193400|gb|EGE60300.1| putative pilus component protein [Rhizobium etli CNPAF512]
          Length = 55

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M ++K F  D +GATA+EYGL+ ++I   +++ +    G L+  F  +   I
Sbjct: 1  MRLLKAFFADGTGATAVEYGLIAAVICTALVSGLGFFTGSLQNVFSVVSNNI 52


>gi|319782175|ref|YP_004141651.1| Flp/Fap pilin component [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
 gi|317168063|gb|ADV11601.1| Flp/Fap pilin component [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
          Length = 72

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 31/52 (59%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M + + F  DE+GA  +EY +L+ +IAV  I +V  +GG +   F A+  A+
Sbjct: 5  MTMTRQFRDDENGAAMVEYSILIGIIAVASIMTVLAIGGWVNGRFSALCTAL 56


>gi|220913379|ref|YP_002488688.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6]
 gi|219860257|gb|ACL40599.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6]
          Length = 66

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++N +  E GATA EY LLV+ IA++II  VT  G  L   F  +   +
Sbjct: 15 LRNRMDSEKGATATEYSLLVAFIALLIIAGVTLFGNALSAWFSTLGSTV 63


>gi|114797760|ref|YP_761694.1| flp/Fap pilus protein [Hyphomonas neptunium ATCC 15444]
 gi|114737934|gb|ABI76059.1| flp/fap pilus protein [Hyphomonas neptunium ATCC 15444]
          Length = 57

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 39/54 (72%), Gaps = 1/54 (1%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT-TSPA 60
           FL+DESGATAIEYGL+ +LIAV II  V+ LG ++   F+ I+K I T  +PA
Sbjct: 4  RFLKDESGATAIEYGLIAALIAVAIIGGVSALGTQVDTTFDEIEKGIRTGEAPA 57


>gi|172065269|ref|YP_001815981.1| Flp/Fap pilin component [Burkholderia ambifaria MC40-6]
 gi|171997511|gb|ACB68428.1| Flp/Fap pilin component [Burkholderia ambifaria MC40-6]
          Length = 68

 Score = 42.0 bits (97), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 29/45 (64%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          V  ++ D+ G T+IEY L+ +LIA +++ SV TLGG L   +  I
Sbjct: 10 VLRWIGDDQGVTSIEYALIGALIATLVMASVMTLGGSLDDTYNMI 54


>gi|134291861|ref|YP_001115630.1| Flp/Fap pilin component [Burkholderia vietnamiensis G4]
 gi|134135050|gb|ABO59375.1| Flp/Fap pilin component [Burkholderia vietnamiensis G4]
          Length = 68

 Score = 42.0 bits (97), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          V  ++ DE G T+IEY LL ++ A V++ +V  L G ++ A++AI  +IVT +
Sbjct: 10 VSRWIDDERGVTSIEYALLAAVFATVVLGAVVALKGSVQGAYDAI-ASIVTAA 61


>gi|315121894|ref|YP_004062383.1| hypothetical protein CKC_00720 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
 gi|313495296|gb|ADR51895.1| hypothetical protein CKC_00720 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
          Length = 44

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 1/30 (3%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAV 30
          MK  I++NFLQD+S AT + YGL V+LIAV
Sbjct: 1  MKFDIIRNFLQDKSSAT-VRYGLFVALIAV 29


>gi|224824208|ref|ZP_03697316.1| Flp/Fap pilin component [Lutiella nitroferrum 2002]
 gi|224603627|gb|EEG09802.1| Flp/Fap pilin component [Lutiella nitroferrum 2002]
          Length = 64

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 28/43 (65%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          I+ +   D+ G T+IEY LL SLIAVVI++SV  LG  L   F
Sbjct: 7  ILTSLFNDDEGVTSIEYALLGSLIAVVILSSVLGLGTNLTALF 49


>gi|75674502|ref|YP_316923.1| Flp/Fap pilin component [Nitrobacter winogradskyi Nb-255]
 gi|74419372|gb|ABA03571.1| Flp/Fap pilin component [Nitrobacter winogradskyi Nb-255]
          Length = 55

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 36/51 (70%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++   FL+DESGATAIEYGL+ + IAV IIT+V TLG  L   F  +++ +
Sbjct: 3  NLFSRFLKDESGATAIEYGLIAAGIAVAIITAVNTLGTSLNTTFTKVEQDL 53


>gi|315497468|ref|YP_004086272.1| flp/fap pilin component [Asticcacaulis excentricus CB 48]
 gi|315415480|gb|ADU12121.1| Flp/Fap pilin component [Asticcacaulis excentricus CB 48]
          Length = 57

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAID 51
          M IV+ FL D+SGATAIEY L+ SL+ +    ++   G   K  +  I 
Sbjct: 1  MQIVREFLSDKSGATAIEYALIASLVFLAASGAILAYGESFKNMYSFIS 49


>gi|85713501|ref|ZP_01044491.1| Flp/Fap pilin component [Nitrobacter sp. Nb-311A]
 gi|85699405|gb|EAQ37272.1| Flp/Fap pilin component [Nitrobacter sp. Nb-311A]
          Length = 56

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          ++   FL+DESGATAIEYGL+ + IAV IIT+V TLG  L   F+ +
Sbjct: 3  NLFSRFLKDESGATAIEYGLIAAGIAVAIITAVNTLGTSLNTTFQNV 49


>gi|330873639|gb|EGH07788.1| hypothetical protein PSYMP_04385 [Pseudomonas syringae pv.
          morsprunorum str. M302280PT]
 gi|330963440|gb|EGH63700.1| hypothetical protein PSYAC_02082 [Pseudomonas syringae pv.
          actinidiae str. M302091]
          Length = 68

 Score = 41.6 bits (96), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 34/49 (69%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +++FL+D+  A+AIEY ++V+++A+V+   VT +G  +K  F  I  A+
Sbjct: 14 IQSFLKDKEAASAIEYAVIVAMVALVLFAMVTPMGTAIKARFNEIITAL 62


>gi|86750604|ref|YP_487100.1| Flp/Fap pilin component [Rhodopseudomonas palustris HaA2]
 gi|86573632|gb|ABD08189.1| Flp/Fap pilin component [Rhodopseudomonas palustris HaA2]
          Length = 54

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 33/51 (64%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           ++  F    SGATAIEY L+ + +++VI+ +V  LG KL  ++ +++ A+
Sbjct: 3  RLISRFTCGTSGATAIEYALIAAGLSIVILVTVNGLGSKLNTSYTSVNTAL 53


>gi|192290480|ref|YP_001991085.1| Flp/Fap pilin component [Rhodopseudomonas palustris TIE-1]
 gi|192284229|gb|ACF00610.1| Flp/Fap pilin component [Rhodopseudomonas palustris TIE-1]
          Length = 54

 Score = 41.6 bits (96), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 32/51 (62%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           ++  F  D  GATAIEY ++ + +++VI+  VTTLG  L   + ++ +A+
Sbjct: 3  RLISRFWADTRGATAIEYAMIAAGLSIVILGVVTTLGNSLAGKYTSVSEAM 53


>gi|103487278|ref|YP_616839.1| Flp/Fap pilin component [Sphingopyxis alaskensis RB2256]
 gi|98977355|gb|ABF53506.1| Flp/Fap pilin component [Sphingopyxis alaskensis RB2256]
          Length = 54

 Score = 41.6 bits (96), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 30/48 (62%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          M  +K F++D   ATAIEYGL+ +LIAV  I+++  +G  +   F  +
Sbjct: 1  MKFIKKFVRDTKAATAIEYGLIAALIAVAGISAMGLVGNSVSNTFNEV 48


>gi|325964110|ref|YP_004242016.1| Flp/Fap pilin component [Arthrobacter phenanthrenivorans Sphe3]
 gi|323470197|gb|ADX73882.1| Flp/Fap pilin component [Arthrobacter phenanthrenivorans Sphe3]
          Length = 60

 Score = 41.6 bits (96), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 35/50 (70%), Gaps = 1/50 (2%)

Query: 6  VKNFL-QDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          VK+ L ++E GAT +EYG++V+ IAV+++ +V  LG K+   F ++  AI
Sbjct: 11 VKDRLAREEKGATMVEYGIMVAFIAVLVMAAVIILGPKIAGLFTSVSTAI 60


>gi|220913378|ref|YP_002488687.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6]
 gi|219860256|gb|ACL40598.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6]
          Length = 66

 Score = 41.2 bits (95), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 28/51 (54%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          VK+    E GATA EY LLV+ IA++II  VT  G  L   F  +   + T
Sbjct: 15 VKDRFSSEKGATATEYSLLVAFIALLIIAGVTLFGNALSGWFSTLGSRVGT 65


>gi|239817409|ref|YP_002946319.1| Flp/Fap pilin component [Variovorax paradoxus S110]
 gi|239803986|gb|ACS21053.1| Flp/Fap pilin component [Variovorax paradoxus S110]
          Length = 60

 Score = 41.2 bits (95), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 3/48 (6%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVII---TSVTTLGGKLKKAFEAI 50
          +  FL+DE GATAIEYG++  L+A+V++   +  T +G  L   F AI
Sbjct: 5  ITRFLRDEEGATAIEYGIIAGLMAIVLVAAFSKTTGIGLALTNMFTAI 52


>gi|149184276|ref|ZP_01862594.1| hypothetical protein ED21_26198 [Erythrobacter sp. SD-21]
 gi|148831596|gb|EDL50029.1| hypothetical protein ED21_26198 [Erythrobacter sp. SD-21]
          Length = 60

 Score = 41.2 bits (95), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          +  +K    DE GATA+EYGL+++LI V I+ +V+T G      +  +  A+    P
Sbjct: 2  VQFLKKLGHDERGATAVEYGLILALIFVSIMGAVSTFGETTIDMWNTVSSAVSAARP 58


>gi|17937222|ref|NP_534011.1| fimbriae associated protein [Agrobacterium tumefaciens str. C58]
 gi|17741918|gb|AAL44327.1| fimbriae associated protein [Agrobacterium tumefaciens str. C58]
          Length = 71

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +H   NF ++E+GATAIEYGL+  +I+  +I  +  +   +   F+ I  A 
Sbjct: 17 LHFFINFCKNENGATAIEYGLIAGIISAALIAGLGNISSGINAVFQFIVDAF 68


>gi|299069502|emb|CBJ40771.1| putative Flp/Fap pilin component [Ralstonia solanacearum CMR15]
          Length = 58

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 1/54 (1%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          MK  I++ FL+DE GATAIEYGLL  LIA  I  +VTTLG ++K AF ++  AI
Sbjct: 1  MKNAILQ-FLRDEQGATAIEYGLLAGLIAAAIAATVTTLGTEIKTAFGSVCTAI 53


>gi|289675701|ref|ZP_06496591.1| hypothetical protein PsyrpsF_20686 [Pseudomonas syringae pv.
          syringae FF5]
          Length = 68

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 32/45 (71%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +++FL+D+  A+AIEY ++V+++A+V+   VT +G  +K  F  I
Sbjct: 14 IQSFLKDKEAASAIEYAVIVAMVALVLFAMVTPMGDAVKAQFNKI 58


>gi|329847250|ref|ZP_08262278.1| flp/Fap pilin component family protein [Asticcacaulis
          biprosthecum C19]
 gi|328842313|gb|EGF91882.1| flp/Fap pilin component family protein [Asticcacaulis
          biprosthecum C19]
          Length = 56

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 29/46 (63%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +++ F+ DE GATAIEYGL+  L+ + ++ ++T  G      +E I
Sbjct: 1  MLRRFIADERGATAIEYGLVAGLLFLGVVGAITAYGDAFTTMYEGI 46


>gi|327540757|gb|EGF27324.1| Flp/Fap pilin component [Rhodopirellula baltica WH47]
          Length = 59

 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 27/39 (69%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          FL++E G TA+EY +L++LI VV I +VTT+G      F
Sbjct: 11 FLKEEDGPTAVEYAVLLALIIVVCIGAVTTIGSNANAKF 49


>gi|300021851|ref|YP_003754462.1| Flp/Fap pilin component [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523672|gb|ADJ22141.1| Flp/Fap pilin component [Hyphomicrobium denitrificans ATCC 51888]
          Length = 58

 Score = 41.2 bits (95), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 31/45 (68%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          V+ F  DE+GAT+IEY L+ S++++ I+ ++  + G L   FE++
Sbjct: 6  VREFAADENGATSIEYALIASIVSIAIVGALMGVKGSLVSVFESV 50


>gi|16125085|ref|NP_419649.1| hypothetical protein CC_0832 [Caulobacter crescentus CB15]
 gi|221233812|ref|YP_002516248.1| Flp/Fap pilin component protein [Caulobacter crescentus NA1000]
 gi|13422083|gb|AAK22817.1| hypothetical protein CC_0832 [Caulobacter crescentus CB15]
 gi|220962984|gb|ACL94340.1| Flp/Fap pilin component protein [Caulobacter crescentus NA1000]
          Length = 57

 Score = 41.2 bits (95), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 29/39 (74%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          F +D+SGATA+E G++V LI++ +I ++T L   +K AF
Sbjct: 10 FWRDQSGATAVEVGVIVVLISIALIGAITVLSDGIKTAF 48


>gi|39934951|ref|NP_947227.1| Flp/Fap pilin protein [Rhodopseudomonas palustris CGA009]
 gi|39648802|emb|CAE27323.1| Flp/Fap pilin component [Rhodopseudomonas palustris CGA009]
          Length = 63

 Score = 41.2 bits (95), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 31/51 (60%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           ++  F  D  GATAIEY ++ + +++VI+  VTTLG  L   + ++  A+
Sbjct: 12 RLISRFWADTRGATAIEYAMIAAGLSIVILGVVTTLGNSLAGKYTSVSDAL 62


>gi|94309596|ref|YP_582806.1| Flp/Fap pilin component [Cupriavidus metallidurans CH34]
 gi|93353448|gb|ABF07537.1| Flp/Fap pilin component; Putative pilus subunit protein
          [Cupriavidus metallidurans CH34]
          Length = 57

 Score = 41.2 bits (95), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 30/46 (65%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +   F +D  G T+IEY LL +LIA+VII +V+ LG  LK  ++ +
Sbjct: 7  MCDTFRRDTRGVTSIEYALLGALIAMVIIGAVSLLGTNLKALYDMV 52


>gi|297618084|ref|YP_003703243.1| Flp/Fap pilin component [Syntrophothermus lipocalidus DSM 12680]
 gi|297145921|gb|ADI02678.1| Flp/Fap pilin component [Syntrophothermus lipocalidus DSM 12680]
          Length = 53

 Score = 41.2 bits (95), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 33/52 (63%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          + +VK  L +E G    EYGL+++L+A+ +IT +  +GG +K  F+ +  A+
Sbjct: 2  LSLVKRLLVEEEGQGMAEYGLILALVAIAVITVLGLMGGSIKDKFQEVIDAL 53


>gi|254420564|ref|ZP_05034288.1| Flp/Fap pilin component superfamily [Brevundimonas sp. BAL3]
 gi|196186741|gb|EDX81717.1| Flp/Fap pilin component superfamily [Brevundimonas sp. BAL3]
          Length = 59

 Score = 41.2 bits (95), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 22/32 (68%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLG 40
          FL D+ GATAIEYGL+  LI V I+  +  LG
Sbjct: 8  FLNDDRGATAIEYGLICGLIFVAILGGLNALG 39


>gi|171920997|gb|ACB59180.1| Flp1 [Actinobacillus suis ATCC 33415]
          Length = 81

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGG---KLKKAFEAIDKAI 54
          ++NF Q++ G TAIEYGL+   +A++IIT     GG    LK  F  + K+I
Sbjct: 17 IRNFKQNQQGVTAIEYGLIAVALAILIITVFYNDGGFIQSLKAKFADLTKSI 68


>gi|146339727|ref|YP_001204775.1| putative Flp/Fap pilin component [Bradyrhizobium sp. ORS278]
 gi|146192533|emb|CAL76538.1| Putative Flp/Fap pilin component [Bradyrhizobium sp. ORS278]
          Length = 54

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 34/51 (66%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           ++ +FL+ ++GAT+IEY ++   +++VI+ +V  LG  L   F +I+ +I
Sbjct: 3  QLIASFLRHQAGATSIEYAIIAGGLSIVILAAVNGLGSGLSSKFTSINSSI 53


>gi|225182001|ref|ZP_03735433.1| Flp/Fap pilin component [Dethiobacter alkaliphilus AHT 1]
 gi|225167286|gb|EEG76105.1| Flp/Fap pilin component [Dethiobacter alkaliphilus AHT 1]
          Length = 59

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 32/47 (68%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
           +V+ F  +ESG    EY L+++L+++V I ++  +GG++++ FE I
Sbjct: 3  EMVRRFFTEESGQGMTEYALILALVSIVAIGALFAMGGRIEEIFEQI 49


>gi|260892921|ref|YP_003239018.1| Flp/Fap pilin component [Ammonifex degensii KC4]
 gi|260865062|gb|ACX52168.1| Flp/Fap pilin component [Ammonifex degensii KC4]
          Length = 57

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +   +DE G    EYGL+++LIA+V+I ++T LG  ++  F+ +   +  T 
Sbjct: 6  RELWRDEEGQGMAEYGLILALIAIVVIIALTALGTSIRDKFQKVSDELNKTQ 57


>gi|163757623|ref|ZP_02164712.1| component of type IV pilus, pilin subunit protein [Hoeflea
           phototrophica DFL-43]
 gi|162285125|gb|EDQ35407.1| component of type IV pilus, pilin subunit protein [Hoeflea
           phototrophica DFL-43]
          Length = 120

 Score = 40.8 bits (94), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 30/45 (66%), Gaps = 1/45 (2%)

Query: 9   FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI-DK 52
           F +D++G TAIEYGL+ +LI+V II    TLG  +   F+ + DK
Sbjct: 67  FAKDKTGTTAIEYGLIGTLISVSIIAGAMTLGNTVGNQFQGLADK 111


>gi|218673962|ref|ZP_03523631.1| putative pilus component protein [Rhizobium etli GR56]
          Length = 62

 Score = 40.8 bits (94), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 28/43 (65%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKK 45
          M ++K FL D +GATA+EYGL+ ++I   +++ +    G  +K
Sbjct: 1  MRLLKAFLADGTGATAVEYGLIAAVICTALVSGLGLFSGSCQK 43


>gi|317123661|ref|YP_004097773.1| Flp/Fap pilin component [Intrasporangium calvum DSM 43043]
 gi|315587749|gb|ADU47046.1| Flp/Fap pilin component [Intrasporangium calvum DSM 43043]
          Length = 59

 Score = 40.8 bits (94), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 28/42 (66%)

Query: 13 ESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          E GATA+EYGL+V+LIAV I+ +V  LG  L   F  +  A+
Sbjct: 15 EEGATAVEYGLMVALIAVAIMVTVGLLGDALDGLFARVLAAV 56


>gi|330938337|gb|EGH41969.1| hypothetical protein PSYPI_05933 [Pseudomonas syringae pv. pisi
          str. 1704B]
          Length = 68

 Score = 40.8 bits (94), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 32/45 (71%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +++FL+D+  A+AIEY ++V+++A+V+   VT +G  +K  F  I
Sbjct: 14 IQSFLKDKEAASAIEYAVIVAMVALVLFAMVTPMGDAVKGQFNKI 58


>gi|90425193|ref|YP_533563.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB18]
 gi|90107207|gb|ABD89244.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB18]
          Length = 53

 Score = 40.4 bits (93), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +IV  FL+DESGATAIEYGL+ + IA+ IIT+V T+G  L   F +I
Sbjct: 3  NIVARFLKDESGATAIEYGLIAAGIALAIITAVNTVGSNLSAKFTSI 49


>gi|194288840|ref|YP_002004747.1| flp pilin component [Cupriavidus taiwanensis LMG 19424]
 gi|193222675|emb|CAQ68678.1| Flp pilin component [Cupriavidus taiwanensis LMG 19424]
          Length = 57

 Score = 40.4 bits (93), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 29/40 (72%)

Query: 11 QDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
           D++G T+IEY LL  LIAV I+++V+T+G  +K  +E I
Sbjct: 13 HDDAGVTSIEYALLGMLIAVAIVSTVSTVGDAVKLMYEMI 52


>gi|119717345|ref|YP_924310.1| Flp/Fap pilin component [Nocardioides sp. JS614]
 gi|119538006|gb|ABL82623.1| Flp/Fap pilin component [Nocardioides sp. JS614]
          Length = 67

 Score = 40.4 bits (93), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 26/36 (72%)

Query: 12 DESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          DE GA+A+EYGLL+  IA VI+  V  LG ++K+ F
Sbjct: 17 DERGASAVEYGLLIGGIAAVIVVLVFALGDQVKELF 52


>gi|49082500|gb|AAT50650.1| PA4306 [synthetic construct]
          Length = 73

 Score = 40.4 bits (93), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 35/61 (57%), Gaps = 4/61 (6%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIIT--SVTTLG--GKLKKAFEAIDKAIVTTSPAA 61
          V+ FL DE GA AIEY ++  LIAV +I   S T  G  G LK  F+ + + +   +P A
Sbjct: 12 VRAFLADEEGANAIEYAVIAGLIAVALIAVLSPTDSGIVGGLKAFFDGVGEKVGGLAPTA 71

Query: 62 S 62
          +
Sbjct: 72 N 72


>gi|116878542|ref|YP_842256.1| hypothetical protein Pcar_3316 [Pelobacter carbinolicus DSM 2380]
 gi|114843178|gb|ABI81935.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380]
          Length = 175

 Score = 40.0 bits (92), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 33/53 (62%)

Query: 6   VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
            +  ++ E GATA EY ++++LI +V I ++T LG K+   F+ I +++   S
Sbjct: 123 CRELIRSEEGATATEYAVMLALIIIVAIGAITFLGKKVNNTFQNIAESLPDPS 175


>gi|15599502|ref|NP_252996.1| Type IVb pilin, Flp [Pseudomonas aeruginosa PAO1]
 gi|9950529|gb|AAG07694.1|AE004847_1 Type IVb pilin, Flp [Pseudomonas aeruginosa PAO1]
          Length = 72

 Score = 40.0 bits (92), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 35/61 (57%), Gaps = 4/61 (6%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIIT--SVTTLG--GKLKKAFEAIDKAIVTTSPAA 61
          V+ FL DE GA AIEY ++  LIAV +I   S T  G  G LK  F+ + + +   +P A
Sbjct: 12 VRAFLADEEGANAIEYAVIAGLIAVALIAVLSPTDSGIVGGLKAFFDGVGEKVGGLAPTA 71

Query: 62 S 62
          +
Sbjct: 72 N 72


>gi|116671466|ref|YP_832399.1| Flp/Fap pilin component [Arthrobacter sp. FB24]
 gi|116611575|gb|ABK04299.1| Flp/Fap pilin component [Arthrobacter sp. FB24]
          Length = 64

 Score = 40.0 bits (92), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 30/47 (63%), Gaps = 1/47 (2%)

Query: 6  VKNFLQ-DESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAID 51
          VKN L  +E GATA+EYGL+V+LI +  I  +T +G  L+  F  I 
Sbjct: 15 VKNRLTGEEKGATAVEYGLMVALIVIAAILGITAVGTSLQTLFNDIS 61


>gi|304320644|ref|YP_003854287.1| hypothetical protein PB2503_05357 [Parvularcula bermudensis
          HTCC2503]
 gi|303299546|gb|ADM09145.1| hypothetical protein PB2503_05357 [Parvularcula bermudensis
          HTCC2503]
          Length = 60

 Score = 40.0 bits (92), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 40/51 (78%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++   F++DE GATAIEYGL+ +LIAV II++V++LG +++ AF+ ++  +
Sbjct: 3  NLFNRFVKDEDGATAIEYGLIAALIAVAIISAVSSLGTRIQGAFDDVNTTL 53


>gi|328953764|ref|YP_004371098.1| Flp/Fap pilin component [Desulfobacca acetoxidans DSM 11109]
 gi|328454088|gb|AEB09917.1| Flp/Fap pilin component [Desulfobacca acetoxidans DSM 11109]
          Length = 60

 Score = 40.0 bits (92), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 33/57 (57%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          ++K F+++E GA+A+EY +LV  I  V+I  +    G+L  A ++    I T   A+
Sbjct: 4  LIKKFIREEDGASAVEYAVLVGAIGAVLIAGIYAFYGRLNTAIDSAATKIGTNGGAS 60


>gi|254780736|ref|YP_003065149.1| hypothetical protein CLIBASIA_03115 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040413|gb|ACT57209.1| hypothetical protein CLIBASIA_03115 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 60

 Score = 40.0 bits (92), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 34/45 (75%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFE 48
          + +   L+DESGA AIEYG+LV+LIAV II +VT LGG LK  FE
Sbjct: 3  NCMNKLLKDESGAAAIEYGMLVALIAVAIIAAVTMLGGSLKGTFE 47


>gi|87312297|ref|ZP_01094395.1| Flp/Fap pilin component [Blastopirellula marina DSM 3645]
 gi|87285001|gb|EAQ76937.1| Flp/Fap pilin component [Blastopirellula marina DSM 3645]
          Length = 67

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 32/53 (60%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          ++NFL  E G TA+EY ++++LI +V +T++  +G +    F  I   + T +
Sbjct: 8  IQNFLVSEDGPTAVEYAVMLALIVIVCLTAIQAIGTQANATFTKIGNDMSTAN 60


>gi|73542325|ref|YP_296845.1| Flp/Fap pilin component [Ralstonia eutropha JMP134]
 gi|72119738|gb|AAZ62001.1| Flp/Fap pilin component [Ralstonia eutropha JMP134]
          Length = 74

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 34/48 (70%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          ++++ + L +++  T+IEY LL  LIA+ I+ SV+++G  +K  +E+I
Sbjct: 22 LNLIADLLHEDAAVTSIEYALLGMLIAIAIVGSVSSVGDAVKTLYESI 69


>gi|299067804|emb|CBJ39015.1| putative pilin transmembrane protein [Ralstonia solanacearum
          CMR15]
          Length = 53

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +++ F+++E GA + EY LLV+ +A+V+I     L G +K A+  I  A 
Sbjct: 4  VIQRFIREEDGAASTEYALLVTFVALVMIAYGDALQGTVKSAWSQIAAAF 53


>gi|323702110|ref|ZP_08113778.1| Flp/Fap pilin component [Desulfotomaculum nigrificans DSM 574]
 gi|323532992|gb|EGB22863.1| Flp/Fap pilin component [Desulfotomaculum nigrificans DSM 574]
          Length = 54

 Score = 39.7 bits (91), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 25/37 (67%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG 40
           I+ N L+DE+G    EYGL+++LIA V I +  TLG
Sbjct: 3  EIIMNLLRDENGQGMAEYGLILALIAAVCIVAFKTLG 39


>gi|296158790|ref|ZP_06841619.1| Flp/Fap pilin component [Burkholderia sp. Ch1-1]
 gi|295890995|gb|EFG70784.1| Flp/Fap pilin component [Burkholderia sp. Ch1-1]
          Length = 57

 Score = 39.7 bits (91), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          + FL++  G TAIEYGL+  L+ +VI  +VT++G  +      +   IV  S
Sbjct: 6  QRFLKENKGVTAIEYGLIAGLVVIVIAGAVTSVGANISTVMTKVANLIVAPS 57


>gi|163758977|ref|ZP_02166063.1| hypothetical protein HPDFL43_04415 [Hoeflea phototrophica DFL-43]
 gi|162283381|gb|EDQ33666.1| hypothetical protein HPDFL43_04415 [Hoeflea phototrophica DFL-43]
          Length = 86

 Score = 39.7 bits (91), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 31/50 (62%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          M+  +    L D +GAT+IEYGL+ +++++ + + V  +G  L  +FE +
Sbjct: 1  MRKKLCTRALADRAGATSIEYGLIAAVLSLALFSGVGVIGQSLSTSFERV 50


>gi|85373828|ref|YP_457890.1| hypothetical protein ELI_05005 [Erythrobacter litoralis HTCC2594]
 gi|84786911|gb|ABC63093.1| hypothetical protein ELI_05005 [Erythrobacter litoralis HTCC2594]
          Length = 66

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 30/38 (78%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGK 42
          ++ + LQDE+GATA+EYGL+++L+ + ++ +V  +G +
Sbjct: 8  LITSLLQDEAGATAVEYGLILALVFLAMVAAVQGVGNE 45


>gi|227819049|ref|YP_002823020.1| PilA3 pilus assembly protein [Sinorhizobium fredii NGR234]
 gi|227338048|gb|ACP22267.1| PilA3 pilus assembly protein [Sinorhizobium fredii NGR234]
          Length = 51

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 29/37 (78%), Gaps = 2/37 (5%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG 40
          +++  F++ ESGATAIEYGL+  LIAV  IT+V T+G
Sbjct: 3  NLLLRFVRHESGATAIEYGLITGLIAV--ITAVQTVG 37


>gi|260462609|ref|ZP_05810815.1| Flp/Fap pilin component [Mesorhizobium opportunistum WSM2075]
 gi|259031515|gb|EEW32785.1| Flp/Fap pilin component [Mesorhizobium opportunistum WSM2075]
          Length = 64

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 33/57 (57%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          M + + F  DE+GA  +EY +L+ +I V +I +V  +G  +   +  ++  + T+SP
Sbjct: 5  MTMTRQFRDDENGAAMVEYTVLLGIITVAVIATVALVGTWVSGKWVTLNSTLTTSSP 61


>gi|17545377|ref|NP_518779.1| pilin transmembrane protein [Ralstonia solanacearum GMI1000]
 gi|17427669|emb|CAD14188.1| putative pilin transmembrane protein [Ralstonia solanacearum
          GMI1000]
          Length = 53

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +V+ F+++E GA + EY LLV+ +A+V++     L G +K A+  I  A 
Sbjct: 4  VVQRFIRNEDGAASTEYALLVTFVALVMLAYGDALQGTVKSAWSQIAAAF 53


>gi|152985381|ref|YP_001350209.1| hypothetical protein PSPA7_4873 [Pseudomonas aeruginosa PA7]
 gi|150960539|gb|ABR82564.1| hypothetical protein PSPA7_4873 [Pseudomonas aeruginosa PA7]
          Length = 72

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 4/60 (6%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIIT--SVTTLG--GKLKKAFEAIDKAIVTTSPAAS 62
          + FL DE GA AIEY ++  LIAV +I   S T  G  G LK  F+ + + +   +P+A+
Sbjct: 13 RAFLADEEGANAIEYAVIAGLIAVALIAVLSPTDSGIVGGLKAFFDGVGEKVGGLAPSAN 72


>gi|156741109|ref|YP_001431238.1| Flp/Fap pilin component [Roseiflexus castenholzii DSM 13941]
 gi|156232437|gb|ABU57220.1| Flp/Fap pilin component [Roseiflexus castenholzii DSM 13941]
          Length = 52

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 31/50 (62%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +V++F   E G   +EY L++ LIA+V+I  +T LG ++ + F  I+  +
Sbjct: 1  MVRSFFAKEEGQGLVEYALILVLIAIVVIGILTLLGNRVSQVFSQINSGL 50


>gi|13472987|ref|NP_104554.1| PilA-like protein [Mesorhizobium loti MAFF303099]
 gi|14023735|dbj|BAB50340.1| PilA [Mesorhizobium loti MAFF303099]
          Length = 59

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 35/54 (64%), Gaps = 11/54 (20%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVII-------TSVTTL----GGKLKKAF 47
          ++  FL+DE+GATA+EYGL+V+++++ I+        S+T L    G +L  AF
Sbjct: 4  VLLRFLKDETGATAVEYGLIVAVLSLTIVAGISQVFNSITWLFSDNGSRLANAF 57


>gi|85859142|ref|YP_461344.1| flp/Fap pilin component [Syntrophus aciditrophicus SB]
 gi|85722233|gb|ABC77176.1| flp/fap pilin component [Syntrophus aciditrophicus SB]
          Length = 54

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 26/36 (72%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLK 44
          FL+ E GATAIEY L+  LI + I++SV+ LG  +K
Sbjct: 7  FLKSEDGATAIEYALIAGLIFLAIVSSVSFLGQSVK 42


>gi|303241716|ref|ZP_07328213.1| Flp/Fap pilin component [Acetivibrio cellulolyticus CD2]
 gi|303241717|ref|ZP_07328214.1| Flp/Fap pilin component [Acetivibrio cellulolyticus CD2]
 gi|302590717|gb|EFL60468.1| Flp/Fap pilin component [Acetivibrio cellulolyticus CD2]
 gi|302590718|gb|EFL60469.1| Flp/Fap pilin component [Acetivibrio cellulolyticus CD2]
          Length = 60

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 4/61 (6%)

Query: 1  MKMHI--VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          MKM+   +K  + ++ G   +EYGL++SLIAV  I ++  LG K+   F  +  +I  T+
Sbjct: 2  MKMYFDYLKALVGNKKGQGMVEYGLIISLIAVACIAALVVLGPKIATLFNGVANSI--TA 59

Query: 59 P 59
          P
Sbjct: 60 P 60


>gi|322434110|ref|YP_004216322.1| hypothetical protein AciX9_0470 [Acidobacterium sp. MP5ACTX9]
 gi|321161837|gb|ADW67542.1| hypothetical protein AciX9_0470 [Acidobacterium sp. MP5ACTX9]
          Length = 60

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 3  MHIVKNF----LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          M+  K+F    LQDESG   IEY L+  LI +  + ++T L GK++ +F ++  ++  
Sbjct: 1  MNKTKSFFFDLLQDESGQDLIEYALVAGLIGLGAVVAMTGLSGKIQSSFNSVGSSLTN 58


>gi|319785611|ref|YP_004145087.1| Flp/Fap pilin component [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
 gi|317171499|gb|ADV15037.1| Flp/Fap pilin component [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
          Length = 60

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 38/59 (64%), Gaps = 1/59 (1%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          +++  F++DESGATAIEYGL+ +LIA+ IIT   TLG  L   F  I  + +  +P  S
Sbjct: 3  NLIARFVKDESGATAIEYGLIAALIALAIITGAGTLGNALNAKFTNIG-STLNNAPTGS 60


>gi|296121064|ref|YP_003628842.1| Flp/Fap pilin component [Planctomyces limnophilus DSM 3776]
 gi|296013404|gb|ADG66643.1| Flp/Fap pilin component [Planctomyces limnophilus DSM 3776]
          Length = 57

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          VK FL  E G TA+EY ++++LI +V +T+V  +G      F+ +   + T
Sbjct: 7  VKKFLVSEDGPTAVEYAVMLALIVIVCLTAVQAIGTNAAAKFQNVADTLAT 57


>gi|293606496|ref|ZP_06688854.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
          43553]
 gi|292815119|gb|EFF74242.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
          43553]
          Length = 58

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          MK  + + F  DE G TA+EYGL+  L+AV +I +V T    L   F  +
Sbjct: 1  MKAKLAQ-FWNDEDGITALEYGLIAGLVAVALIAAVGTFTDALSNMFTGL 49


>gi|56477534|ref|YP_159123.1| pilus assembly protein, pilin component [Aromatoleum aromaticum
          EbN1]
 gi|56313577|emb|CAI08222.1| pilus assembly protein, pilin component [Aromatoleum aromaticum
          EbN1]
          Length = 66

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 30/45 (66%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          + ++K F++D+ G T+IEY LL +LI   I+ SV+ LG  ++  +
Sbjct: 10 VELLKGFIEDQDGVTSIEYALLAALIFGAIVVSVSLLGSSVETLY 54


>gi|229588197|ref|YP_002870316.1| hypothetical protein PFLU0649 [Pseudomonas fluorescens SBW25]
 gi|229360063|emb|CAY46917.1| putative membrane protein [Pseudomonas fluorescens SBW25]
          Length = 63

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 31/42 (73%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          F Q + GA+ IEY ++V+++A+VI+ + + LG K+K  F+++
Sbjct: 16 FFQRKEGASGIEYAIIVAMVALVIVGAGSGLGTKIKSIFDSV 57


>gi|15966374|ref|NP_386727.1| hypothetical protein SMc02446 [Sinorhizobium meliloti 1021]
 gi|307313039|ref|ZP_07592666.1| Flp/Fap pilin component [Sinorhizobium meliloti BL225C]
 gi|307321045|ref|ZP_07600451.1| Flp/Fap pilin component [Sinorhizobium meliloti AK83]
 gi|15075645|emb|CAC47200.1| Putative pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|306893320|gb|EFN24100.1| Flp/Fap pilin component [Sinorhizobium meliloti AK83]
 gi|306899358|gb|EFN29992.1| Flp/Fap pilin component [Sinorhizobium meliloti BL225C]
          Length = 57

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKL 43
          M  ++  L+D  GATA+EYGLL +LI+V ++  +    G L
Sbjct: 1  METLRRLLRDHDGATAVEYGLLAALISVGLLIGLQNFSGAL 41


>gi|254239024|ref|ZP_04932347.1| hypothetical protein PACG_05201 [Pseudomonas aeruginosa C3719]
 gi|254244883|ref|ZP_04938205.1| hypothetical protein PA2G_05756 [Pseudomonas aeruginosa 2192]
 gi|126170955|gb|EAZ56466.1| hypothetical protein PACG_05201 [Pseudomonas aeruginosa C3719]
 gi|126198261|gb|EAZ62324.1| hypothetical protein PA2G_05756 [Pseudomonas aeruginosa 2192]
          Length = 72

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 4/61 (6%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIIT--SVTTLG--GKLKKAFEAIDKAIVTTSPAA 61
          ++ FL DE GA AIEY ++  LIAV +I   S T  G  G LK  F+ + + +   +P A
Sbjct: 12 LRAFLADEEGANAIEYAVIAGLIAVALIAVLSPTDSGIVGGLKAFFDGVGEKVGGLAPTA 71

Query: 62 S 62
          +
Sbjct: 72 N 72


>gi|13475419|ref|NP_106983.1| pilin subunit [Mesorhizobium loti MAFF303099]
 gi|14026171|dbj|BAB52769.1| pilin subunit [Mesorhizobium loti MAFF303099]
          Length = 87

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 32/54 (59%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          M + + F  DE+GA  +EY +L+ +I V +I +V  +G  +   + A++ A+ T
Sbjct: 31 MTMTRQFRDDENGAAMVEYTVLLGIITVAVIATVVLVGTWVSGRWTALNSALTT 84


>gi|148553539|ref|YP_001261121.1| Flp/Fap pilin component [Sphingomonas wittichii RW1]
 gi|148498729|gb|ABQ66983.1| Flp/Fap pilin component [Sphingomonas wittichii RW1]
          Length = 61

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 2  KMHI-VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          + H+  +   +D  GATA+EYGL++SLI + I+ +V +LG  ++  +  I + + +
Sbjct: 5  RRHVPFRALARDCRGATAVEYGLILSLIFMAIMGAVASLGSSVQSRWNDIAERVTS 60


>gi|283778146|ref|YP_003368901.1| Flp/Fap pilin component [Pirellula staleyi DSM 6068]
 gi|283436599|gb|ADB15041.1| Flp/Fap pilin component [Pirellula staleyi DSM 6068]
          Length = 58

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 26/38 (68%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG 40
          M  + NFL++E G TA+EY +++++I +V I  V  +G
Sbjct: 1  MQWISNFLREEDGPTAVEYAVMLAMIIMVCIAGVVLIG 38


>gi|317154608|ref|YP_004122656.1| Flp/Fap pilin component [Desulfovibrio aespoeensis Aspo-2]
 gi|316944859|gb|ADU63910.1| Flp/Fap pilin component [Desulfovibrio aespoeensis Aspo-2]
          Length = 60

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 3/60 (5%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAID---KAIVTTSP 59
          M  + N + +E GATA+EYGLL +LIA  I+ +VTTLGG +   F +I    +A   T+P
Sbjct: 1  MSKIMNLIMNEEGATALEYGLLAALIAAAIVGAVTTLGGVVSTTFSSIATSMQAATATAP 60


>gi|294012383|ref|YP_003545843.1| putative pilin Flp [Sphingobium japonicum UT26S]
 gi|292675713|dbj|BAI97231.1| putative pilin Flp [Sphingobium japonicum UT26S]
          Length = 53

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 34/48 (70%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          M  ++  +++E GATAIEYGL+ +LIAV  I ++++LGGKL   F  +
Sbjct: 1  MQFIRKMMKNEKGATAIEYGLIAALIAVAAIGAMSSLGGKLGNTFNNV 48


>gi|239814530|ref|YP_002943440.1| hypothetical protein Vapar_1523 [Variovorax paradoxus S110]
 gi|239801107|gb|ACS18174.1| hypothetical protein Vapar_1523 [Variovorax paradoxus S110]
          Length = 58

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 27/33 (81%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTL 39
          K+FL DESGA  +EY L++++I++++ITS+  L
Sbjct: 3  KSFLADESGAQMVEYALVIAVISILLITSLRPL 35


>gi|149173516|ref|ZP_01852146.1| hypothetical protein PM8797T_22268 [Planctomyces maris DSM 8797]
 gi|148847698|gb|EDL62031.1| hypothetical protein PM8797T_22268 [Planctomyces maris DSM 8797]
          Length = 57

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 28/46 (60%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFE 48
          M  +K FL +E G TA+EY ++++ I +V I ++  +G +    FE
Sbjct: 1  MQYLKRFLIEEDGPTAVEYAVMLAAIVMVCIAAIAAIGTRTNDLFE 46


>gi|254502513|ref|ZP_05114664.1| Flp/Fap pilin component family [Labrenzia alexandrii DFL-11]
 gi|222438584|gb|EEE45263.1| Flp/Fap pilin component family [Labrenzia alexandrii DFL-11]
          Length = 72

 Score = 38.5 bits (88), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 2  KMHIVKNF---LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKA-FEAIDKAIVTT 57
          K  +V  F   + D SGAT +EYGLLV+ +++ I+ +V ++G  ++   F+ I   ++T 
Sbjct: 6  KQFLVNQFTRLIHDRSGATMVEYGLLVATLSIAILLTVGSIGETVRDDIFQVISNVMLTG 65

Query: 58 SPAAS 62
          +  A+
Sbjct: 66 ANEAA 70


>gi|328545282|ref|YP_004305391.1| PilA2 pilus assembly protein [polymorphum gilvum SL003B-26A1]
 gi|326415024|gb|ADZ72087.1| PilA2 pilus assembly protein [Polymorphum gilvum SL003B-26A1]
          Length = 60

 Score = 38.5 bits (88), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 36/58 (62%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          ++   F +DESGATAIEYGL+  LI+VVI+ +V T+G  L   F  I   +    PA+
Sbjct: 3  NLFARFAKDESGATAIEYGLIAGLISVVIVGTVVTIGTDLSSVFTKISTELAKAKPAS 60


>gi|170701159|ref|ZP_02892132.1| Flp/Fap pilin component [Burkholderia ambifaria IOP40-10]
 gi|170133940|gb|EDT02295.1| Flp/Fap pilin component [Burkholderia ambifaria IOP40-10]
          Length = 68

 Score = 38.1 bits (87), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
           ++ DE G T+IEY L+ ++ A V++ SV TL   L+  +  I
Sbjct: 12 RWIDDEQGVTSIEYALIAAMFATVVLASVVTLKDSLEDMYNMI 54


>gi|149184275|ref|ZP_01862593.1| hypothetical protein ED21_26193 [Erythrobacter sp. SD-21]
 gi|148831595|gb|EDL50028.1| hypothetical protein ED21_26193 [Erythrobacter sp. SD-21]
          Length = 60

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (63%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          M  +    ++E GATAIEYGL+ +LIAV  IT++ +LGG+L   F  +  A+ T + A
Sbjct: 1  MKFINKLRRNEEGATAIEYGLIAALIAVAAITAMQSLGGELTTTFNTVSSAMSTANNA 58


>gi|323137854|ref|ZP_08072929.1| Flp/Fap pilin component [Methylocystis sp. ATCC 49242]
 gi|322396857|gb|EFX99383.1| Flp/Fap pilin component [Methylocystis sp. ATCC 49242]
          Length = 54

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 28/42 (66%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          ++NFL D  GATA+EY  +  +++++II   TT+G KL   +
Sbjct: 5  LRNFLVDTRGATALEYVTIAFMVSIIIIAGSTTIGTKLSTLY 46


>gi|328953763|ref|YP_004371097.1| Flp/Fap pilin component [Desulfobacca acetoxidans DSM 11109]
 gi|328454087|gb|AEB09916.1| Flp/Fap pilin component [Desulfobacca acetoxidans DSM 11109]
          Length = 58

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 26/40 (65%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLK 44
          ++K F+++E GA+A+EY +LV  I  V+I  +    GKL 
Sbjct: 4  MIKKFIREEDGASAVEYAVLVGAIGAVLIAGIYVFYGKLN 43


>gi|90423304|ref|YP_531674.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB18]
 gi|90105318|gb|ABD87355.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB18]
          Length = 54

 Score = 38.1 bits (87), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 33/51 (64%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           ++  FL D SGAT++EY L+ + +++VI+ +V T+G  +   + ++  AI
Sbjct: 3  RLLCKFLGDRSGATSLEYALIAAGLSIVILGAVQTIGTAVTAKYTSVGSAI 53


>gi|322434101|ref|YP_004216313.1| Flp/Fap pilin component [Acidobacterium sp. MP5ACTX9]
 gi|321161828|gb|ADW67533.1| Flp/Fap pilin component [Acidobacterium sp. MP5ACTX9]
          Length = 60

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 31/51 (60%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +++   L DESG   IEY L+  LI +  + ++T L GK++ +F ++  ++
Sbjct: 6  NVIAALLNDESGQDLIEYALVAGLIGLGAVVAMTGLSGKIQSSFNSVGSSL 56


>gi|85708397|ref|ZP_01039463.1| hypothetical protein NAP1_04140 [Erythrobacter sp. NAP1]
 gi|85689931|gb|EAQ29934.1| hypothetical protein NAP1_04140 [Erythrobacter sp. NAP1]
          Length = 61

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 30/47 (63%), Gaps = 4/47 (8%)

Query: 8  NFLQ----DESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          NFL+    D SGATA+EYGL+VSLI V +I ++  +  +  K +  +
Sbjct: 5  NFLKHIGNDNSGATAVEYGLIVSLIVVAMIAALNGVANETIKMWSDV 51


>gi|326404413|ref|YP_004284495.1| putative pilin subunit protein [Acidiphilium multivorum AIU301]
 gi|325051275|dbj|BAJ81613.1| putative pilin subunit protein [Acidiphilium multivorum AIU301]
          Length = 63

 Score = 38.1 bits (87), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 24/35 (68%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKL 43
          F +D  G TA+EYGL+ +L+AVVII +   LG  L
Sbjct: 16 FAKDNRGVTAMEYGLIAALMAVVIIAAFGILGNGL 50


>gi|190149869|ref|YP_001968394.1| flp operon protein Flp1 [Actinobacillus pleuropneumoniae serovar
          7 str. AP76]
 gi|307263193|ref|ZP_07544814.1| Flp operon protein Flp1 [Actinobacillus pleuropneumoniae serovar
          13 str. N273]
 gi|189915000|gb|ACE61252.1| flp operon protein Flp1 [Actinobacillus pleuropneumoniae serovar
          7 str. AP76]
 gi|306871555|gb|EFN03278.1| Flp operon protein Flp1 [Actinobacillus pleuropneumoniae serovar
          13 str. N273]
          Length = 78

 Score = 37.7 bits (86), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGG---KLKKAFEAIDKAI 54
          ++ F +++ G TAIEYGL+   +A++I+       G   +LK  FEA+ K I
Sbjct: 17 IRRFKENQQGVTAIEYGLIAVAVAILIVAVFYNDNGFIQQLKDKFEALTKTI 68


>gi|296391005|ref|ZP_06880480.1| Type IVb pilin, Flp [Pseudomonas aeruginosa PAb1]
 gi|313106825|ref|ZP_07793037.1| Type IVb pilin, Flp [Pseudomonas aeruginosa 39016]
 gi|310879539|gb|EFQ38133.1| Type IVb pilin, Flp [Pseudomonas aeruginosa 39016]
          Length = 70

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIIT--SVTTLG--GKLKKAFEAIDKAIVTTSP 59
          V+ FL DE GA AIEY ++  LIAV +I   S T  G  G LK  F+ +   +   +P
Sbjct: 12 VRAFLADEEGANAIEYAVIAGLIAVALIAVLSPTDSGIVGGLKAFFDGVGTKVGGLAP 69


>gi|296282443|ref|ZP_06860441.1| hypothetical protein CbatJ_02425 [Citromicrobium bathyomarinum
          JL354]
          Length = 82

 Score = 37.7 bits (86), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 31/45 (68%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          M I ++ L+DE+G +AIEY ++++LI V ++ ++  LG +   ++
Sbjct: 1  MMITRHLLRDETGTSAIEYAVIMALIGVGLVGALNALGTETANSY 45


>gi|163801680|ref|ZP_02195578.1| hypothetical protein 1103602000597_AND4_09507 [Vibrio sp. AND4]
 gi|159174597|gb|EDP59399.1| hypothetical protein AND4_09507 [Vibrio sp. AND4]
          Length = 70

 Score = 37.7 bits (86), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG--GKLKKAFEAIDKAIVTTSP 59
           +  F +DE G TAIEYGL+   +AVV+  ++ T G  G+L  AF+ ++  I    P
Sbjct: 12 FLSEFNKDERGVTAIEYGLIAVAMAVVLGLALGTDGFIGQLDAAFDEVESTIQGVLP 68


>gi|116052340|ref|YP_792651.1| hypothetical protein PA14_55940 [Pseudomonas aeruginosa
          UCBPP-PA14]
 gi|115587561|gb|ABJ13576.1| putative pilus assembly protein [Pseudomonas aeruginosa
          UCBPP-PA14]
          Length = 70

 Score = 37.7 bits (86), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIIT--SVTTLG--GKLKKAFEAIDKAIVTTSP 59
          V+ FL DE GA AIEY ++  LIAV +I   S T  G  G LK  F+ +   +   +P
Sbjct: 12 VRAFLADEEGANAIEYAVIAGLIAVALIAVLSPTDSGIVGGLKAFFDGVGTKVGGLAP 69


>gi|188586931|ref|YP_001918476.1| Flp/Fap pilin component [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179351618|gb|ACB85888.1| Flp/Fap pilin component [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 69

 Score = 37.7 bits (86), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 29/45 (64%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +K    +E G   +EYGL+++L+AVV+I +++ LG  +   FE I
Sbjct: 5  LKRLWTEEDGQGMVEYGLILALVAVVVIGALSFLGDNVAGIFEHI 49


>gi|194366093|ref|YP_002028703.1| Flp/Fap pilin component [Stenotrophomonas maltophilia R551-3]
 gi|194348897|gb|ACF52020.1| Flp/Fap pilin component [Stenotrophomonas maltophilia R551-3]
          Length = 63

 Score = 37.7 bits (86), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 31/45 (68%), Gaps = 3/45 (6%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          ++ FL++E G TA+EYGLL ++IA V+I   +T   ++K  FE +
Sbjct: 5  IRRFLKEEDGVTALEYGLLAAVIAGVLIALGST---QIKDFFETL 46


>gi|83749641|ref|ZP_00946624.1| Putative Pilin Protein [Ralstonia solanacearum UW551]
 gi|207728109|ref|YP_002256503.1| pilin protein [Ralstonia solanacearum MolK2]
 gi|207744155|ref|YP_002260547.1| pilin protein [Ralstonia solanacearum IPO1609]
 gi|300704927|ref|YP_003746530.1| pilin transmembrane protein [Ralstonia solanacearum CFBP2957]
 gi|83723702|gb|EAP70897.1| Putative Pilin Protein [Ralstonia solanacearum UW551]
 gi|206591354|emb|CAQ56966.1| pilin protein [Ralstonia solanacearum MolK2]
 gi|206595559|emb|CAQ62486.1| pilin protein [Ralstonia solanacearum IPO1609]
 gi|299072591|emb|CBJ43941.1| putative pilin transmembrane protein [Ralstonia solanacearum
          CFBP2957]
          Length = 58

 Score = 37.7 bits (86), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 34/52 (65%), Gaps = 4/52 (7%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          ++K F+++E GA  +EY LL++ +A+V++T  TT    +K A  AI  ++ T
Sbjct: 4  MIKRFVREEDGAAGVEYALLLAFVALVMVTYGTT----VKTAVGAIWNSVAT 51


>gi|87199922|ref|YP_497179.1| Flp/Fap pilin component [Novosphingobium aromaticivorans DSM
          12444]
 gi|87135603|gb|ABD26345.1| Flp/Fap pilin component [Novosphingobium aromaticivorans DSM
          12444]
          Length = 59

 Score = 37.7 bits (86), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 35/59 (59%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          M + +N L +  GATAIEYGL+ +L+AV  I ++++LG  L   F  +   +   SP A
Sbjct: 1  MKLFRNLLANNEGATAIEYGLIAALVAVAAIGAMSSLGTSLSTTFNNVSTEMDNASPTA 59


>gi|255262164|ref|ZP_05341506.1| hypothetical protein TR2A62_2320 [Thalassiobium sp. R2A62]
 gi|255104499|gb|EET47173.1| hypothetical protein TR2A62_2320 [Thalassiobium sp. R2A62]
          Length = 90

 Score = 37.7 bits (86), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%)

Query: 15 GATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          GA  IEYGLLV L+AVV   SV+TLG ++   F  +   + + +  AS
Sbjct: 28 GAALIEYGLLVGLVAVVANGSVSTLGEEIDGTFANVTAELSSNTAGAS 75


>gi|283779849|ref|YP_003370604.1| Flp/Fap pilin component [Pirellula staleyi DSM 6068]
 gi|283438302|gb|ADB16744.1| Flp/Fap pilin component [Pirellula staleyi DSM 6068]
          Length = 62

 Score = 37.4 bits (85), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 28/45 (62%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          V+ FL  E G TA+EY ++++LI +V +T++  +G      F ++
Sbjct: 8  VQRFLVSEDGPTAVEYAVMLALIVIVCLTAIQAIGTNANATFNSV 52


>gi|168703134|ref|ZP_02735411.1| hypothetical protein GobsU_26626 [Gemmata obscuriglobus UQM 2246]
          Length = 65

 Score = 37.4 bits (85), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          V  FL+ E G TA+EY ++++LI VV++ +++ +GG     +   D ++    P  S
Sbjct: 9  VVEFLKGEDGPTAVEYAVMLALIIVVLVAAISNIGGTTSAMYN--DLSLQGVKPGGS 63


>gi|194288841|ref|YP_002004748.1| flp pilin component [Cupriavidus taiwanensis LMG 19424]
 gi|193222676|emb|CAQ68679.1| Flp pilin component [Cupriavidus taiwanensis LMG 19424]
          Length = 61

 Score = 37.4 bits (85), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (71%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          + + FL+DE G TAIEYGL+ +LIA+VII SV T+G +L   F  I
Sbjct: 7  MFQQFLRDEDGVTAIEYGLIAALIAIVIIVSVQTVGTQLNSVFSKI 52


>gi|27382252|ref|NP_773781.1| components of type IV pilus pilin subunit [Bradyrhizobium
          japonicum USDA 110]
 gi|27355423|dbj|BAC52406.1| components of type IV pilus pilin subunit [Bradyrhizobium
          japonicum USDA 110]
          Length = 78

 Score = 37.4 bits (85), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (68%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++V  F++DESGATAIEYGL+ + IA+ IIT V  LG  L   F +I  ++
Sbjct: 27 NLVARFVKDESGATAIEYGLIAAGIALAIITVVNNLGSTLNTKFTSISTSL 77


>gi|307294422|ref|ZP_07574266.1| Flp/Fap pilin component [Sphingobium chlorophenolicum L-1]
 gi|306880573|gb|EFN11790.1| Flp/Fap pilin component [Sphingobium chlorophenolicum L-1]
          Length = 59

 Score = 37.4 bits (85), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          M  +KN   DE GA+A EY L+++++   I  +   LGG +  A       I T +
Sbjct: 1  MTFIKNLWADECGASAAEYALILAIVGTGIALAAFQLGGAISGAMNTAKNCINTAN 56


>gi|153008056|ref|YP_001369271.1| Flp/Fap pilin component [Ochrobactrum anthropi ATCC 49188]
 gi|151559944|gb|ABS13442.1| Flp/Fap pilin component [Ochrobactrum anthropi ATCC 49188]
          Length = 60

 Score = 37.4 bits (85), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 34/50 (68%), Gaps = 2/50 (4%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++  F+++ +G+TAIEY L+ +L++++II+ V  + G + + F   D AI
Sbjct: 5  LMTRFMKNRAGSTAIEYALIGTLVSIMIISGVALVAGNVGEKFN--DTAI 52


>gi|92116016|ref|YP_575745.1| Flp/Fap pilin component [Nitrobacter hamburgensis X14]
 gi|91798910|gb|ABE61285.1| Flp/Fap pilin component [Nitrobacter hamburgensis X14]
          Length = 56

 Score = 37.4 bits (85), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 11/53 (20%)

Query: 4  HIVKNFLQDESGATAIEYGL-----------LVSLIAVVIITSVTTLGGKLKK 45
          ++VK F +DESGATAIEYGL            V+L+   +I+  T +  +L K
Sbjct: 3  NLVKRFAKDESGATAIEYGLIAAGIAVAIISAVNLVGTNLISKFTQVSDQLAK 55


>gi|114797894|ref|YP_761847.1| flp/Fap pilus protein [Hyphomonas neptunium ATCC 15444]
 gi|114738068|gb|ABI76193.1| flp/fap pilus protein [Hyphomonas neptunium ATCC 15444]
          Length = 59

 Score = 37.4 bits (85), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%)

Query: 11 QDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          +DE GATAIEYGL+  L+ + II  VT       + ++ ++  +V
Sbjct: 13 RDERGATAIEYGLIAGLMVLAIIGGVTAFADANNEIYQTVEDNLV 57


>gi|283779850|ref|YP_003370605.1| Flp/Fap pilin component [Pirellula staleyi DSM 6068]
 gi|283438303|gb|ADB16745.1| Flp/Fap pilin component [Pirellula staleyi DSM 6068]
          Length = 62

 Score = 37.4 bits (85), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 28/45 (62%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +  FL+ E G TA+EY ++++LI +V +T++  +G      F ++
Sbjct: 8  IGRFLKSEDGPTAVEYAVMLALIVIVCLTAIQAIGTNANATFNSV 52


>gi|115525746|ref|YP_782657.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisA53]
 gi|115519693|gb|ABJ07677.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisA53]
          Length = 81

 Score = 37.0 bits (84), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +I+  FL+DESGATAIEYGL+ + IA+ IIT+V T+G  L   F  I
Sbjct: 27 NILARFLKDESGATAIEYGLIAAGIALAIITAVNTVGTDLSTKFGEI 73


>gi|170741514|ref|YP_001770169.1| Flp/Fap pilin component [Methylobacterium sp. 4-46]
 gi|168195788|gb|ACA17735.1| Flp/Fap pilin component [Methylobacterium sp. 4-46]
          Length = 51

 Score = 37.0 bits (84), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          ++K+F  DESGATAIEYGLL +LIA+ +I + +++G  L  AF+ +
Sbjct: 1  MIKSFFYDESGATAIEYGLLAALIAIALIAAASSVGTNLGTAFQNV 46


>gi|21673265|ref|NP_661330.1| hypothetical protein CT0426 [Chlorobium tepidum TLS]
 gi|21646353|gb|AAM71672.1| hypothetical protein CT0426 [Chlorobium tepidum TLS]
          Length = 69

 Score = 37.0 bits (84), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 6/58 (10%)

Query: 5  IVKNFLQD------ESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          ++  FLQ       + G T IEY L+ SLIAV +I  + T+G  LK  F  +   + T
Sbjct: 12 VLSGFLQQYFGVKSQKGVTMIEYALIASLIAVAVIAVLLTVGSNLKTVFSYVGSNLTT 69


>gi|296121140|ref|YP_003628918.1| Flp/Fap pilin component [Planctomyces limnophilus DSM 3776]
 gi|296013480|gb|ADG66719.1| Flp/Fap pilin component [Planctomyces limnophilus DSM 3776]
          Length = 57

 Score = 37.0 bits (84), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 26/38 (68%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG 40
          M  V  FL+ E G TA+EY +++++I +V+IT V+  G
Sbjct: 1  MESVIRFLRSEDGPTAVEYAVMLAMILLVVITGVSAFG 38


>gi|220913387|ref|YP_002488696.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6]
 gi|219860265|gb|ACL40607.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6]
          Length = 71

 Score = 37.0 bits (84), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFE 48
          +   ++F + E GATA EYG+LV+ +A  ++  V+  G  L   ++
Sbjct: 13 LRTFRHFNRSEKGATATEYGILVAFLAFALVLGVSAFGQALNLHYQ 58


>gi|51891533|ref|YP_074224.1| pilus subunit protein [Symbiobacterium thermophilum IAM 14863]
 gi|51855222|dbj|BAD39380.1| pilus subunit protein [Symbiobacterium thermophilum IAM 14863]
          Length = 63

 Score = 37.0 bits (84), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 4  HIVKNFLQ---DESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
           I K F +    + G    EYGL+++LIAVV+IT++T L   L K F  +
Sbjct: 3  RIAKGFRRLVVRQEGQGMTEYGLIIALIAVVLITTLTGLNKTLDKTFNKV 52


>gi|149188849|ref|ZP_01867139.1| hypothetical protein VSAK1_05850 [Vibrio shilonii AK1]
 gi|148837269|gb|EDL54216.1| hypothetical protein VSAK1_05850 [Vibrio shilonii AK1]
          Length = 74

 Score = 37.0 bits (84), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 6/53 (11%)

Query: 11 QDESGATAIEYGLLVSLIAVVIITSVTTLG-----GKLKKAFEAIDKAIVTTS 58
           DE G TAIEYGL+   +A V++++V   G     G+L++AF AI   I TT+
Sbjct: 18 NDERGVTAIEYGLIAVAMA-VLLSAVLVFGEGNMLGELQQAFAAISGDINTTT 69


>gi|149911629|ref|ZP_01900240.1| hypothetical protein PE36_02929 [Moritella sp. PE36]
 gi|149805299|gb|EDM65313.1| hypothetical protein PE36_02929 [Moritella sp. PE36]
          Length = 90

 Score = 37.0 bits (84), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          +  + NF+ DE G TA+EY L  +L+   + +    LG         +   IVT++PA
Sbjct: 5  VRFIDNFIHDEQGLTAVEYALAGALVVSSLASGFIALGSGASNNITELASLIVTSAPA 62


>gi|148553540|ref|YP_001261122.1| Flp/Fap pilin component [Sphingomonas wittichii RW1]
 gi|148498730|gb|ABQ66984.1| Flp/Fap pilin component [Sphingomonas wittichii RW1]
          Length = 55

 Score = 37.0 bits (84), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M  V   L++  GATAIEYGL+ +LIAV  IT++T+LG +L+K F  +   +
Sbjct: 1  MKFVAKLLKNNKGATAIEYGLIAALIAVAAITAMTSLGNQLQKTFNNVSNNM 52


>gi|17545379|ref|NP_518781.1| pilin transmembrane protein [Ralstonia solanacearum GMI1000]
 gi|17427671|emb|CAD14190.1| putative pilin transmembrane protein [Ralstonia solanacearum
          GMI1000]
          Length = 53

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 33/50 (66%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++K F+++E GA  +EY LL++ +A+V++T  +T+   +   + +I  A+
Sbjct: 4  MIKRFVREEDGAAGVEYALLLTFVALVMVTYGSTVKTAVGSVWNSIANAL 53


>gi|239833240|ref|ZP_04681569.1| Flp/Fap pilin component [Ochrobactrum intermedium LMG 3301]
 gi|239825507|gb|EEQ97075.1| Flp/Fap pilin component [Ochrobactrum intermedium LMG 3301]
          Length = 107

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 29/43 (67%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          ++  F+++ +G+TAIEY L+ +L+++ II+ V  + G +   F
Sbjct: 52 LMTRFMKNRAGSTAIEYALIGTLVSIAIISGVALMAGSVGDKF 94


>gi|188581864|ref|YP_001925309.1| Flp/Fap pilin component [Methylobacterium populi BJ001]
 gi|179345362|gb|ACB80774.1| Flp/Fap pilin component [Methylobacterium populi BJ001]
          Length = 60

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 25/40 (62%)

Query: 11 QDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          Q + GATAIEYGL+ + +A+ I+  + + G  L + F  +
Sbjct: 14 QHDGGATAIEYGLVCTFVALAILVGLQSFGSTLTEVFPKV 53


>gi|254522212|ref|ZP_05134267.1| Flp/Fap pilin component superfamily protein [Stenotrophomonas sp.
          SKA14]
 gi|219719803|gb|EED38328.1| Flp/Fap pilin component superfamily protein [Stenotrophomonas sp.
          SKA14]
          Length = 62

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 23/28 (82%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVII 33
          ++ FL++E G TA+EYGLL ++IA V+I
Sbjct: 5  IRTFLKEEDGVTALEYGLLAAVIAGVLI 32


>gi|218893399|ref|YP_002442268.1| Type IVb pilin, Flp [Pseudomonas aeruginosa LESB58]
 gi|218773627|emb|CAW29441.1| Type IVb pilin, Flp [Pseudomonas aeruginosa LESB58]
          Length = 70

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIIT--SVTTLG--GKLKKAFEAIDKAIVTTSP 59
          ++ FL DE GA AIEY ++  LIAV +I   S T  G  G LK  F+ +   +   +P
Sbjct: 12 LRAFLADEEGANAIEYAVIAGLIAVALIAVLSPTDSGIVGGLKAFFDGVGTKVGGLAP 69


>gi|85373827|ref|YP_457889.1| hypothetical protein ELI_05000 [Erythrobacter litoralis HTCC2594]
 gi|84786910|gb|ABC63092.1| hypothetical protein ELI_05000 [Erythrobacter litoralis HTCC2594]
          Length = 54

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 31/48 (64%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          M    N ++DE GATAIEYGL+ +LIAV  I ++  LG +L   F ++
Sbjct: 1  MKFFNNLMKDEQGATAIEYGLIAALIAVAAIVAMQGLGNQLSNTFSSV 48


>gi|260467147|ref|ZP_05813325.1| Flp/Fap pilin component [Mesorhizobium opportunistum WSM2075]
 gi|259029071|gb|EEW30369.1| Flp/Fap pilin component [Mesorhizobium opportunistum WSM2075]
          Length = 59

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 11/54 (20%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVII-------TSVTTL----GGKLKKAF 47
          ++  FL DE+GATA+EY L+V ++++ II        S+T L    G +L  AF
Sbjct: 4  VLLRFLTDETGATAVEYALIVCVLSLTIIGGISQVFNSITWLFSDNGSRLANAF 57


>gi|218530763|ref|YP_002421579.1| Flp/Fap pilin component [Methylobacterium chloromethanicum CM4]
 gi|218523066|gb|ACK83651.1| Flp/Fap pilin component [Methylobacterium chloromethanicum CM4]
          Length = 56

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 25/45 (55%), Gaps = 4/45 (8%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSV----TTLGGKLKKAFE 48
           F + ESGATAIEYGL  + I + +I +     T LG    K FE
Sbjct: 7  RFARHESGATAIEYGLASTFIGIAVIGAFRAYGTALGSFFPKIFE 51


>gi|194335911|ref|YP_002017705.1| Flp/Fap pilin component [Pelodictyon phaeoclathratiforme BU-1]
 gi|194308388|gb|ACF43088.1| Flp/Fap pilin component [Pelodictyon phaeoclathratiforme BU-1]
          Length = 81

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++ + G T IEY L+  LI+V  I +VT +G  L + FE I  A+
Sbjct: 34 IRSQKGVTMIEYALIAGLISVATIAAVTLIGTSLNEVFEKISDAL 78


>gi|299067802|emb|CBJ39013.1| putative pilin transmembrane protein [Ralstonia solanacearum
          CMR15]
          Length = 53

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 33/50 (66%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++K F+++E GA  +EY LL++ +A+V++T  +T+   +   + +I  A+
Sbjct: 4  MIKRFVREEDGAAGVEYALLLTFVALVMVTYGSTVKTAVGNVWNSIAAAL 53


>gi|299067800|emb|CBJ39011.1| putative pilin transmembrane protein [Ralstonia solanacearum
          CMR15]
          Length = 53

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 33/50 (66%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++K F+++E GA  +EY LL++ +A+V+IT  +T+   +   + +I  A+
Sbjct: 4  MIKRFVREEDGAAGVEYALLLTFVALVMITYGSTVKTAVGNIWNSIATAL 53


>gi|326387727|ref|ZP_08209333.1| hypothetical protein Y88_0641 [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326207773|gb|EGD58584.1| hypothetical protein Y88_0641 [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 61

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF----EAIDKAI 54
          M ++++ L+D  GATA+EYG+LV + ++ II   T    +L   +    E  D A+
Sbjct: 1  MTMLRHILRDTQGATAVEYGILVGIFSIGIIFGFTEFTNQLYNLWLIVGENTDAAV 56


>gi|116878541|ref|YP_842255.1| hypothetical protein Pcar_3315 [Pelobacter carbinolicus DSM 2380]
 gi|114843177|gb|ABI81934.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380]
          Length = 59

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFE 48
          M  +++ +  E GAT+ EY ++++LI +V I +++ LG K+   F 
Sbjct: 5  MSKLRDLVWKEEGATSPEYAVMLALIIIVCIAAISYLGKKVNNTFN 50


>gi|86748910|ref|YP_485406.1| Flp/Fap pilin component [Rhodopseudomonas palustris HaA2]
 gi|86571938|gb|ABD06495.1| Flp/Fap pilin component [Rhodopseudomonas palustris HaA2]
          Length = 54

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          I   F++DESGATAIEYGL+ + IA+ II  +  +G KL  AF +I+ A+
Sbjct: 4  IFARFVKDESGATAIEYGLIAAGIALAIIAVINGMGTKLNTAFTSINTAL 53


>gi|152994344|ref|YP_001339179.1| Flp/Fap pilin component [Marinomonas sp. MWYL1]
 gi|150835268|gb|ABR69244.1| Flp/Fap pilin component [Marinomonas sp. MWYL1]
          Length = 65

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAV---VIITSVTTLGGKLKKAFEAI-DKAIVTTSPAA 61
          V+ FL DE G TAIEYG+L + +A    VI  S       LK+ F +I D+   T++P A
Sbjct: 5  VRRFLSDERGVTAIEYGILAAAMAAAIGVIFGSDGVFVTALKERFSSIADQITNTSNPGA 64


>gi|316934953|ref|YP_004109935.1| Flp/Fap pilin component [Rhodopseudomonas palustris DX-1]
 gi|315602667|gb|ADU45202.1| Flp/Fap pilin component [Rhodopseudomonas palustris DX-1]
          Length = 54

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           ++  F  D  GAT+IEY L+   I++VI+    TLG  L   + A+  A+
Sbjct: 3  RLISRFRTDTRGATSIEYALIAVGISIVIVGLSATLGTNLAAKYSAVKDAL 53


>gi|115523899|ref|YP_780810.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisA53]
 gi|115517846|gb|ABJ05830.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisA53]
          Length = 54

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 32/51 (62%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           ++  F+ DE+ AT++EY L+ + I++ I+ +V  +G  + + + AI  AI
Sbjct: 3  RLLSRFVADETAATSLEYALIAAGISITIVGAVQVIGTSVTERYTAIGTAI 53


>gi|322419948|ref|YP_004199171.1| Flp/Fap pilin component [Geobacter sp. M18]
 gi|320126335|gb|ADW13895.1| Flp/Fap pilin component [Geobacter sp. M18]
          Length = 64

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 5  IVKNFLQ----DESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          IV+N L+    ++SG   +EY L++ LIA+ +   V TLG +L   +E I+ ++
Sbjct: 6  IVRNRLRLVLGNDSGQGLVEYALILVLIAIAVFAMVQTLGVQLNGTYEKINTSV 59


>gi|158421906|ref|YP_001523198.1| hypothetical protein AZC_0282 [Azorhizobium caulinodans ORS 571]
 gi|158328795|dbj|BAF86280.1| conserved hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 54

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 31/41 (75%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKK 45
          +++ F+++E G+TA+EYGL+ + +++ I+T +T +G  L +
Sbjct: 4  LLQRFVKEEHGSTALEYGLIAAGLSIAIVTVLTQVGLTLSR 44


>gi|255613581|ref|XP_002539522.1| conserved hypothetical protein [Ricinus communis]
 gi|223505367|gb|EEF22861.1| conserved hypothetical protein [Ricinus communis]
          Length = 243

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 36/52 (69%)

Query: 3   MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           +++V  F++DESGATAIEYGL+ + IA+ IIT V  LG  L   F +I  ++
Sbjct: 191 VNLVARFVKDESGATAIEYGLIAAGIALAIITVVNNLGTTLNTKFTSISTSL 242


>gi|146276363|ref|YP_001166522.1| hypothetical protein Rsph17025_0307 [Rhodobacter sphaeroides ATCC
          17025]
 gi|145554604|gb|ABP69217.1| hypothetical protein Rsph17025_0307 [Rhodobacter sphaeroides ATCC
          17025]
          Length = 67

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          ++I KNF  DE GA  +++ +L + I  + I  VTT+ G LK A  +I
Sbjct: 4  LNIFKNFRNDEDGAVTVDWVVLTAAIVGLGIAVVTTVSGGLKTAASSI 51


>gi|91783007|ref|YP_558213.1| putative pilus subunit protein, PilA like [Burkholderia
          xenovorans LB400]
 gi|91686961|gb|ABE30161.1| Putative pilus subunit protein, PilA like protein [Burkholderia
          xenovorans LB400]
          Length = 55

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          + FL++  G TAIEYGL+  L+ +VI  +V+++G  +      +   I T
Sbjct: 6  QRFLKENKGVTAIEYGLIAGLVVLVIAGAVSSVGSNISAVMTKVASLITT 55


>gi|307293402|ref|ZP_07573248.1| Flp/Fap pilin component [Sphingobium chlorophenolicum L-1]
 gi|306881468|gb|EFN12684.1| Flp/Fap pilin component [Sphingobium chlorophenolicum L-1]
          Length = 53

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 33/48 (68%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          M  ++  L++E GATAIEYGL+ +LIAV  I +++T+G  LK  F  +
Sbjct: 1  MQFIRKMLKNEKGATAIEYGLIAALIAVAAIGAMSTIGTNLKGTFNNV 48


>gi|190574775|ref|YP_001972620.1| putative pilin subunit [Stenotrophomonas maltophilia K279a]
 gi|190012697|emb|CAQ46325.1| putative pilin subunit [Stenotrophomonas maltophilia K279a]
          Length = 68

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 23/28 (82%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVII 33
          ++ FL++E G TA+EYGLL ++IA ++I
Sbjct: 5  IRKFLKEEDGVTALEYGLLAAVIAGILI 32


>gi|167566928|ref|ZP_02359844.1| putative pilus subunit protein [Burkholderia oklahomensis EO147]
 gi|167573997|ref|ZP_02366871.1| putative pilus subunit protein [Burkholderia oklahomensis C6786]
          Length = 56

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (68%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +  VK F++DE G +AIEYGL+ +LIA+VII SV T+G  L   F  I
Sbjct: 5  VQYVKQFVRDEGGVSAIEYGLIAALIAIVIIGSVKTVGTNLNSVFSTI 52


>gi|170720036|ref|YP_001747724.1| Flp/Fap pilin component [Pseudomonas putida W619]
 gi|169758039|gb|ACA71355.1| Flp/Fap pilin component [Pseudomonas putida W619]
          Length = 59

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           K FL  + GA+ IEY ++ +++AV++   V  + G +   F AI  A+
Sbjct: 10 CKQFLHRKDGASGIEYAVIAAMVAVILAGFVPGISGNISTMFTAIQTAL 58


>gi|86159253|ref|YP_466038.1| Flp/Fap pilin component [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85775764|gb|ABC82601.1| Flp/Fap pilin component [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 59

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFE 48
          +  +K   +DE   TA+EY ++V++I +VII     LG  +   F 
Sbjct: 2  LQTLKRLWKDEEAPTAVEYAIMVAVIGLVIIVGAQILGTNVNTTFN 47


>gi|316933042|ref|YP_004108024.1| Flp/Fap pilin component [Rhodopseudomonas palustris DX-1]
 gi|315600756|gb|ADU43291.1| Flp/Fap pilin component [Rhodopseudomonas palustris DX-1]
          Length = 55

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +IV  F++DESGATAIEYGL+ + IA+ II +V  +GG+L   F  I
Sbjct: 3  NIVARFIKDESGATAIEYGLIAAGIALAIIAAVQGVGGQLSTNFTKI 49


>gi|170692569|ref|ZP_02883731.1| Flp/Fap pilin component [Burkholderia graminis C4D1M]
 gi|170142225|gb|EDT10391.1| Flp/Fap pilin component [Burkholderia graminis C4D1M]
          Length = 57

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 28/44 (63%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          K F++DE G TAIEYGL+ +LIA  I+   TTL   +   F AI
Sbjct: 9  KAFIRDEDGVTAIEYGLMAALIATAILAGYTTLANAVSAKFTAI 52


>gi|21673264|ref|NP_661329.1| hypothetical protein CT0425 [Chlorobium tepidum TLS]
 gi|21646352|gb|AAM71671.1| hypothetical protein CT0425 [Chlorobium tepidum TLS]
          Length = 69

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 6/58 (10%)

Query: 5  IVKNFLQD------ESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          ++  FLQ       + G T IEY L+ SLIAV +I  + T+G  L+  F  +   + T
Sbjct: 12 VLSGFLQQYFGVKSQKGVTMIEYALIASLIAVAVIAVLLTVGSNLQTVFSYVGSNLTT 69


>gi|332798620|ref|YP_004460119.1| Flp/Fap pilin component [Tepidanaerobacter sp. Re1]
 gi|332696355|gb|AEE90812.1| Flp/Fap pilin component [Tepidanaerobacter sp. Re1]
          Length = 60

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 33/53 (62%), Gaps = 4/53 (7%)

Query: 6  VKNFLQ----DESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++NFL     +ESG   +EYGL+++L+AV++I ++  +   L+  F  +  A+
Sbjct: 1  MRNFLNWFTSEESGQGMVEYGLIIALVAVILIVALQGMTDGLESIFGEVTDAL 53


>gi|326387726|ref|ZP_08209332.1| hypothetical protein Y88_0640 [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326207772|gb|EGD58583.1| hypothetical protein Y88_0640 [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 63

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 32/49 (65%)

Query: 2  KMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          K+ I++    D  GATAIEYGL+ +L+AV  I+++  LG  L   F+A+
Sbjct: 3  KVRILRQLRDDRRGATAIEYGLIAALVAVAAISAMGALGNGLSNTFQAV 51


>gi|197123321|ref|YP_002135272.1| Flp/Fap pilin component [Anaeromyxobacter sp. K]
 gi|196173170|gb|ACG74143.1| Flp/Fap pilin component [Anaeromyxobacter sp. K]
          Length = 59

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          +  +K   +DE   TA+EY ++V++I +VII     LG  +   F
Sbjct: 2  LQTLKRLWKDEEAPTAVEYAIMVAVIGLVIIIGAAALGTNVNTTF 46


>gi|220922530|ref|YP_002497832.1| Flp/Fap pilin protein [Methylobacterium nodulans ORS 2060]
 gi|219947137|gb|ACL57529.1| Flp/Fap pilin component [Methylobacterium nodulans ORS 2060]
          Length = 53

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 32/52 (61%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M+ +  FL+DE GA  +EY +L+ ++ V +I ++  +G  +   + A++ A+
Sbjct: 1  MNRLSKFLRDEDGAALVEYTVLLGILLVAVIATIGGVGTWINGKWTALNSAL 52


>gi|241662168|ref|YP_002980528.1| Flp/Fap pilin component [Ralstonia pickettii 12D]
 gi|309780763|ref|ZP_07675504.1| pilin transmembrane protein [Ralstonia sp. 5_7_47FAA]
 gi|240864195|gb|ACS61856.1| Flp/Fap pilin component [Ralstonia pickettii 12D]
 gi|308920445|gb|EFP66101.1| pilin transmembrane protein [Ralstonia sp. 5_7_47FAA]
          Length = 58

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 32/52 (61%), Gaps = 4/52 (7%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          ++K F+++E GA  +EY LL++ +A+V++ S    G  +K A  +I   I T
Sbjct: 4  MIKRFVREEDGAAGVEYALLLAFVALVMVAS----GPTVKAAVGSIWSTIAT 51


>gi|258405296|ref|YP_003198038.1| Flp/Fap pilin component [Desulfohalobium retbaense DSM 5692]
 gi|257797523|gb|ACV68460.1| Flp/Fap pilin component [Desulfohalobium retbaense DSM 5692]
          Length = 56

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (68%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          M  + NF + E GATA+EYGL+V+LIA+VII +VT LG  L   F  +
Sbjct: 1  MDKLMNFFRAEEGATAVEYGLMVALIAIVIIAAVTFLGNSLNNIFNEV 48


>gi|326387837|ref|ZP_08209443.1| hypothetical protein Y88_0751 [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326207883|gb|EGD58694.1| hypothetical protein Y88_0751 [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 60

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (62%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          M  +K+  +DE+GATAIEYGL+ +LIAV  IT++  LG  L   F  +   + T
Sbjct: 1  MQFIKSVFRDETGATAIEYGLIAALIAVAAITAMGALGNSLSNTFSLVSGDMAT 54


>gi|27376553|ref|NP_768082.1| pilus assembly protein pilin subunit [Bradyrhizobium japonicum
          USDA 110]
 gi|27349694|dbj|BAC46707.1| pilus assembly protein pilin subunit [Bradyrhizobium japonicum
          USDA 110]
          Length = 54

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (66%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +++  F +DESGATAIEYGL+ + IA+ IIT V  LG  L   F +I  ++
Sbjct: 3  NLIARFAKDESGATAIEYGLIAAGIALAIITVVNNLGSTLNTKFTSISTSL 53


>gi|328474266|gb|EGF45071.1| putative fimbrial protein [Vibrio parahaemolyticus 10329]
          Length = 57

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITS--VTTLGGKLKKAFEAIDKA 53
          +++K+F++DE G T +EY L  +LI    +TS   TTL GK       I+ +
Sbjct: 6  NLIKDFMEDEEGLTLLEYILGAALIVTAFLTSGFWTTLSGKFTSVASQINNS 57


>gi|52425837|ref|YP_088974.1| hypothetical protein MS1782 [Mannheimia succiniciproducens
          MBEL55E]
 gi|52307889|gb|AAU38389.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 75

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIA---VVIITSVTTLGGKLKKAFEAIDKAI 54
          ++ F QD  G TAIEYGL+  ++A   V +    T+    LK+ F  + K++
Sbjct: 17 IRRFKQDHKGVTAIEYGLIAVVMAAFIVYVFADDTSFVQSLKEKFSDVSKSV 68


>gi|319781330|ref|YP_004140806.1| Flp/Fap pilin component [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
 gi|317167218|gb|ADV10756.1| Flp/Fap pilin component [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
          Length = 61

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 24/28 (85%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSV 36
          FL DE+GATA+EYG++++++++ I+  +
Sbjct: 8  FLNDETGATAVEYGVIIAVLSLAIVGGI 35


>gi|17545380|ref|NP_518782.1| pilin transmembrane protein [Ralstonia solanacearum GMI1000]
 gi|17427672|emb|CAD14191.1| putative pilin transmembrane protein [Ralstonia solanacearum
          GMI1000]
          Length = 53

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 32/50 (64%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          + K F+++E GA  +EY LL++ +A+V+IT  +T+   +   + +I  A+
Sbjct: 4  MFKRFVREEDGAAGVEYALLLTFVALVMITYGSTVKTAVGNIWNSIATAL 53


>gi|153834036|ref|ZP_01986703.1| putative fimbrial protein [Vibrio harveyi HY01]
 gi|148869591|gb|EDL68581.1| putative fimbrial protein [Vibrio harveyi HY01]
          Length = 57

 Score = 35.4 bits (80), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 2/42 (4%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITS--VTTLGGKL 43
          +++K+F++DE G T +EY L  +LI    +TS   TTL GK 
Sbjct: 6  NLIKDFMEDEEGLTLLEYILGAALIVTAFLTSGFWTTLSGKF 47


>gi|149185491|ref|ZP_01863807.1| hypothetical protein ED21_20739 [Erythrobacter sp. SD-21]
 gi|148830711|gb|EDL49146.1| hypothetical protein ED21_20739 [Erythrobacter sp. SD-21]
          Length = 63

 Score = 35.4 bits (80), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 29/41 (70%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKK 45
          ++ NFL+DESGA+A EY L+++++   +  +V T+   +++
Sbjct: 1  MLTNFLRDESGASAAEYALILAIVGAGLAFAVFTVSDAIER 41


>gi|293391335|ref|ZP_06635669.1| fimbrial protein Flp precursor [Aggregatibacter
          actinomycetemcomitans D7S-1]
 gi|15487345|dbj|BAB64544.1| fimbrial protein Flp precursor [Actinobacillus
          actinomycetemcomitans]
 gi|19702512|gb|AAL93276.1| flp-1 protein [Aggregatibacter actinomycetemcomitans]
 gi|19702514|gb|AAL93277.1| flp-1 protein [Aggregatibacter actinomycetemcomitans]
 gi|19702518|gb|AAL93279.1| flp-1 protein [Aggregatibacter actinomycetemcomitans]
 gi|19702520|gb|AAL93280.1| flp-1 protein [Aggregatibacter actinomycetemcomitans]
 gi|32452619|gb|AAP43981.1| Flp1 [Aggregatibacter actinomycetemcomitans]
 gi|290951869|gb|EFE01988.1| fimbrial protein Flp precursor [Aggregatibacter
          actinomycetemcomitans D7S-1]
          Length = 75

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGG---KLKKAFEAIDKAIVTTS 58
          +++F ++++G TAIEYGL+   +AV+I+    + GG   KL+  F  +   I + S
Sbjct: 17 IRSFKKNQAGVTAIEYGLIAIAVAVLIVAVFYSEGGFIAKLQSKFNDLTSTISSAS 72


>gi|220922529|ref|YP_002497831.1| Flp/Fap pilin protein [Methylobacterium nodulans ORS 2060]
 gi|219947136|gb|ACL57528.1| Flp/Fap pilin component [Methylobacterium nodulans ORS 2060]
          Length = 53

 Score = 35.4 bits (80), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 32/52 (61%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M+ +  FL+DE GA  +EY +L+ ++ V +I ++  +G  +   + A++ A+
Sbjct: 1  MNRLSKFLRDEDGAALVEYTVLLGILLVAVIATIGGVGTWVNGKWTALNSAL 52


>gi|28899197|ref|NP_798802.1| putative fimbrial protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|153836832|ref|ZP_01989499.1| putative fimbrial protein [Vibrio parahaemolyticus AQ3810]
 gi|260361565|ref|ZP_05774592.1| putative fimbrial protein [Vibrio parahaemolyticus K5030]
 gi|260876722|ref|ZP_05889077.1| putative fimbrial protein [Vibrio parahaemolyticus AN-5034]
 gi|260898199|ref|ZP_05906695.1| putative fimbrial protein [Vibrio parahaemolyticus Peru-466]
 gi|260900393|ref|ZP_05908788.1| putative fimbrial protein [Vibrio parahaemolyticus AQ4037]
 gi|28807421|dbj|BAC60686.1| putative fimbrial protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|149749978|gb|EDM60723.1| putative fimbrial protein [Vibrio parahaemolyticus AQ3810]
 gi|308089071|gb|EFO38766.1| putative fimbrial protein [Vibrio parahaemolyticus Peru-466]
 gi|308091431|gb|EFO41126.1| putative fimbrial protein [Vibrio parahaemolyticus AN-5034]
 gi|308109139|gb|EFO46679.1| putative fimbrial protein [Vibrio parahaemolyticus AQ4037]
 gi|308113986|gb|EFO51526.1| putative fimbrial protein [Vibrio parahaemolyticus K5030]
          Length = 57

 Score = 35.4 bits (80), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 2/42 (4%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITS--VTTLGGKL 43
          +++K+F++DE G T +EY L  +LI    +TS   TTL GK 
Sbjct: 6  NLIKDFMEDEEGLTLLEYILGAALIVTAFLTSGFWTTLAGKF 47


>gi|220927008|ref|YP_002502310.1| hypothetical protein Mnod_7268 [Methylobacterium nodulans ORS
          2060]
 gi|219951615|gb|ACL62007.1| conserved hypothetical protein [Methylobacterium nodulans ORS
          2060]
          Length = 66

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 29/55 (52%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          ++   V+ FL D +G+TAIEY ++  LI + +  S+   G      + ++   +V
Sbjct: 6  LRARSVRRFLNDGAGSTAIEYAMIAGLIFLAVAVSLNLYGASTGSLYTSLGNKVV 60


>gi|219848813|ref|YP_002463246.1| Flp/Fap pilin component [Chloroflexus aggregans DSM 9485]
 gi|219543072|gb|ACL24810.1| Flp/Fap pilin component [Chloroflexus aggregans DSM 9485]
          Length = 52

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++++F   E G   +EY L++ LIAVV+I ++T LG  +   F  +   I
Sbjct: 1  MLRSFFAKEEGQGLVEYALILVLIAVVVIGALTALGTNISGLFSQLADTI 50


>gi|163846875|ref|YP_001634919.1| Flp/Fap pilin component [Chloroflexus aurantiacus J-10-fl]
 gi|163668164|gb|ABY34530.1| Flp/Fap pilin component [Chloroflexus aurantiacus J-10-fl]
          Length = 55

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++++F   E G   +EY L++ LIAVV+I ++T LG  +   F  +   I
Sbjct: 4  MLRSFFAKEEGQGLVEYALILVLIAVVVIGALTLLGQNISDLFNNLAGTI 53


>gi|254178185|ref|ZP_04884840.1| pilin, flp/fap family [Burkholderia mallei ATCC 10399]
 gi|254199900|ref|ZP_04906266.1| pilin, flp/fap family [Burkholderia mallei FMH]
 gi|254206232|ref|ZP_04912584.1| pilin, flp/fap family [Burkholderia mallei JHU]
 gi|254358351|ref|ZP_04974624.1| pilin, flp/fap family [Burkholderia mallei 2002721280]
 gi|147749496|gb|EDK56570.1| pilin, flp/fap family [Burkholderia mallei FMH]
 gi|147753675|gb|EDK60740.1| pilin, flp/fap family [Burkholderia mallei JHU]
 gi|148027478|gb|EDK85499.1| pilin, flp/fap family [Burkholderia mallei 2002721280]
 gi|160699224|gb|EDP89194.1| pilin, flp/fap family [Burkholderia mallei ATCC 10399]
          Length = 42

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 22/34 (64%)

Query: 17 TAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          TAIEYGL+  LIAV I T+V T+G  L   F  I
Sbjct: 2  TAIEYGLIAGLIAVAIATTVGTVGTDLSALFSTI 35


>gi|222524612|ref|YP_002569083.1| hypothetical protein Chy400_1336 [Chloroflexus sp. Y-400-fl]
 gi|222448491|gb|ACM52757.1| hypothetical protein Chy400_1336 [Chloroflexus sp. Y-400-fl]
          Length = 60

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 25/41 (60%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          L  E G    EYGL+++LIA+V + +++ +GG L   +  +
Sbjct: 15 LHRERGQGLAEYGLIITLIALVCVLAISAIGGSLSDMYNTV 55


>gi|222524696|ref|YP_002569167.1| Flp/Fap pilin component [Chloroflexus sp. Y-400-fl]
 gi|222448575|gb|ACM52841.1| Flp/Fap pilin component [Chloroflexus sp. Y-400-fl]
          Length = 52

 Score = 35.0 bits (79), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFE 48
          ++++F   E G   +EY L++ LIAVV+I ++T LG  +   F 
Sbjct: 1  MLRSFFAKEEGQGLVEYALILVLIAVVVIGALTLLGQNISDLFN 44


>gi|296444357|ref|ZP_06886322.1| Flp/Fap pilin component [Methylosinus trichosporium OB3b]
 gi|296258004|gb|EFH05066.1| Flp/Fap pilin component [Methylosinus trichosporium OB3b]
          Length = 55

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 26/40 (65%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
           FL DE GAT+IEY  + + ++++I ++   +G KL  A+
Sbjct: 7  RFLADEIGATSIEYATIGAFVSILIYSATKVIGTKLSSAY 46


>gi|229816456|ref|ZP_04446757.1| hypothetical protein COLINT_03510 [Collinsella intestinalis DSM
          13280]
 gi|229807998|gb|EEP43799.1| hypothetical protein COLINT_03510 [Collinsella intestinalis DSM
          13280]
          Length = 99

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          V+  L++ESG    EY +LV ++ V+ I ++     K+   +EAI + I
Sbjct: 48 VRQILREESGQGTTEYAILVGVLVVIAILAIVAFRDKVSSLWEAISQGI 96


>gi|114704315|ref|ZP_01437223.1| hypothetical protein FP2506_05261 [Fulvimarina pelagi HTCC2506]
 gi|114539100|gb|EAU42220.1| hypothetical protein FP2506_05261 [Fulvimarina pelagi HTCC2506]
          Length = 66

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTL 39
          L D+SGATAIEY L+  +IA  I+T +  L
Sbjct: 18 LNDDSGATAIEYCLIAGIIATAIVTGLEAL 47


>gi|320102935|ref|YP_004178526.1| hypothetical protein Isop_1392 [Isosphaera pallida ATCC 43644]
 gi|319750217|gb|ADV61977.1| hypothetical protein Isop_1392 [Isosphaera pallida ATCC 43644]
          Length = 82

 Score = 35.0 bits (79), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTLG 40
          LQDE GATA+EY +++  I + +ITS+   G
Sbjct: 21 LQDEQGATAVEYAVMLMAILLAMITSIRYFG 51


>gi|299532594|ref|ZP_07045983.1| hypothetical protein CTS44_17418 [Comamonas testosteroni S44]
 gi|298719397|gb|EFI60365.1| hypothetical protein CTS44_17418 [Comamonas testosteroni S44]
          Length = 67

 Score = 34.7 bits (78), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 29/39 (74%), Gaps = 2/39 (5%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVII--TSVTTLG 40
          H +++F++DE GA  IEY L+V+++++ +I   +VT LG
Sbjct: 10 HSLQSFVRDEEGAQIIEYALIVAVVSLTLILAMNVTDLG 48


>gi|219849039|ref|YP_002463472.1| hypothetical protein Cagg_2152 [Chloroflexus aggregans DSM 9485]
 gi|219543298|gb|ACL25036.1| hypothetical protein Cagg_2152 [Chloroflexus aggregans DSM 9485]
          Length = 60

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%)

Query: 11 QDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          Q E G    EYGL+++LIA+V + ++ ++GG L   +  +
Sbjct: 16 QRERGQGMAEYGLIITLIALVCVLAMISIGGSLSDMYNTV 55


>gi|90411210|ref|ZP_01219223.1| hypothetical protein P3TCK_06577 [Photobacterium profundum 3TCK]
 gi|90328056|gb|EAS44377.1| hypothetical protein P3TCK_06577 [Photobacterium profundum 3TCK]
          Length = 57

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          F +DE G T +EY +  SL+   ++ + T+LG K+  +  A+  AI
Sbjct: 11 FWKDEEGLTTVEYAIAGSLVGAAVVGAFTSLGEKVTSSVNAMATAI 56


>gi|150397710|ref|YP_001328177.1| Flp/Fap pilin protein [Sinorhizobium medicae WSM419]
 gi|150029225|gb|ABR61342.1| Flp/Fap pilin component [Sinorhizobium medicae WSM419]
          Length = 57

 Score = 34.7 bits (78), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAV 30
          M  +K   +D  GAT +EYGLL +LI+V
Sbjct: 1  METLKRLFEDRDGATVVEYGLLAALISV 28


>gi|53723202|ref|YP_112187.1| pilus subunit protein [Burkholderia pseudomallei K96243]
 gi|76818517|ref|YP_336463.1| putative pilus subunit protein [Burkholderia pseudomallei 1710b]
 gi|126444256|ref|YP_001064071.1| putative pilus subunit protein [Burkholderia pseudomallei 668]
 gi|126456774|ref|YP_001076983.1| putative pilus subunit protein [Burkholderia pseudomallei 1106a]
 gi|134281902|ref|ZP_01768609.1| putative pilus subunit protein [Burkholderia pseudomallei 305]
 gi|167725240|ref|ZP_02408476.1| putative pilus subunit protein [Burkholderia pseudomallei DM98]
 gi|167744170|ref|ZP_02416944.1| putative pilus subunit protein [Burkholderia pseudomallei 14]
 gi|167821369|ref|ZP_02453049.1| putative pilus subunit protein [Burkholderia pseudomallei 91]
 gi|167829708|ref|ZP_02461179.1| putative pilus subunit protein [Burkholderia pseudomallei 9]
 gi|167851177|ref|ZP_02476685.1| putative pilus subunit protein [Burkholderia pseudomallei B7210]
 gi|167899808|ref|ZP_02487209.1| putative pilus subunit protein [Burkholderia pseudomallei 7894]
 gi|167908124|ref|ZP_02495329.1| putative pilus subunit protein [Burkholderia pseudomallei NCTC
          13177]
 gi|167916471|ref|ZP_02503562.1| putative pilus subunit protein [Burkholderia pseudomallei 112]
 gi|167924327|ref|ZP_02511418.1| putative pilus subunit protein [Burkholderia pseudomallei BCC215]
 gi|217424250|ref|ZP_03455749.1| putative pilus subunit protein [Burkholderia pseudomallei 576]
 gi|226194052|ref|ZP_03789653.1| putative pilus subunit protein [Burkholderia pseudomallei
          Pakistan 9]
 gi|237509208|ref|ZP_04521923.1| putative pilin [Burkholderia pseudomallei MSHR346]
 gi|242312447|ref|ZP_04811464.1| putative pilus subunit protein [Burkholderia pseudomallei 1106b]
 gi|254182589|ref|ZP_04889183.1| putative pilus subunit protein [Burkholderia pseudomallei 1655]
 gi|254187140|ref|ZP_04893655.1| putative pilus subunit protein [Burkholderia pseudomallei Pasteur
          52237]
 gi|254192539|ref|ZP_04898978.1| putative pilus subunit protein [Burkholderia pseudomallei S13]
 gi|254262622|ref|ZP_04953487.1| putative pilus subunit protein [Burkholderia pseudomallei 1710a]
 gi|254296479|ref|ZP_04963935.1| putative pilus subunit protein [Burkholderia pseudomallei 406e]
 gi|52213616|emb|CAH39670.1| putative pilus subunit protein [Burkholderia pseudomallei K96243]
 gi|76582990|gb|ABA52464.1| putative pilus subunit protein [Burkholderia pseudomallei 1710b]
 gi|126223747|gb|ABN87252.1| putative pilus subunit protein [Burkholderia pseudomallei 668]
 gi|126230542|gb|ABN93955.1| putative pilus subunit protein [Burkholderia pseudomallei 1106a]
 gi|134246964|gb|EBA47051.1| putative pilus subunit protein [Burkholderia pseudomallei 305]
 gi|157806367|gb|EDO83537.1| putative pilus subunit protein [Burkholderia pseudomallei 406e]
 gi|157934823|gb|EDO90493.1| putative pilus subunit protein [Burkholderia pseudomallei Pasteur
          52237]
 gi|169649297|gb|EDS81990.1| putative pilus subunit protein [Burkholderia pseudomallei S13]
 gi|184213124|gb|EDU10167.1| putative pilus subunit protein [Burkholderia pseudomallei 1655]
 gi|217392715|gb|EEC32738.1| putative pilus subunit protein [Burkholderia pseudomallei 576]
 gi|225933997|gb|EEH29983.1| putative pilus subunit protein [Burkholderia pseudomallei
          Pakistan 9]
 gi|235001413|gb|EEP50837.1| putative pilin [Burkholderia pseudomallei MSHR346]
 gi|242135686|gb|EES22089.1| putative pilus subunit protein [Burkholderia pseudomallei 1106b]
 gi|254213624|gb|EET03009.1| putative pilus subunit protein [Burkholderia pseudomallei 1710a]
          Length = 56

 Score = 34.7 bits (78), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (68%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +  VK F++DE G +AIEYGL+ +LIA+VII +V T+G  L   F  I
Sbjct: 5  VQYVKQFVRDEGGVSAIEYGLIAALIAIVIIGAVKTVGTNLNSVFSTI 52


>gi|238027722|ref|YP_002911953.1| putative fimbriae assembly-like protein [Burkholderia glumae
          BGR1]
 gi|237876916|gb|ACR29249.1| Putative fimbriae assembly related protein [Burkholderia glumae
          BGR1]
          Length = 56

 Score = 34.7 bits (78), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          ++  FL++E+G TAIEYGL+  +IA       T L   + +AF
Sbjct: 4  LLGRFLEEEAGTTAIEYGLIAGVIAGAAGYMATNLSDDVTQAF 46


>gi|19702498|gb|AAL93269.1| flp-1 protein [Aggregatibacter actinomycetemcomitans]
 gi|19702508|gb|AAL93274.1| flp-1 protein [Aggregatibacter actinomycetemcomitans]
 gi|307133492|dbj|BAJ19004.1| Flp1 [Aggregatibacter actinomycetemcomitans]
          Length = 75

 Score = 34.3 bits (77), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 32/55 (58%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          +++F ++E+G TAIEYGL+   +AV+I+    +  G +K      ++   T S A
Sbjct: 17 IRSFRKNEAGVTAIEYGLIAIAVAVLIVAVFYSNNGFIKGLQNKFNQLTSTVSSA 71


>gi|332185257|ref|ZP_08387006.1| flp/Fap pilin component family protein [Sphingomonas sp. S17]
 gi|332014981|gb|EGI57037.1| flp/Fap pilin component family protein [Sphingomonas sp. S17]
          Length = 57

 Score = 34.3 bits (77), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (61%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          M+ ++  +++  GATAIEYGL+ +L+AV  I  ++ LGG L  AF  I   + T 
Sbjct: 1  MNTLRKMVKNNKGATAIEYGLIAALVAVAAIAGMSKLGGSLGTAFNTIGGKLDTN 55


>gi|13474657|ref|NP_106226.1| fimbriae associated protein [Mesorhizobium loti MAFF303099]
 gi|14025412|dbj|BAB52012.1| fimbriae associated protein [Mesorhizobium loti MAFF303099]
          Length = 58

 Score = 34.3 bits (77), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 31/47 (65%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          ++   F++DESGATAIEYGL+ +LIA+ IIT    LG  +   F  I
Sbjct: 3  NLFARFVKDESGATAIEYGLIAALIALAIITGAGALGNAINSKFTNI 49


>gi|260461952|ref|ZP_05810197.1| Flp/Fap pilin component [Mesorhizobium opportunistum WSM2075]
 gi|259032199|gb|EEW33465.1| Flp/Fap pilin component [Mesorhizobium opportunistum WSM2075]
          Length = 58

 Score = 34.3 bits (77), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 31/47 (65%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          ++   F++DESGATAIEYGL+ +LIA+ IIT    LG  +   F  I
Sbjct: 3  NLFARFVKDESGATAIEYGLIAALIALAIITGAGALGNAINAKFTTI 49


>gi|322434112|ref|YP_004216324.1| Flp/Fap pilin component [Acidobacterium sp. MP5ACTX9]
 gi|321161839|gb|ADW67544.1| Flp/Fap pilin component [Acidobacterium sp. MP5ACTX9]
          Length = 60

 Score = 34.3 bits (77), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 30/53 (56%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
           ++ + L+DESG   IEY L+ +LI +  + ++     K+K AF ++  ++  
Sbjct: 6  DLLSDLLEDESGQDLIEYALVAALIGLGAVVAMNGFSTKVKTAFNSVGSSLTN 58


>gi|116626782|ref|YP_828938.1| Flp/Fap pilin component [Candidatus Solibacter usitatus
          Ellin6076]
 gi|116229944|gb|ABJ88653.1| Flp/Fap pilin component [Candidatus Solibacter usitatus
          Ellin6076]
          Length = 60

 Score = 34.3 bits (77), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 29/46 (63%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          +V NF++DE G   +EY L+V+ + + +IT+V  L   +   ++++
Sbjct: 4  LVLNFVRDEQGQDLVEYALIVAAVGLALITTVNQLSQGIVSLYQSM 49


>gi|78186673|ref|YP_374716.1| pilus assembly protein PilA [Chlorobium luteolum DSM 273]
 gi|78166575|gb|ABB23673.1| pilus assembly protein PilA [Chlorobium luteolum DSM 273]
          Length = 60

 Score = 34.3 bits (77), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +  + G T IEY L+ +L+AVV+IT++  +G  L   F  I  A+
Sbjct: 8  ITSQKGVTMIEYALIAALVAVVVITALGLVGENLTTIFTTISDAL 52


>gi|326797324|ref|YP_004315144.1| Flp/Fap pilin component [Marinomonas mediterranea MMB-1]
 gi|326548088|gb|ADZ93308.1| Flp/Fap pilin component [Marinomonas mediterranea MMB-1]
          Length = 65

 Score = 34.3 bits (77), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAV---VIITSVTTLGGKLKKAFEAI-DKAIVTTSPA 60
          +K FL DE G TAIEYG+L + +A    VI  S       LK  F +I D+   T +P 
Sbjct: 5  IKRFLSDERGVTAIEYGILAAAMAAAIGVIFGSDGVFVTALKDRFSSIADQITNTNNPG 63


>gi|238027566|ref|YP_002911797.1| Flp/Fap pilin component [Burkholderia glumae BGR1]
 gi|237876760|gb|ACR29093.1| Flp/Fap pilin component [Burkholderia glumae BGR1]
          Length = 65

 Score = 34.3 bits (77), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 30/46 (65%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          ++  FL++E G TA+EYGL+  L+AV ++ +V  L G +  AF  I
Sbjct: 4  LINRFLKEEDGVTAVEYGLIAGLMAVALVAAVGVLSGGISNAFSYI 49


>gi|167624209|ref|YP_001674503.1| hypothetical protein Shal_2285 [Shewanella halifaxensis HAW-EB4]
 gi|167354231|gb|ABZ76844.1| hypothetical protein Shal_2285 [Shewanella halifaxensis HAW-EB4]
          Length = 65

 Score = 34.3 bits (77), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 24/36 (66%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG 40
          ++K F++DESG TA+EY +   L+   +I +  TLG
Sbjct: 6  LLKEFIEDESGLTAVEYAIAGGLVVGGMIAAFNTLG 41


>gi|149188867|ref|ZP_01867157.1| hypothetical protein VSAK1_05940 [Vibrio shilonii AK1]
 gi|148837287|gb|EDL54234.1| hypothetical protein VSAK1_05940 [Vibrio shilonii AK1]
          Length = 72

 Score = 33.9 bits (76), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 34/61 (55%), Gaps = 6/61 (9%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG--GKLKKAF----EAIDKAIVTTS 58
           +  F  D+ G TAIEYGL+   +AV++  ++ + G  G+LK AF      I  A  TT+
Sbjct: 12 FLSQFKNDQRGVTAIEYGLIGVAMAVLLSVALGSTGFIGELKTAFANIATTIKNAGKTTA 71

Query: 59 P 59
          P
Sbjct: 72 P 72


>gi|326386385|ref|ZP_08208008.1| hypothetical protein Y88_2279 [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326209046|gb|EGD59840.1| hypothetical protein Y88_2279 [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 60

 Score = 33.9 bits (76), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 31/45 (68%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          M ++   L+DE+GATAIEYGL+ +LIAV  IT++  LG  L   F
Sbjct: 1  MKLINRILKDEAGATAIEYGLIAALIAVAAITAMGALGNSLSNTF 45


>gi|307261009|ref|ZP_07542691.1| hypothetical protein appser12_5760 [Actinobacillus
          pleuropneumoniae serovar 12 str. 1096]
 gi|306869311|gb|EFN01106.1| hypothetical protein appser12_5760 [Actinobacillus
          pleuropneumoniae serovar 12 str. 1096]
          Length = 78

 Score = 33.9 bits (76), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGG---KLKKAFEAIDKAIVTTSP 59
          ++ F +++ G TAIEYGL+   +A++I+       G   +L+K F  + K I  T+ 
Sbjct: 17 IRRFKENQQGVTAIEYGLIAVAVAILIVAVFYKDNGFIQELQKKFGELTKTIAGTTD 73


>gi|87199923|ref|YP_497180.1| hypothetical protein Saro_1906 [Novosphingobium aromaticivorans
          DSM 12444]
 gi|87135604|gb|ABD26346.1| hypothetical protein Saro_1906 [Novosphingobium aromaticivorans
          DSM 12444]
          Length = 62

 Score = 33.5 bits (75), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 22/26 (84%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAV 30
          +++  +++ESGATAIEYGLL++ I +
Sbjct: 6  VLRKIIRNESGATAIEYGLLIASIGL 31


>gi|163751740|ref|ZP_02158958.1| hypothetical protein KT99_12224 [Shewanella benthica KT99]
 gi|161328392|gb|EDP99551.1| hypothetical protein KT99_12224 [Shewanella benthica KT99]
          Length = 62

 Score = 33.5 bits (75), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG 40
           I  +F++DESG TA+EY +   L+   +I +  TLG
Sbjct: 5  QIFADFIEDESGLTAVEYAIAGGLVVGGMIAAFNTLG 41


>gi|332185116|ref|ZP_08386865.1| flp/Fap pilin component family protein [Sphingomonas sp. S17]
 gi|332014840|gb|EGI56896.1| flp/Fap pilin component family protein [Sphingomonas sp. S17]
          Length = 57

 Score = 33.5 bits (75), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (62%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          ++  + +  GATAIEYGL+ +LIAV  I  +++LGG L  AF  I   + T
Sbjct: 4  IRKIIHNRKGATAIEYGLIAALIAVAAIAGMSSLGGSLGTAFNTIGGKLDT 54


>gi|322419947|ref|YP_004199170.1| Flp/Fap pilin component [Geobacter sp. M18]
 gi|320126334|gb|ADW13894.1| Flp/Fap pilin component [Geobacter sp. M18]
          Length = 65

 Score = 33.5 bits (75), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          L+ E G   +EY L++ LIA+V+I  VT +G    + F  ++ A+
Sbjct: 19 LKSEKGQGLVEYALILVLIAIVVIAMVTGIGQNANEVFCQVNGAL 63


Searching..................................................done


Results from round 2




>gi|254780730|ref|YP_003065143.1| hypothetical protein CLIBASIA_03085 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040407|gb|ACT57203.1| hypothetical protein CLIBASIA_03085 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 120

 Score = 69.6 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/54 (51%), Positives = 42/54 (77%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          MKM+I+K  L++ SGATAIEYGLL SL++V II++V+TLG ++K  ++ I   +
Sbjct: 1  MKMNIIKKILKNGSGATAIEYGLLASLVSVAIISAVSTLGDRMKGVYQTISTEL 54


>gi|254255250|ref|ZP_04948566.1| hypothetical protein BDAG_04583 [Burkholderia dolosa AUO158]
 gi|124900987|gb|EAY71737.1| hypothetical protein BDAG_04583 [Burkholderia dolosa AUO158]
          Length = 241

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 34/55 (61%)

Query: 6   VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
           V   +++E G TAIEYGL+ +LIA+ I+ ++TT+G  LK  F  +   + +   A
Sbjct: 186 VAWLVRNEDGVTAIEYGLIAALIAIGIVAALTTIGTDLKTVFSTLAVDLDSVVAA 240


>gi|254780734|ref|YP_003065147.1| Flp/Fap pilin component [Candidatus Liberibacter asiaticus str.
          psy62]
 gi|254040411|gb|ACT57207.1| Flp/Fap pilin component [Candidatus Liberibacter asiaticus str.
          psy62]
          Length = 62

 Score = 68.5 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 62/62 (100%), Positives = 62/62 (100%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA
Sbjct: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60

Query: 61 AS 62
          AS
Sbjct: 61 AS 62


>gi|254255251|ref|ZP_04948567.1| hypothetical protein BDAG_04584 [Burkholderia dolosa AUO158]
 gi|124900988|gb|EAY71738.1| hypothetical protein BDAG_04584 [Burkholderia dolosa AUO158]
          Length = 112

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 35/55 (63%)

Query: 6   VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
           V+ F++DE G TAIEYGL+ +LIAV II +++T+G  LK  F  I   + +    
Sbjct: 57  VRRFVRDEEGVTAIEYGLIAALIAVGIILALSTIGKDLKTVFSTIAADLDSAVSG 111


>gi|160897519|ref|YP_001563101.1| Flp/Fap pilin component [Delftia acidovorans SPH-1]
 gi|160363103|gb|ABX34716.1| Flp/Fap pilin component [Delftia acidovorans SPH-1]
          Length = 68

 Score = 63.8 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 32/56 (57%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
           I+KNF +DE GATAIEYGL+  LIAV I+   T LG  L   F  I   +    P
Sbjct: 13 DIIKNFWKDEEGATAIEYGLIAGLIAVGIVVGATALGTNLNGLFTRIATKLTGFVP 68


>gi|33593020|ref|NP_880664.1| hypothetical protein BP1991 [Bordetella pertussis Tohama I]
 gi|33563395|emb|CAE42271.1| putative membrane protein [Bordetella pertussis Tohama I]
 gi|332382432|gb|AEE67279.1| hypothetical protein BPTD_1961 [Bordetella pertussis CS]
          Length = 58

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 38/54 (70%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          +KNF +DE GATAIEYGL+V LIAVVII SV+ LG  LK  F+ I   +   +P
Sbjct: 5  LKNFWRDEEGATAIEYGLIVGLIAVVIIGSVSLLGETLKGFFDTIQTELSAEAP 58


>gi|218506996|ref|ZP_03504874.1| pilus subunit protein [Rhizobium etli Brasil 5]
          Length = 92

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/59 (40%), Positives = 35/59 (59%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
           +   FL+DESGATAIEYGL+ +LI+V +IT  T+LG K+   F  +   +   +    
Sbjct: 3  KLFSRFLKDESGATAIEYGLIAALISVALITGATSLGSKIGNTFNGLSTKMDGATSGCQ 61


>gi|254780732|ref|YP_003065145.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040409|gb|ACT57205.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 58

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 44/58 (75%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          MKMHIVKNFLQDESGATAIEYGLL SLIAV II SVTTLGGKL   F  I   +   S
Sbjct: 1  MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADISSKLNPKS 58


>gi|134295591|ref|YP_001119326.1| Flp/Fap pilin component [Burkholderia vietnamiensis G4]
 gi|134138748|gb|ABO54491.1| Flp/Fap pilin component [Burkholderia vietnamiensis G4]
          Length = 91

 Score = 62.7 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 39/58 (67%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          ++K FL++E+G TAIEYGL+  L+AV II  V++LGG L   F +I   + +   A++
Sbjct: 24 LIKRFLKEETGVTAIEYGLIAGLVAVAIIAGVSSLGGNLNTMFTSIGSCVSSLGSASA 81


>gi|315121897|ref|YP_004062386.1| hypothetical protein CKC_00735 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
 gi|313495299|gb|ADR51898.1| hypothetical protein CKC_00735 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
          Length = 64

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 34/60 (56%), Positives = 46/60 (76%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          MK++I++NFLQDESGATAIEYGLL +L++VVII +VTTLG KL   F  + ++ +    A
Sbjct: 1  MKINIIRNFLQDESGATAIEYGLLAALVSVVIIGAVTTLGTKLSATFAKVGESFLPGPTA 60


>gi|33596964|ref|NP_884607.1| hypothetical protein BPP2371 [Bordetella parapertussis 12822]
 gi|33600806|ref|NP_888366.1| hypothetical protein BB1821 [Bordetella bronchiseptica RB50]
 gi|33566415|emb|CAE37668.1| putative membrane protein [Bordetella parapertussis]
 gi|33568406|emb|CAE32318.1| putative membrane protein [Bordetella bronchiseptica RB50]
          Length = 58

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 37/54 (68%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          +KNF  DE GATAIEYGL+V LIAVVII SV+ LG  LK  F+ I   +   +P
Sbjct: 5  LKNFWHDEEGATAIEYGLIVGLIAVVIIGSVSLLGETLKGFFDTIQTELSAEAP 58


>gi|254780733|ref|YP_003065146.1| hypothetical protein CLIBASIA_03100 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040410|gb|ACT57206.1| hypothetical protein CLIBASIA_03100 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 56

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 43/56 (76%), Positives = 47/56 (83%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          MKM+IVK+FL+DESGATAIEYGLL SLIAV II SVTTLGGKL K FE I+K I  
Sbjct: 1  MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIEKGIKA 56


>gi|161524909|ref|YP_001579921.1| Flp/Fap pilin component [Burkholderia multivorans ATCC 17616]
 gi|189350341|ref|YP_001945969.1| putative fimbriae assembly-related protein [Burkholderia
          multivorans ATCC 17616]
 gi|160342338|gb|ABX15424.1| Flp/Fap pilin component [Burkholderia multivorans ATCC 17616]
 gi|189334363|dbj|BAG43433.1| putative fimbriae assembly-related protein [Burkholderia
          multivorans ATCC 17616]
          Length = 69

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/54 (53%), Positives = 37/54 (68%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          I+K FL++E G TAIEYGL+  LIAV II SV+T+G KL   FE I   + + S
Sbjct: 4  IIKCFLKEEDGVTAIEYGLIAGLIAVAIIASVSTIGSKLGTMFENISSCVSSPS 57


>gi|221197777|ref|ZP_03570823.1| Flp/Fap pilin component [Burkholderia multivorans CGD2M]
 gi|221204665|ref|ZP_03577682.1| Flp/Fap pilin component [Burkholderia multivorans CGD2]
 gi|221175522|gb|EEE07952.1| Flp/Fap pilin component [Burkholderia multivorans CGD2]
 gi|221181709|gb|EEE14110.1| Flp/Fap pilin component [Burkholderia multivorans CGD2M]
          Length = 72

 Score = 61.5 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 27/58 (46%), Positives = 39/58 (67%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          I+K FL++E+G TAIEYGL+  LIAV I+  V+++GG L   F  + K I   S +A+
Sbjct: 4  IIKRFLKEETGVTAIEYGLIAGLIAVAIVAGVSSIGGSLGNMFNNLGKCITDPSNSAA 61


>gi|288956966|ref|YP_003447307.1| Flp/Fap pilin component [Azospirillum sp. B510]
 gi|288909274|dbj|BAI70763.1| Flp/Fap pilin component [Azospirillum sp. B510]
          Length = 75

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 35/55 (63%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          I++   +D+ GATAIEYGLL +LIAV II  V+ +GG L   F AI   I   +P
Sbjct: 20 ILRRLRKDDRGATAIEYGLLAALIAVAIIGGVSAVGGNLNSMFNAISSKISAKTP 74


>gi|167584952|ref|ZP_02377340.1| hypothetical protein BuboB_06426 [Burkholderia ubonensis Bu]
          Length = 70

 Score = 60.4 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 32/48 (66%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           NFL+D+SG TAIEYGL+ +LIAVVII +V  +G  L   F  I   +
Sbjct: 23 SNFLRDDSGVTAIEYGLIAALIAVVIIGAVQIVGQDLNGVFTTIGNEL 70


>gi|160897518|ref|YP_001563100.1| Flp/Fap pilin component [Delftia acidovorans SPH-1]
 gi|160363102|gb|ABX34715.1| Flp/Fap pilin component [Delftia acidovorans SPH-1]
          Length = 58

 Score = 60.4 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 33/55 (60%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          ++KNF +DE GATAIEYGL+  LIAV I+   T LG  L   F  +   +   +P
Sbjct: 4  MIKNFWKDEEGATAIEYGLIAGLIAVGIVVGATALGTDLNGLFNRLATKLNGLAP 58


>gi|221213143|ref|ZP_03586119.1| Flp/Fap pilin component [Burkholderia multivorans CGD1]
 gi|221167356|gb|EED99826.1| Flp/Fap pilin component [Burkholderia multivorans CGD1]
          Length = 73

 Score = 60.4 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 26/58 (44%), Positives = 39/58 (67%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          I+K FL++E+G TAIEYGL+  LIAV I+  V+++GG L   F+ +   I   S +A+
Sbjct: 4  IIKRFLKEETGVTAIEYGLIAGLIAVAIVAGVSSIGGSLGNMFKNLGSCITDPSNSAA 61


>gi|86355861|ref|YP_467753.1| component of type IV pilus, pilin subunit protein [Rhizobium etli
          CFN 42]
 gi|86279963|gb|ABC89026.1| component of type IV pilus, pilin subunit protein [Rhizobium etli
          CFN 42]
          Length = 91

 Score = 60.4 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 34/51 (66%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           +   FL+DESGATAIEYGL+ +LI+V +I   T+LGGK+   F  +   +
Sbjct: 26 KLFSRFLKDESGATAIEYGLIAALISVALIAGATSLGGKIGDTFNNLSDRM 76


>gi|113866749|ref|YP_725238.1| flp pilus assembly protein, pilin Flp [Ralstonia eutropha H16]
 gi|113525525|emb|CAJ91870.1| flp pilus assembly protein, pilin Flp [Ralstonia eutropha H16]
          Length = 62

 Score = 60.4 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 37/56 (66%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          ++K F++DE G TAIEYGL+ +LIAVVII SVT +G  L   F+ I   +    PA
Sbjct: 7  MIKQFIRDEDGVTAIEYGLIAALIAVVIIVSVTLIGTNLNLIFKYIGDTLTNAVPA 62


>gi|85859143|ref|YP_461345.1| flp/Fap pilin component [Syntrophus aciditrophicus SB]
 gi|85722234|gb|ABC77177.1| flp/fap pilin component [Syntrophus aciditrophicus SB]
          Length = 56

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 35/52 (67%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M ++K FL+DE G TAIEYGL+ +LIAVVII +VT +G  L   F  +   +
Sbjct: 1  MELIKRFLKDEEGVTAIEYGLIAALIAVVIIGAVTLVGKGLDGTFREVAGEL 52


>gi|167584951|ref|ZP_02377339.1| hypothetical protein BuboB_06421 [Burkholderia ubonensis Bu]
          Length = 56

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/49 (48%), Positives = 32/49 (65%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +K F++DE G TAIEYGL+ +LIAVVII +V  +G  L   F  I   +
Sbjct: 8  LKQFVRDEDGVTAIEYGLIAALIAVVIIGAVRIVGQDLNGVFTTIGNEL 56


>gi|218665735|ref|YP_002427087.1| pilin, putative [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|218517948|gb|ACK78534.1| pilin, putative [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 79

 Score = 59.6 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/51 (50%), Positives = 31/51 (60%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          H V  F+++E G TAIEYGL+  LIAV II SV  LG KL   F  I   +
Sbjct: 26 HAVARFVREEEGVTAIEYGLIAGLIAVAIIISVQALGLKLASLFSYITGQL 76


>gi|186474098|ref|YP_001861440.1| Flp/Fap pilin component [Burkholderia phymatum STM815]
 gi|184196430|gb|ACC74394.1| Flp/Fap pilin component [Burkholderia phymatum STM815]
          Length = 58

 Score = 58.8 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 33/56 (58%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          + +K FL++E G +AIEYGLL  LI+V IIT+V  +G  L   F  I   +    P
Sbjct: 3  NAIKQFLREEDGVSAIEYGLLAGLISVAIITTVGLIGTNLNTVFSTIQTKLAAVKP 58


>gi|27379923|ref|NP_771452.1| fimbriae associated protein [Bradyrhizobium japonicum USDA 110]
 gi|27353076|dbj|BAC50077.1| bsl4812 [Bradyrhizobium japonicum USDA 110]
          Length = 69

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 35/51 (68%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          + +KNFL DE GATAIEYGL+ + IA+ +IT V  +G KL   F +I  ++
Sbjct: 18 NTLKNFLADERGATAIEYGLIAAGIALAVITVVNGMGSKLNTKFGSISTSL 68


>gi|171317109|ref|ZP_02906312.1| Flp/Fap pilin component [Burkholderia ambifaria MEX-5]
 gi|171097743|gb|EDT42570.1| Flp/Fap pilin component [Burkholderia ambifaria MEX-5]
          Length = 68

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 26/58 (44%), Positives = 37/58 (63%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          ++K FL++E G TAIEYGL+  LIAV I+  VT++GG L   F  +   + T + AA 
Sbjct: 4  LIKRFLKEEDGVTAIEYGLIAGLIAVAIVAGVTSIGGSLGTMFTNLGTCVTTRTAAAC 61


>gi|163757622|ref|ZP_02164711.1| component of type IV pilus, pilin subunit protein [Hoeflea
          phototrophica DFL-43]
 gi|162285124|gb|EDQ35406.1| component of type IV pilus, pilin subunit protein [Hoeflea
          phototrophica DFL-43]
          Length = 63

 Score = 58.4 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 33/54 (61%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          I   F++DESGATAIEYGL+ +LI+V +IT  TTLG  L   F  +   +    
Sbjct: 9  IFDRFVKDESGATAIEYGLIAALISVALITGATTLGNSLNNQFSGLATKLDNAG 62


>gi|94309598|ref|YP_582808.1| Flp/Fap pilin component [Cupriavidus metallidurans CH34]
 gi|93353450|gb|ABF07539.1| Flp/Fap pilin component; Putative pilus subunit protein
          [Cupriavidus metallidurans CH34]
          Length = 57

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 33/49 (67%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +K F++DE G TAIEYGL+ +LIAVVII SV  +G  L K F  I   +
Sbjct: 8  LKRFVRDEDGVTAIEYGLIAALIAVVIIASVQLVGQNLSKVFSLIAGEL 56


>gi|187479019|ref|YP_787043.1| pilin subunit [Bordetella avium 197N]
 gi|115423605|emb|CAJ50144.1| putative pilin subunit [Bordetella avium 197N]
          Length = 71

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 29/57 (50%), Positives = 36/57 (63%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          +  F +DE GATAIEYGL+  LIAVVII  +T LGG L   F  I+ A++     AS
Sbjct: 5  LSAFWRDEDGATAIEYGLIAGLIAVVIIAGLTALGGGLNGLFTRINNALINVGTPAS 61


>gi|325525573|gb|EGD03363.1| Flp/Fap pilin component [Burkholderia sp. TJI49]
          Length = 60

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (63%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          M  V+ F++DE G TAIEYGL+ +LIAV II +++T+G  LK  F  I   +   
Sbjct: 5  MLDVRRFVRDEDGVTAIEYGLIAALIAVGIIAALSTIGTDLKTVFSTIADDLNGA 59


>gi|221066742|ref|ZP_03542847.1| Flp/Fap pilin component [Comamonas testosteroni KF-1]
 gi|220711765|gb|EED67133.1| Flp/Fap pilin component [Comamonas testosteroni KF-1]
          Length = 61

 Score = 57.3 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 37/55 (67%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          + +K F +DE GATAIEYGL+  L+AV II ++T+LG +L   F+ + + +   +
Sbjct: 3  NFIKTFCKDEKGATAIEYGLIAGLVAVGIIFALTSLGTELSALFDRVSEKLKGAT 57


>gi|172060491|ref|YP_001808143.1| Flp/Fap pilin component [Burkholderia ambifaria MC40-6]
 gi|171993008|gb|ACB63927.1| Flp/Fap pilin component [Burkholderia ambifaria MC40-6]
          Length = 72

 Score = 56.9 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 33/55 (60%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          ++K FL++E G TAIEYGL+  LIAV II   +T+G  L   F  I   + + S 
Sbjct: 4  LIKRFLKEEDGVTAIEYGLIAGLIAVAIIAGASTVGSNLSSTFSKIGTCVSSPSA 58


>gi|299532816|ref|ZP_07046203.1| pilus subunit protein PilA [Comamonas testosteroni S44]
 gi|298719040|gb|EFI60010.1| pilus subunit protein PilA [Comamonas testosteroni S44]
          Length = 58

 Score = 56.9 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 37/59 (62%), Gaps = 1/59 (1%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          MK  I+K F +DE GATAIEYGL+  LIA  ++ + T LGG LK  FE I  A+   + 
Sbjct: 1  MKDQIIK-FWRDEEGATAIEYGLIAGLIAAGLVITFTDLGGALKTLFEKIKDALPQATS 58


>gi|197103822|ref|YP_002129199.1| pilus subunit protein PilA [Phenylobacterium zucineum HLK1]
 gi|196477242|gb|ACG76770.1| pilus subunit protein PilA [Phenylobacterium zucineum HLK1]
          Length = 58

 Score = 56.5 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 34/56 (60%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
            V  FL+DESGATAIEYGL+ +LIAVV++ ++  +G  L   F  I   + T   
Sbjct: 3  KFVTRFLKDESGATAIEYGLIAALIAVVLVGALQLVGTSLDTKFRDISTKVSTAGS 58


>gi|116249978|ref|YP_765816.1| pilus subunit protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254626|emb|CAK05700.1| putative pilus subunit protein [Rhizobium leguminosarum bv.
          viciae 3841]
          Length = 61

 Score = 56.5 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 38/59 (64%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
           +   FL+DESGATAIEYGL+ +LI+V +IT  TTLG ++   F  +   + T   A++
Sbjct: 3  KLFSRFLKDESGATAIEYGLIAALISVALITGATTLGDRIGTTFNNLGTKMNTGVTASN 61


>gi|90423865|ref|YP_532235.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB18]
 gi|90105879|gb|ABD87916.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB18]
          Length = 60

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 30/57 (52%), Positives = 39/57 (68%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
           +IV  FL+DESGATAIEYGL+ SLIA+ IIT++TT+G  L      +  A+ T  P
Sbjct: 2  NNIVMKFLKDESGATAIEYGLIASLIALAIITALTTIGSNLSTKLGEVGAALTTPEP 58


>gi|325291662|ref|YP_004277526.1| components of type IV pilus, pilin subunit [Agrobacterium sp.
          H13-3]
 gi|325059515|gb|ADY63206.1| components of type IV pilus, pilin subunit [Agrobacterium sp.
          H13-3]
          Length = 62

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 39/59 (66%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
           I   FL+DESGATAIEYGL+ +LI+V II   T +G +L   F A+ + I   +PAA+
Sbjct: 3  KIFTRFLKDESGATAIEYGLIAALISVAIIGGATAVGTRLNAFFTALSQRINANAPAAT 61


>gi|83859354|ref|ZP_00952875.1| hypothetical protein OA2633_13155 [Oceanicaulis alexandrii
          HTCC2633]
 gi|83852801|gb|EAP90654.1| hypothetical protein OA2633_13155 [Oceanicaulis alexandrii
          HTCC2633]
          Length = 69

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 41/57 (71%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          ++V  FL+DESGATAIEYGL+ +LIAVVIIT+VTTLG  L   F  +   + T + A
Sbjct: 3  NLVSRFLKDESGATAIEYGLIAALIAVVIITAVTTLGTNLSTTFTNVGTQLSTANSA 59


>gi|300021850|ref|YP_003754461.1| Flp/Fap pilin component [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523671|gb|ADJ22140.1| Flp/Fap pilin component [Hyphomicrobium denitrificans ATCC 51888]
          Length = 59

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/58 (44%), Positives = 36/58 (62%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          M+I   F+ DESGATAIEYGL+ +LI V ++T +  +G  L   F  +D A+  T  A
Sbjct: 1  MNIFSRFMNDESGATAIEYGLIAALIGVALVTILGQVGTSLSGTFTKVDDALKGTPAA 58


>gi|254293211|ref|YP_003059234.1| Flp/Fap pilin component [Hirschia baltica ATCC 49814]
 gi|254041742|gb|ACT58537.1| Flp/Fap pilin component [Hirschia baltica ATCC 49814]
          Length = 59

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 39/52 (75%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          +++K F +DESGATAIEYGL+ +LI+V II  V+T+G K    F+A+ + +V
Sbjct: 3  NLMKKFFKDESGATAIEYGLIAALISVAIIGGVSTVGTKTSATFDAVSEKLV 54


>gi|222087312|ref|YP_002545849.1| component of type IV pilus [Agrobacterium radiobacter K84]
 gi|221724760|gb|ACM27916.1| component of type IV pilus [Agrobacterium radiobacter K84]
          Length = 60

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 32/60 (53%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          M  V+ F  D +GAT +EYGL+ +L++V I++ +   GG L   F  +   +      A+
Sbjct: 1  MRSVRRFFNDRTGATVVEYGLIAALMSVAIVSGLGAFGGSLTNVFNLVSNTLNGPVTPAN 60


>gi|94309597|ref|YP_582807.1| Flp/Fap pilin component [Cupriavidus metallidurans CH34]
 gi|93353449|gb|ABF07538.1| Flp/Fap pilin component; Putative pilus subunit protein
          [Cupriavidus metallidurans CH34]
          Length = 57

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 32/50 (64%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          +K FL+D+ G TAIEYGL+ +LIAVVII SV  +G  L   F  I   + 
Sbjct: 8  LKAFLRDDDGVTAIEYGLIAALIAVVIIASVQLVGTNLSSIFNTIASELS 57


>gi|116671474|ref|YP_832407.1| Flp/Fap pilin component [Arthrobacter sp. FB24]
 gi|116611583|gb|ABK04307.1| Flp/Fap pilin component [Arthrobacter sp. FB24]
          Length = 101

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 26/58 (44%), Positives = 37/58 (63%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          +++     DE GATA+EYG++V+LIAVVII +V  LGG L   FE +   +   + AA
Sbjct: 28 NLMIRLRSDEKGATAVEYGIMVALIAVVIIVAVGLLGGTLTTMFEQVKCQVGGGAWAA 85


>gi|332716312|ref|YP_004443778.1| fimbriae associated protein [Agrobacterium sp. H13-3]
 gi|325062997|gb|ADY66687.1| fimbriae associated protein [Agrobacterium sp. H13-3]
          Length = 63

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 31/55 (56%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          +H    F +DE+GATA+EYGL+V +I+  II   T + G +   F+ +  A    
Sbjct: 9  LHCFIRFFKDENGATAVEYGLIVGVISAAIIGGATAISGNINTVFQFLADAFPNN 63


>gi|296156486|ref|ZP_06839324.1| Flp/Fap pilin component [Burkholderia sp. Ch1-1]
 gi|295893085|gb|EFG72865.1| Flp/Fap pilin component [Burkholderia sp. Ch1-1]
          Length = 62

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 36/58 (62%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          + ++ FL++E G  AIEYGLL  LIAV II ++TT+G KL   F  +  A+   +  A
Sbjct: 3  NTIQQFLREEDGVAAIEYGLLAGLIAVAIIATITTVGSKLNNVFTYVQNALNGVANPA 60


>gi|220923697|ref|YP_002498999.1| Flp/Fap pilin protein [Methylobacterium nodulans ORS 2060]
 gi|219948304|gb|ACL58696.1| Flp/Fap pilin component [Methylobacterium nodulans ORS 2060]
          Length = 54

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 30/51 (58%), Positives = 39/51 (76%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++   F++DESGATAIEYGL+  LIAVVIIT+VTT+G +L   F AI  A+
Sbjct: 3  NLFTRFVKDESGATAIEYGLIAGLIAVVIITAVTTIGTRLNTKFTAIGTAL 53


>gi|315121896|ref|YP_004062385.1| hypothetical protein CKC_00730 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
 gi|313495298|gb|ADR51897.1| hypothetical protein CKC_00730 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
          Length = 60

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 33/59 (55%), Positives = 44/59 (74%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          M+++I++ FLQDESGATAIEYGLL +L+AV II SVTTLG KL   F+ +  ++    P
Sbjct: 1  MRINIIRKFLQDESGATAIEYGLLAALVAVAIIASVTTLGTKLSATFKRVGDSLSDVKP 59


>gi|159184218|ref|NP_353257.2| components of type IV pilus, pilin subunit [Agrobacterium
          tumefaciens str. C58]
 gi|159139547|gb|AAK86042.2| components of type IV pilus, pilin subunit [Agrobacterium
          tumefaciens str. C58]
          Length = 63

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 30/57 (52%), Positives = 38/57 (66%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
           I   FL+DESGATAIEYGL+ +LI+V II   +TLGGKLK  F  I K+   +  +
Sbjct: 3  KIFARFLKDESGATAIEYGLIAALISVAIIGGASTLGGKLKDTFTFIGKSFTDSKAS 59


>gi|222084466|ref|YP_002542995.1| component of type IV pilus [Agrobacterium radiobacter K84]
 gi|221721914|gb|ACM25070.1| component of type IV pilus [Agrobacterium radiobacter K84]
          Length = 60

 Score = 55.0 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 35/57 (61%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
           +   FL+DESGATAIEYGL+ +LI+V II   TTLG  L   F  +   + T S A
Sbjct: 3  KLFSRFLKDESGATAIEYGLIAALISVAIIAGATTLGNTLSTTFNGVSDKMNTASVA 59


>gi|73542324|ref|YP_296844.1| Flp/Fap pilin component [Ralstonia eutropha JMP134]
 gi|72119737|gb|AAZ62000.1| Flp/Fap pilin component [Ralstonia eutropha JMP134]
          Length = 61

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 37/54 (68%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          ++K F++DE G TAIEYGL+ +LIAVVII SV  +G +L   F  I  ++ + +
Sbjct: 7  MLKQFIRDEEGVTAIEYGLIAALIAVVIIASVAIVGTQLNSTFSKIGTSLTSAN 60


>gi|187927693|ref|YP_001898180.1| Flp/Fap pilin component [Ralstonia pickettii 12J]
 gi|187724583|gb|ACD25748.1| Flp/Fap pilin component [Ralstonia pickettii 12J]
          Length = 55

 Score = 54.2 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 34/52 (65%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++ +K F +DE G TAIEYGL+ +LIAVVII SV  +G  L   F  I  A+
Sbjct: 4  LNALKQFARDEDGVTAIEYGLIAALIAVVIIASVKLVGQNLSTVFSNIAAAL 55


>gi|241207154|ref|YP_002978250.1| Flp/Fap pilin component [Rhizobium leguminosarum bv. trifolii
          WSM1325]
 gi|240861044|gb|ACS58711.1| Flp/Fap pilin component [Rhizobium leguminosarum bv. trifolii
          WSM1325]
          Length = 62

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 27/58 (46%), Positives = 39/58 (67%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
           +   FL+DESGATAIEYGL+ +LI+V +IT  T+LGGK+   F  +   + T+  A+
Sbjct: 3  KLFSRFLKDESGATAIEYGLIAALISVALITGATSLGGKIGNVFNGLSTKMDTSVTAS 60


>gi|190889878|ref|YP_001976420.1| pilus subunit protein [Rhizobium etli CIAT 652]
 gi|190695157|gb|ACE89242.1| pilus subunit protein [Rhizobium etli CIAT 652]
 gi|327194697|gb|EGE61543.1| pilus subunit protein [Rhizobium etli CNPAF512]
          Length = 61

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 38/59 (64%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
           +   FL+DESGATAIEYGL+ +LI+V +IT  T+LG K+   F  +   +   + AA+
Sbjct: 3  KLFSRFLKDESGATAIEYGLIAALISVALITGATSLGSKIGNTFNGLSTKMDGATSAAN 61


>gi|172065268|ref|YP_001815980.1| Flp/Fap pilin component [Burkholderia ambifaria MC40-6]
 gi|171997510|gb|ACB68427.1| Flp/Fap pilin component [Burkholderia ambifaria MC40-6]
          Length = 60

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 32/52 (61%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          V+ F+QDE G TAIEYGL+ +LIAV ++ ++T +G  L   F  I   +   
Sbjct: 8  VRGFVQDEQGVTAIEYGLIAALIAVTLVAALTLVGKDLNDVFNTIADDLNAA 59


>gi|218680428|ref|ZP_03528325.1| Flp/Fap pilin component [Rhizobium etli CIAT 894]
          Length = 62

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 27/58 (46%), Positives = 39/58 (67%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
           +   FL+DESGATAIEYGL+ +LI+V +IT  T+LGGK+   F  +   + T+  A+
Sbjct: 3  KLFSRFLKDESGATAIEYGLIAALISVALITGATSLGGKIGNTFNGLSTKMDTSVTAS 60


>gi|209551756|ref|YP_002283673.1| Flp/Fap pilin component [Rhizobium leguminosarum bv. trifolii
          WSM2304]
 gi|209537512|gb|ACI57447.1| Flp/Fap pilin component [Rhizobium leguminosarum bv. trifolii
          WSM2304]
          Length = 61

 Score = 54.2 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
           +   FL+DESGATAIEYGL+ +LI+V +IT  T LGGK+   F  +   +   + AA+
Sbjct: 3  KLFSRFLKDESGATAIEYGLIAALISVALITGATALGGKIGNTFNGLSTKMDGATSAAN 61


>gi|222084465|ref|YP_002542994.1| component of type IV pilus [Agrobacterium radiobacter K84]
 gi|221721913|gb|ACM25069.1| component of type IV pilus [Agrobacterium radiobacter K84]
          Length = 60

 Score = 53.8 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 29/57 (50%), Positives = 35/57 (61%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
           +   FL+DESGATAIEYGL+ +LI+V II   TTLG  L   F  I   + T S A
Sbjct: 3  KLFSRFLKDESGATAIEYGLIAALISVAIIAGATTLGNTLSTTFNGISTKMNTASVA 59


>gi|110632962|ref|YP_673170.1| Flp/Fap pilin component [Mesorhizobium sp. BNC1]
 gi|110283946|gb|ABG62005.1| Flp/Fap pilin component [Chelativorans sp. BNC1]
          Length = 57

 Score = 53.8 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 37/54 (68%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          +++  F ++ESGATAIEYGL+  LIAVVIIT+   +G  ++ +F+AI   +   
Sbjct: 3  NLLTRFAKNESGATAIEYGLIAGLIAVVIITAAGLVGTDVRDSFQAIANRLNPV 56


>gi|253996773|ref|YP_003048837.1| Flp/Fap pilin component [Methylotenera mobilis JLW8]
 gi|253983452|gb|ACT48310.1| Flp/Fap pilin component [Methylotenera mobilis JLW8]
          Length = 64

 Score = 53.8 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 36/55 (65%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          V+ F+ DE G TAIEY L+ +LIAVVII +VTT G ++ + F ++  A+     A
Sbjct: 8  VQRFINDEEGVTAIEYALIAALIAVVIIAAVTTTGTRVCETFRSVATALGGAPVA 62


>gi|295690802|ref|YP_003594495.1| Flp/Fap pilin component [Caulobacter segnis ATCC 21756]
 gi|295432705|gb|ADG11877.1| Flp/Fap pilin component [Caulobacter segnis ATCC 21756]
          Length = 59

 Score = 53.8 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 34/55 (61%), Positives = 40/55 (72%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
            V  FL+DESGATAIEYGL+V+LIAVVI+T+VTTLG KL  AF     AI   +
Sbjct: 3  KFVTRFLKDESGATAIEYGLIVALIAVVIVTAVTTLGTKLGTAFGKAGDAIEKPA 57


>gi|53723203|ref|YP_112188.1| pilus subunit protein [Burkholderia pseudomallei K96243]
 gi|76818831|ref|YP_336464.1| putative pilus subunit protein [Burkholderia pseudomallei 1710b]
 gi|52213617|emb|CAH39671.1| putative pilus subunit protein [Burkholderia pseudomallei K96243]
 gi|76583304|gb|ABA52778.1| putative pilus subunit protein [Burkholderia pseudomallei 1710b]
          Length = 72

 Score = 53.4 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
               +L+DES  +AIEY L+ SLIA+VII +V  +G  L+  F  +   +
Sbjct: 22 RAFMRWLRDESAVSAIEYALIASLIAIVIIGAVQVVGTNLQSVFSTVASDV 72


>gi|150398538|ref|YP_001329005.1| Flp/Fap pilin protein [Sinorhizobium medicae WSM419]
 gi|150030053|gb|ABR62170.1| Flp/Fap pilin component [Sinorhizobium medicae WSM419]
          Length = 61

 Score = 53.4 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 32/57 (56%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          I    ++DESGATAIEYGL+ +LI+V +I    TLGG L   F  +   +      A
Sbjct: 4  IFTRLMKDESGATAIEYGLIAALISVALIGGAQTLGGALDTQFNNLSTFLSVGEAPA 60


>gi|239831632|ref|ZP_04679961.1| component of type IV pilus, pilin subunit protein [Ochrobactrum
          intermedium LMG 3301]
 gi|239823899|gb|EEQ95467.1| component of type IV pilus, pilin subunit protein [Ochrobactrum
          intermedium LMG 3301]
          Length = 62

 Score = 53.4 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 32/55 (58%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
           ++  F ++ESGATAIEY L+  LIAVVII    TLGG +   F+ I   +    
Sbjct: 3  KLIARFRKNESGATAIEYALIAGLIAVVIIVGAQTLGGAINDKFDDIATKVENAG 57


>gi|83717974|ref|YP_440452.1| Flp/Fap pilin component superfamily protein [Burkholderia
          thailandensis E264]
 gi|167579109|ref|ZP_02371983.1| Flp/Fap pilin component superfamily protein [Burkholderia
          thailandensis TXDOH]
 gi|167617224|ref|ZP_02385855.1| Flp/Fap pilin component superfamily protein [Burkholderia
          thailandensis Bt4]
 gi|257141099|ref|ZP_05589361.1| Flp/Fap pilin component superfamily protein [Burkholderia
          thailandensis E264]
 gi|83651799|gb|ABC35863.1| Flp/Fap pilin component superfamily [Burkholderia thailandensis
          E264]
          Length = 72

 Score = 53.4 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 31/51 (60%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          H    +L+DES  +AIEY L+ SLIA+VII +V  +G  L+  F  +   +
Sbjct: 22 HAFMCWLRDESAVSAIEYALIASLIAIVIIGAVQVVGTNLQSVFSTVASDV 72


>gi|167841420|ref|ZP_02468104.1| putative pilus subunit protein [Burkholderia thailandensis
          MSMB43]
          Length = 56

 Score = 53.4 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 32/52 (61%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +   K F++DE G +AIEYGL+ +LIAVVII +V  +G  L   F  I   +
Sbjct: 5  IQYAKQFVRDEGGVSAIEYGLIAALIAVVIIGAVKAVGTDLNSVFTTIGSDL 56


>gi|91788407|ref|YP_549359.1| Flp/Fap pilin component [Polaromonas sp. JS666]
 gi|91697632|gb|ABE44461.1| Flp/Fap pilin component [Polaromonas sp. JS666]
          Length = 97

 Score = 53.4 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 35/61 (57%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          M+ H ++N L DE+G TAIEY LL SLI VVI+ +V  +G  +   +  +   +   +  
Sbjct: 33 MQHHPLENLLADEAGVTAIEYALLSSLIVVVILGAVGAVGSSVLSLWRLVSNCVTFAATG 92

Query: 61 A 61
          A
Sbjct: 93 A 93


>gi|152983319|ref|YP_001355010.1| pilus subunit protein PilA [Janthinobacterium sp. Marseille]
 gi|151283396|gb|ABR91806.1| pilus subunit protein PilA [Janthinobacterium sp. Marseille]
          Length = 59

 Score = 53.4 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 37/57 (64%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          + +  F++DE GATAIEYGL+V LI+VVI  SV  +GG L+  F  I  A+ T   +
Sbjct: 3  NQIIRFMKDEEGATAIEYGLIVGLISVVIAVSVGLIGGNLQTLFTNISNALATAVGS 59


>gi|167648155|ref|YP_001685818.1| Flp/Fap pilin component [Caulobacter sp. K31]
 gi|167350585|gb|ABZ73320.1| Flp/Fap pilin component [Caulobacter sp. K31]
          Length = 61

 Score = 53.4 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 34/59 (57%), Positives = 42/59 (71%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
            V  FL DESGATAIEYGL+V+LIAVVI T VTTLGG LK  F+ +D ++   +  A+
Sbjct: 3  KFVTRFLNDESGATAIEYGLIVALIAVVIATVVTTLGGSLKTTFKNVDDSVKAANGPAA 61


>gi|115361028|ref|YP_778165.1| Flp/Fap pilin component [Burkholderia ambifaria AMMD]
 gi|115286356|gb|ABI91831.1| Flp/Fap pilin component [Burkholderia ambifaria AMMD]
          Length = 60

 Score = 53.4 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 33/52 (63%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          V+ F+QDE G TAIEYGL+ +LIAV ++ ++T +G  LK  F  I   +   
Sbjct: 8  VRGFVQDEQGVTAIEYGLIAALIAVGLVAALTAVGTDLKTVFNTIADDLNAA 59


>gi|107028254|ref|YP_625349.1| Flp/Fap pilin component [Burkholderia cenocepacia AU 1054]
 gi|116686247|ref|YP_839494.1| Flp/Fap pilin component [Burkholderia cenocepacia HI2424]
 gi|170734874|ref|YP_001773988.1| Flp/Fap pilin component [Burkholderia cenocepacia MC0-3]
 gi|105897418|gb|ABF80376.1| Flp/Fap pilin component [Burkholderia cenocepacia AU 1054]
 gi|116651962|gb|ABK12601.1| Flp/Fap pilin component [Burkholderia cenocepacia HI2424]
 gi|169820912|gb|ACA95493.1| Flp/Fap pilin component [Burkholderia cenocepacia MC0-3]
          Length = 63

 Score = 53.4 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 35/55 (63%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          +  F++D+ G TAIEYGL+ +LIA+ I+ ++TT+G  LK  F  +   + +   A
Sbjct: 8  IAWFVEDQDGVTAIEYGLIAALIAIGIVGALTTVGTDLKTVFNTVADDLDSVVAA 62


>gi|254293165|ref|YP_003059188.1| Flp/Fap pilin component [Hirschia baltica ATCC 49814]
 gi|254041696|gb|ACT58491.1| Flp/Fap pilin component [Hirschia baltica ATCC 49814]
          Length = 67

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 34/49 (69%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKA 53
          +++ F  D+SGATAIEYGL+ SLIAV IITSV  +G +  K F+ +   
Sbjct: 9  LLQKFCADKSGATAIEYGLIASLIAVAIITSVEVVGTENSKNFDNVSTK 57


>gi|209884566|ref|YP_002288423.1| hypothetical protein OCAR_5426 [Oligotropha carboxidovorans OM5]
 gi|209872762|gb|ACI92558.1| conserved domain protein [Oligotropha carboxidovorans OM5]
          Length = 53

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 35/52 (67%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M  +K FL+D+SGAT+IEY ++ + IAVVII +V  LG  L   +E I  ++
Sbjct: 1  MKTLKRFLRDQSGATSIEYAMIAAGIAVVIIVAVNNLGSALNGKYEMIRTSV 52


>gi|89899599|ref|YP_522070.1| Flp/Fap pilin component [Rhodoferax ferrireducens T118]
 gi|89344336|gb|ABD68539.1| Flp/Fap pilin component [Rhodoferax ferrireducens T118]
          Length = 58

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 39/55 (70%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          +H ++ F+++E G TAIEYGL+ +LIAVVII SVT +G +L   F  +  A++ +
Sbjct: 4  VHFIQKFVREEEGVTAIEYGLIAALIAVVIIASVTIVGTQLAVVFGKVSDALIGS 58


>gi|255613581|ref|XP_002539522.1| conserved hypothetical protein [Ricinus communis]
 gi|223505367|gb|EEF22861.1| conserved hypothetical protein [Ricinus communis]
          Length = 243

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 36/52 (69%)

Query: 3   MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           +++V  F++DESGATAIEYGL+ + IA+ IIT V  LG  L   F +I  ++
Sbjct: 191 VNLVARFVKDESGATAIEYGLIAAGIALAIITVVNNLGTTLNTKFTSISTSL 242


>gi|114568967|ref|YP_755647.1| Flp/Fap pilin component [Maricaulis maris MCS10]
 gi|114339429|gb|ABI64709.1| Flp/Fap pilin component [Maricaulis maris MCS10]
          Length = 52

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 27/52 (51%), Positives = 36/52 (69%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M ++  F +DESGATAIEYGL+ +LIAVVII +VT LG  +   F  +  A+
Sbjct: 1  MKMISRFFKDESGATAIEYGLIAALIAVVIIGAVTALGTGVSDNFNTVAGAL 52


>gi|146342483|ref|YP_001207531.1| putative Flp/Fap pilin component (modular protein)
          [Bradyrhizobium sp. ORS278]
 gi|146195289|emb|CAL79314.1| Putative Flp/Fap pilin component (modular protein)
          [Bradyrhizobium sp. ORS278]
          Length = 54

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 35/50 (70%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           V  FL+DESGATAIEYGL+ + I++ II +V  LG  L   F++I+ ++
Sbjct: 4  FVLKFLRDESGATAIEYGLIAAGISLAIIAAVNGLGTSLSSKFDSINSSL 53


>gi|15963891|ref|NP_384244.1| putative pilin subunit protein [Sinorhizobium meliloti 1021]
 gi|307315788|ref|ZP_07595302.1| Flp/Fap pilin component [Sinorhizobium meliloti BL225C]
 gi|307320423|ref|ZP_07599840.1| Flp/Fap pilin component [Sinorhizobium meliloti AK83]
 gi|15073066|emb|CAC41525.1| Putative pilin subunit [Sinorhizobium meliloti 1021]
 gi|306893989|gb|EFN24758.1| Flp/Fap pilin component [Sinorhizobium meliloti AK83]
 gi|306898556|gb|EFN29229.1| Flp/Fap pilin component [Sinorhizobium meliloti BL225C]
          Length = 60

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 32/56 (57%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          I    ++DESGATAIEYGL+ +LI+V +I    TLGG L   F  +   +     A
Sbjct: 4  IFARLMKDESGATAIEYGLIAALISVALIGGAQTLGGALSTQFTNLGGYLNVEPNA 59


>gi|27376661|ref|NP_768190.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
 gi|27349802|dbj|BAC46815.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
          Length = 53

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 35/52 (67%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M  + +FL+DESGATAIEYGL+ + I++ II  V  LG KL   F +I  ++
Sbjct: 1  MKTLVHFLRDESGATAIEYGLIAAGISLAIIAVVNGLGTKLNTKFASISSSL 52


>gi|85713501|ref|ZP_01044491.1| Flp/Fap pilin component [Nitrobacter sp. Nb-311A]
 gi|85699405|gb|EAQ37272.1| Flp/Fap pilin component [Nitrobacter sp. Nb-311A]
          Length = 56

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 28/54 (51%), Positives = 37/54 (68%), Gaps = 1/54 (1%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          MK ++   FL+DESGATAIEYGL+ + IAV IIT+V TLG  L   F+ +   +
Sbjct: 1  MK-NLFSRFLKDESGATAIEYGLIAAGIAVAIITAVNTLGTSLNTTFQNVQDDL 53


>gi|224824209|ref|ZP_03697317.1| Flp/Fap pilin component [Lutiella nitroferrum 2002]
 gi|224603628|gb|EEG09803.1| Flp/Fap pilin component [Lutiella nitroferrum 2002]
          Length = 66

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 29/52 (55%), Positives = 35/52 (67%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          +K F QDE G TAIEYGL+ +LIAVVIITSV  +G +L   F  I  A+ T 
Sbjct: 14 LKQFTQDEEGVTAIEYGLIAALIAVVIITSVQAVGNQLSLVFNNIATALNTA 65


>gi|163757623|ref|ZP_02164712.1| component of type IV pilus, pilin subunit protein [Hoeflea
           phototrophica DFL-43]
 gi|162285125|gb|EDQ35407.1| component of type IV pilus, pilin subunit protein [Hoeflea
           phototrophica DFL-43]
          Length = 120

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 32/58 (55%)

Query: 3   MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
           +   + F +D++G TAIEYGL+ +LI+V II    TLG  +   F+ +   +     A
Sbjct: 61  LKFFECFAKDKTGTTAIEYGLIGTLISVSIIAGAMTLGNTVGNQFQGLADKMNNAQNA 118


>gi|51245391|ref|YP_065275.1| pilus assembly protein pilin subunit [Desulfotalea psychrophila
          LSv54]
 gi|50876428|emb|CAG36268.1| related to pilus assembly protein pilin subunit [Desulfotalea
          psychrophila LSv54]
          Length = 61

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 38/52 (73%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +++++ F++DESG TAIEY L+ SLIA+ II +VT +GG L   F+ I  A+
Sbjct: 5  LNMIQTFVKDESGVTAIEYALIASLIAIGIIAAVTIIGGVLNTTFQRIATAL 56


>gi|325673443|ref|ZP_08153134.1| hypothetical protein HMPREF0724_10916 [Rhodococcus equi ATCC
          33707]
 gi|325555464|gb|EGD25135.1| hypothetical protein HMPREF0724_10916 [Rhodococcus equi ATCC
          33707]
          Length = 67

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 34/53 (64%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKA 53
          M + +     +D+ GATA+EYGL+V+ IA+VII +V   GG+L   F+  + A
Sbjct: 11 MGLDVKDRLTRDDRGATAVEYGLMVAGIAMVIIIAVFAFGGRLSTLFQNFNFA 63


>gi|260892921|ref|YP_003239018.1| Flp/Fap pilin component [Ammonifex degensii KC4]
 gi|260865062|gb|ACX52168.1| Flp/Fap pilin component [Ammonifex degensii KC4]
          Length = 57

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 31/52 (59%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +   +DE G    EYGL+++LIA+V+I ++T LG  ++  F+ +   +  T 
Sbjct: 6  RELWRDEEGQGMAEYGLILALIAIVVIIALTALGTSIRDKFQKVSDELNKTQ 57


>gi|221070071|ref|ZP_03546176.1| Flp/Fap pilin component [Comamonas testosteroni KF-1]
 gi|220715094|gb|EED70462.1| Flp/Fap pilin component [Comamonas testosteroni KF-1]
          Length = 54

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 28/55 (50%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          MK  I+K F +DE GATAIEYGL+  LIA VI+ +VT LG ++      I  AI 
Sbjct: 1  MKDQIIK-FWRDEEGATAIEYGLIAGLIAAVIVGTVTLLGTRINTLLNTILTAIS 54


>gi|56477533|ref|YP_159122.1| Flp/Fap pilin component [Aromatoleum aromaticum EbN1]
 gi|56313576|emb|CAI08221.1| INTERPRO: probable Flp/Fap pilin component [Aromatoleum
          aromaticum EbN1]
          Length = 56

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 33/55 (60%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          + ++K F++D+ G TAIEYGLL SLIA+ II     LG KL   F  I   +V  
Sbjct: 2  LEMMKQFVRDDEGVTAIEYGLLASLIALAIIVGAGALGTKLNTMFNFIAGKLVAA 56


>gi|312139252|ref|YP_004006588.1| flp/fap pilin component [Rhodococcus equi 103S]
 gi|311888591|emb|CBH47903.1| putative Flp/Fap pilin component [Rhodococcus equi 103S]
          Length = 68

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 32/51 (62%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAID 51
          M + +     +D+ GATA+EYGL+V+ IA+VII +V   G K+   F+  +
Sbjct: 11 MGLDVKDRLTRDDRGATAVEYGLMVAGIAMVIIVAVFAFGDKITDLFDGFN 61


>gi|218461609|ref|ZP_03501700.1| pilus subunit protein [Rhizobium etli Kim 5]
          Length = 61

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 34/54 (62%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
           +   FL+DESGATAIEYGL+ +LI+V +IT  T+LG K+   F  +   +   
Sbjct: 3  KLFSRFLKDESGATAIEYGLIAALISVALITGATSLGTKIGNVFTGLSTKMDNA 56


>gi|188592028|ref|YP_001796626.1| flp/fap pilin component [Cupriavidus taiwanensis LMG 19424]
 gi|170938402|emb|CAP63389.1| putative Flp/Fap pilin component [Cupriavidus taiwanensis LMG
          19424]
          Length = 58

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 32/53 (60%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
           ++  F++DE GATAIEYGL+V LIA+ +      LG +L  ++E +   I  
Sbjct: 3  RLIARFIKDERGATAIEYGLIVGLIALGLTVGAGKLGDELNLSYERLSVKISG 55


>gi|116878542|ref|YP_842256.1| hypothetical protein Pcar_3316 [Pelobacter carbinolicus DSM 2380]
 gi|114843178|gb|ABI81935.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380]
          Length = 175

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 1   MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
           M M   +  ++ E GATA EY ++++LI +V I ++T LG K+   F+ I +++   S
Sbjct: 119 MLMKC-RELIRSEEGATATEYAVMLALIIIVAIGAITFLGKKVNNTFQNIAESLPDPS 175


>gi|116694136|ref|YP_728347.1| fimbriae associated protein [Ralstonia eutropha H16]
 gi|113528635|emb|CAJ94982.1| fimbriae associated protein [Ralstonia eutropha H16]
          Length = 58

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 32/53 (60%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
           ++  F++DE GATAIEYGL+V L+A+ I      LG +L  +F+ +   +  
Sbjct: 3  RLIARFIKDERGATAIEYGLIVGLVALAIAVGAGKLGTELNASFDRLSVTVSG 55


>gi|300697746|ref|YP_003748407.1| Flp/Fap pilin component [Ralstonia solanacearum CFBP2957]
 gi|299074470|emb|CBJ54020.1| putative Flp/Fap pilin component [Ralstonia solanacearum
          CFBP2957]
          Length = 58

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 29/55 (52%), Positives = 38/55 (69%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          H +  FL+DE GATAIEYGL+  LIA VI  +VTTLG ++K AF  +  AI  ++
Sbjct: 3  HAILKFLRDEQGATAIEYGLIAGLIAAVIAGTVTTLGTEIKTAFGNVCTAIKGSA 57


>gi|17937222|ref|NP_534011.1| fimbriae associated protein [Agrobacterium tumefaciens str. C58]
 gi|17741918|gb|AAL44327.1| fimbriae associated protein [Agrobacterium tumefaciens str. C58]
          Length = 71

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 30/52 (57%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +H   NF ++E+GATAIEYGL+  +I+  +I  +  +   +   F+ I  A 
Sbjct: 17 LHFFINFCKNENGATAIEYGLIAGIISAALIAGLGNISSGINAVFQFIVDAF 68


>gi|198284419|ref|YP_002220740.1| Flp/Fap pilin component [Acidithiobacillus ferrooxidans ATCC
          53993]
 gi|198248940|gb|ACH84533.1| Flp/Fap pilin component [Acidithiobacillus ferrooxidans ATCC
          53993]
          Length = 69

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 33/59 (55%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          H V  F+++E G TAIEYGL+  LIAV II SV  LG KL   F  I   +     A S
Sbjct: 6  HAVARFVREEEGVTAIEYGLIAGLIAVAIIISVQALGLKLASLFSYITGQLKVPYRAMS 64


>gi|170701158|ref|ZP_02892131.1| Flp/Fap pilin component [Burkholderia ambifaria IOP40-10]
 gi|170133939|gb|EDT02294.1| Flp/Fap pilin component [Burkholderia ambifaria IOP40-10]
          Length = 60

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 33/52 (63%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          V+ F+QDE G TAIEYGL+ +LIAV ++ ++T +G  LK  F  I   +   
Sbjct: 8  VRGFVQDEQGVTAIEYGLIAALIAVGLVAALTAVGTDLKTVFNTIADDLNAA 59


>gi|147677780|ref|YP_001211995.1| flp pilus assembly protein, pilin Flp, pilin Flp [Pelotomaculum
          thermopropionicum SI]
 gi|146273877|dbj|BAF59626.1| flp pilus assembly protein, pilin Flp, pilin Flp [Pelotomaculum
          thermopropionicum SI]
          Length = 59

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 34/53 (64%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          ++K  L++E+G    EYGL+++LIAVV+I ++TTLG  +K   E +   I   
Sbjct: 4  LIKRLLREENGQGMAEYGLILALIAVVVIAALTTLGTNIKTKLETVGNKIGEN 56


>gi|17549313|ref|NP_522653.1| putative pilin protein [Ralstonia solanacearum GMI1000]
 gi|17431565|emb|CAD18243.1| putative pilin protein [Ralstonia solanacearum GMI1000]
          Length = 58

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 30/55 (54%), Positives = 38/55 (69%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          H +  FL+DE GATAIEYGLL  LIA VI  +VTTLG ++K AF  +  AI  ++
Sbjct: 3  HAILQFLRDEQGATAIEYGLLAGLIAAVIAGTVTTLGTEIKTAFGNVCTAIKGSA 57


>gi|187927692|ref|YP_001898179.1| Flp/Fap pilin component [Ralstonia pickettii 12J]
 gi|187724582|gb|ACD25747.1| Flp/Fap pilin component [Ralstonia pickettii 12J]
          Length = 56

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 32/50 (64%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +++ FL DE   TAIEYGL+ +LIAVVII SV  +G  L   F  I  A+
Sbjct: 7  LLQQFLYDEQAVTAIEYGLIAALIAVVIIASVQLVGTNLSTVFSNIAAAL 56


>gi|329890999|ref|ZP_08269342.1| flp/Fap pilin component family protein [Brevundimonas diminuta
          ATCC 11568]
 gi|328846300|gb|EGF95864.1| flp/Fap pilin component family protein [Brevundimonas diminuta
          ATCC 11568]
          Length = 59

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 35/57 (61%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          + +  F +DESGATAIEYGL+ +L+AV+II  +  L   L+ AF+ +   +     A
Sbjct: 3  NFITRFAKDESGATAIEYGLIAALMAVIIIAGIGFLKPGLEGAFKNVGGQMSKVPAA 59


>gi|83747921|ref|ZP_00944953.1| putative pilin protein [Ralstonia solanacearum UW551]
 gi|207724793|ref|YP_002255190.1| pilin protein [Ralstonia solanacearum MolK2]
 gi|207739462|ref|YP_002257855.1| pilin protein [Ralstonia solanacearum IPO1609]
 gi|83725454|gb|EAP72600.1| putative pilin protein [Ralstonia solanacearum UW551]
 gi|206590018|emb|CAQ36979.1| pilin protein [Ralstonia solanacearum MolK2]
 gi|206592838|emb|CAQ59744.1| pilin protein [Ralstonia solanacearum IPO1609]
          Length = 58

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 29/55 (52%), Positives = 38/55 (69%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          H +  FL+DE GATAIEYGL+  LIA VI  +VTTLG ++K AF  +  AI  ++
Sbjct: 3  HAILKFLRDEQGATAIEYGLIAGLIAAVIAGTVTTLGTEIKTAFGNVCSAIKGSA 57


>gi|307943139|ref|ZP_07658484.1| Flp/Fap pilin component [Roseibium sp. TrichSKD4]
 gi|307773935|gb|EFO33151.1| Flp/Fap pilin component [Roseibium sp. TrichSKD4]
          Length = 60

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 34/58 (58%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          +++  F +DESGATAIEYGL+  LI++ II  VT +G  L   F  I   +     A+
Sbjct: 3  NVISRFAKDESGATAIEYGLIAGLISITIIGVVTAVGTNLNSLFTTISSTLAGVGSAS 60


>gi|254502369|ref|ZP_05114520.1| Flp/Fap pilin component superfamily [Labrenzia alexandrii DFL-11]
 gi|222438440|gb|EEE45119.1| Flp/Fap pilin component superfamily [Labrenzia alexandrii DFL-11]
          Length = 58

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 34/54 (62%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +   F +DESGATAIEYGL+  L++V II  + T+G  L   F  ID A+ T S
Sbjct: 4  LFSRFAKDESGATAIEYGLIAGLLSVAIIGILVTMGDSLTSIFSQIDSALKTGS 57


>gi|83721334|ref|YP_443063.1| pilin [Burkholderia thailandensis E264]
 gi|167582067|ref|ZP_02374941.1| pilin, putative [Burkholderia thailandensis TXDOH]
 gi|167620228|ref|ZP_02388859.1| pilin, putative [Burkholderia thailandensis Bt4]
 gi|167836799|ref|ZP_02463682.1| pilin, putative [Burkholderia thailandensis MSMB43]
 gi|257139293|ref|ZP_05587555.1| pilin, putative [Burkholderia thailandensis E264]
 gi|83655159|gb|ABC39222.1| pilin, putative [Burkholderia thailandensis E264]
          Length = 65

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 31/54 (57%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
           ++  F ++E+G TAIEYGL+  LIAV I T+V T+G  L   F  I   +   
Sbjct: 12 QLMHRFFKEEAGVTAIEYGLIAGLIAVAIATTVGTVGTDLSSLFSTIASKLPAA 65


>gi|323137422|ref|ZP_08072500.1| Flp/Fap pilin component [Methylocystis sp. ATCC 49242]
 gi|322397409|gb|EFX99932.1| Flp/Fap pilin component [Methylocystis sp. ATCC 49242]
          Length = 54

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 30/53 (56%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
            I   F++DESGATAIEYGL+ SLI V II  V  LG  L   F  +   + 
Sbjct: 2  NKIFSRFVKDESGATAIEYGLIASLIGVAIIAGVRALGTNLSGTFAKVSGNLA 54


>gi|300694115|ref|YP_003750088.1| flp/fap pilin component [Ralstonia solanacearum PSI07]
 gi|299076152|emb|CBJ35465.1| putative Flp/Fap pilin component [Ralstonia solanacearum PSI07]
          Length = 58

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 34/55 (61%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          H +  FL+DE GATAIEYGL+  LIA VI  +V  LG ++   F  +  A+  ++
Sbjct: 3  HAILQFLRDEQGATAIEYGLIAGLIAAVIAVAVGKLGTEINTVFGTVCTAVKGSA 57


>gi|134291862|ref|YP_001115631.1| Flp/Fap pilin component [Burkholderia vietnamiensis G4]
 gi|134135051|gb|ABO59376.1| Flp/Fap pilin component [Burkholderia vietnamiensis G4]
          Length = 60

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 33/52 (63%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          V+ F+QDE G TAIEYGL+ +LIAV ++ ++T +G  LK  F  I   +   
Sbjct: 8  VRGFVQDEQGVTAIEYGLIAALIAVGLVAALTLVGNDLKTVFNTIADDLNAA 59


>gi|222147185|ref|YP_002548142.1| component of type 4 pilus pilin subunit protein [Agrobacterium
          vitis S4]
 gi|221734175|gb|ACM35138.1| component of type 4 pilus pilin subunit protein [Agrobacterium
          vitis S4]
          Length = 61

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 34/57 (59%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
           I   F++DESGATAIEYGL+ +LI+V ++   TTLG  +   F  +   +   + A
Sbjct: 3  KIFSRFMKDESGATAIEYGLIAALISVALVAGATTLGTSIGNTFNNLTTQMNKGADA 59


>gi|299132284|ref|ZP_07025479.1| Flp/Fap pilin component [Afipia sp. 1NLS2]
 gi|298592421|gb|EFI52621.1| Flp/Fap pilin component [Afipia sp. 1NLS2]
          Length = 56

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 35/53 (66%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          +++  F++DESGATAIEY L+ + I+VVII +V TLG  L   F  I+  +  
Sbjct: 3  NLLARFVKDESGATAIEYALIAAGISVVIIGAVQTLGSTLNGVFTTINGKLTA 55


>gi|170740624|ref|YP_001769279.1| Flp/Fap pilin component [Methylobacterium sp. 4-46]
 gi|168194898|gb|ACA16845.1| Flp/Fap pilin component [Methylobacterium sp. 4-46]
          Length = 54

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 35/50 (70%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++K F +DESGATAIEYGLL +LIAV +IT+  ++G  L   F+ +   +
Sbjct: 4  MLKRFAKDESGATAIEYGLLATLIAVALITAAQSVGSNLNSMFQKVAGNL 53


>gi|315497469|ref|YP_004086273.1| flp/fap pilin component [Asticcacaulis excentricus CB 48]
 gi|315415481|gb|ADU12122.1| Flp/Fap pilin component [Asticcacaulis excentricus CB 48]
          Length = 57

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 38/55 (69%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +++KNF  DESGATAIEYGL+ +LIAV +IT++  LG  L   F+ +   +V  S
Sbjct: 3  NLIKNFANDESGATAIEYGLIAALIAVALITTLGALGKNLDATFKGVSDKLVQAS 57


>gi|78060319|ref|YP_366894.1| Flp/Fap pilin component [Burkholderia sp. 383]
 gi|77964869|gb|ABB06250.1| Flp/Fap pilin component [Burkholderia sp. 383]
          Length = 63

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 33/54 (61%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
            F++DE G TAIEYGL+ +LIAV II +++T+G  LK  F  I   + +    
Sbjct: 9  SRFVRDEDGVTAIEYGLIAALIAVGIILALSTIGKDLKTVFSTIAADLDSAVAG 62


>gi|170701748|ref|ZP_02892684.1| Flp/Fap pilin component [Burkholderia ambifaria IOP40-10]
 gi|170133331|gb|EDT01723.1| Flp/Fap pilin component [Burkholderia ambifaria IOP40-10]
          Length = 54

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 36/50 (72%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++K FL++E G TAIEYGL+  LIA +IITSVTT+G K+   F  I  ++
Sbjct: 4  LIKRFLKEEDGVTAIEYGLIAGLIAALIITSVTTIGTKISALFSTIASSL 53


>gi|39933982|ref|NP_946258.1| Flp/Fap pilin protein [Rhodopseudomonas palustris CGA009]
 gi|39647829|emb|CAE26349.1| Flp/Fap pilin component [Rhodopseudomonas palustris CGA009]
          Length = 57

 Score = 51.1 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (63%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
           +V  FL +ESGATAIEYGL+ + I++ IIT+VT LG KL   F ++   +    
Sbjct: 3  RLVLKFLSEESGATAIEYGLIAAGISLAIITAVTGLGDKLNSTFTSVKDGLTGGG 57


>gi|56477532|ref|YP_159121.1| pilus assembly protein, pilin component [Aromatoleum aromaticum
          EbN1]
 gi|56313575|emb|CAI08220.1| pilus assembly protein, pilin component [Aromatoleum aromaticum
          EbN1]
          Length = 56

 Score = 51.1 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 32/55 (58%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          + +++ F+ DE G TAIEYGL+ SL+A+ II     LG KL   F  I   +V  
Sbjct: 2  LKMLQQFIVDEDGVTAIEYGLIASLVALAIIVGAGALGTKLNDVFNFIAGKLVAA 56


>gi|329847249|ref|ZP_08262277.1| flp/Fap pilin component family protein [Asticcacaulis
          biprosthecum C19]
 gi|328842312|gb|EGF91881.1| flp/Fap pilin component family protein [Asticcacaulis
          biprosthecum C19]
          Length = 59

 Score = 51.1 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 34/57 (59%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
               F +DESGATAIEYGL+ +LIAV +I+ + TL G L   F+ +   +   + A
Sbjct: 3  KFFNRFAKDESGATAIEYGLIAALIAVALISILGTLSGSLTGTFQRVSDDLTAANGA 59


>gi|192289401|ref|YP_001990006.1| Flp/Fap pilin component [Rhodopseudomonas palustris TIE-1]
 gi|192283150|gb|ACE99530.1| Flp/Fap pilin component [Rhodopseudomonas palustris TIE-1]
          Length = 56

 Score = 51.1 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 35/54 (64%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
           +V  FL +ESGATAIEYGL+ + I++ IIT+VT LG KL   F ++   +   
Sbjct: 3  RLVLKFLSEESGATAIEYGLIAAGISLAIITAVTGLGDKLNSTFTSVKDGLTGG 56


>gi|186474099|ref|YP_001861441.1| Flp/Fap pilin component [Burkholderia phymatum STM815]
 gi|184196431|gb|ACC74395.1| Flp/Fap pilin component [Burkholderia phymatum STM815]
          Length = 58

 Score = 51.1 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 33/55 (60%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          + ++ FL +E G +AIEYGLL  LIAV IIT+V  +GG L   F  I   +   +
Sbjct: 3  NAIQQFLGEEDGVSAIEYGLLAGLIAVAIITTVGLVGGSLNSVFNTIQTKLAAIT 57


>gi|227818618|ref|YP_002822589.1| PilA2 pilus assembly protein [Sinorhizobium fredii NGR234]
 gi|36958874|gb|AAQ87299.1| pilA [Sinorhizobium fredii NGR234]
 gi|227337617|gb|ACP21836.1| PilA2 pilus assembly protein [Sinorhizobium fredii NGR234]
          Length = 53

 Score = 51.1 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 37/51 (72%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +++  F+++ESGATAIEYGL+  LIAVVII++V  +G  +   F AI  A+
Sbjct: 3  NLLVRFVRNESGATAIEYGLIAGLIAVVIISAVQLVGTDIGAKFTAISTAL 53


>gi|76811746|ref|YP_333336.1| putative fimbriae assembly-like protein [Burkholderia
          pseudomallei 1710b]
 gi|126441443|ref|YP_001058803.1| pilin family protein [Burkholderia pseudomallei 668]
 gi|126452952|ref|YP_001066054.1| pilin family protein [Burkholderia pseudomallei 1106a]
 gi|134282265|ref|ZP_01768970.1| pilin, flp/fap family [Burkholderia pseudomallei 305]
 gi|167719791|ref|ZP_02403027.1| pilin, flp/fap family protein [Burkholderia pseudomallei DM98]
 gi|167738792|ref|ZP_02411566.1| pilin, flp/fap family protein [Burkholderia pseudomallei 14]
 gi|167824391|ref|ZP_02455862.1| pilin, flp/fap family protein [Burkholderia pseudomallei 9]
 gi|167845922|ref|ZP_02471430.1| pilin, flp/fap family protein [Burkholderia pseudomallei B7210]
 gi|167894498|ref|ZP_02481900.1| pilin, flp/fap family protein [Burkholderia pseudomallei 7894]
 gi|167902903|ref|ZP_02490108.1| pilin, flp/fap family protein [Burkholderia pseudomallei NCTC
          13177]
 gi|167911141|ref|ZP_02498232.1| pilin, flp/fap family protein [Burkholderia pseudomallei 112]
 gi|217423683|ref|ZP_03455184.1| pilin, flp/fap family [Burkholderia pseudomallei 576]
 gi|226199682|ref|ZP_03795235.1| pilin, flp/fap family [Burkholderia pseudomallei Pakistan 9]
 gi|237812063|ref|YP_002896514.1| hypothetical protein GBP346_A1805 [Burkholderia pseudomallei
          MSHR346]
 gi|242317113|ref|ZP_04816129.1| pilin, flp/fap family [Burkholderia pseudomallei 1106b]
 gi|254179961|ref|ZP_04886560.1| pilin, flp/fap family [Burkholderia pseudomallei 1655]
 gi|254188629|ref|ZP_04895140.1| pilin, flp/fap family [Burkholderia pseudomallei Pasteur 52237]
 gi|254197897|ref|ZP_04904319.1| pilin, flp/fap family [Burkholderia pseudomallei S13]
 gi|254259877|ref|ZP_04950931.1| pilin, flp/fap family [Burkholderia pseudomallei 1710a]
 gi|254297797|ref|ZP_04965250.1| pilin, flp/fap family [Burkholderia pseudomallei 406e]
 gi|76581199|gb|ABA50674.1| putative fimbriae assembly related protein [Burkholderia
          pseudomallei 1710b]
 gi|126220936|gb|ABN84442.1| pilin, flp/fap family [Burkholderia pseudomallei 668]
 gi|126226594|gb|ABN90134.1| pilin, flp/fap family [Burkholderia pseudomallei 1106a]
 gi|134246303|gb|EBA46392.1| pilin, flp/fap family [Burkholderia pseudomallei 305]
 gi|157806937|gb|EDO84107.1| pilin, flp/fap family [Burkholderia pseudomallei 406e]
 gi|157936308|gb|EDO91978.1| pilin, flp/fap family [Burkholderia pseudomallei Pasteur 52237]
 gi|169654638|gb|EDS87331.1| pilin, flp/fap family [Burkholderia pseudomallei S13]
 gi|184210501|gb|EDU07544.1| pilin, flp/fap family [Burkholderia pseudomallei 1655]
 gi|217393541|gb|EEC33562.1| pilin, flp/fap family [Burkholderia pseudomallei 576]
 gi|225928268|gb|EEH24302.1| pilin, flp/fap family [Burkholderia pseudomallei Pakistan 9]
 gi|237504579|gb|ACQ96897.1| conserved domain protein [Burkholderia pseudomallei MSHR346]
 gi|242140352|gb|EES26754.1| pilin, flp/fap family [Burkholderia pseudomallei 1106b]
 gi|254218566|gb|EET07950.1| pilin, flp/fap family [Burkholderia pseudomallei 1710a]
          Length = 65

 Score = 51.1 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 31/54 (57%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
           ++  F ++E+G TAIEYGL+  LIAV I T+V T+G  L   F  I   +   
Sbjct: 12 QLMHRFFKEEAGVTAIEYGLIAGLIAVAIATTVGTVGTDLSALFSTIASKLPAA 65


>gi|254473429|ref|ZP_05086826.1| Flp/Fap pilin component superfamily protein [Pseudovibrio sp.
          JE062]
 gi|211957545|gb|EEA92748.1| Flp/Fap pilin component superfamily protein [Pseudovibrio sp.
          JE062]
          Length = 55

 Score = 51.1 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 36/53 (67%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          +   FL+DESGATAIEYG+L +L+AV++I +V  LG K+   F+ I  +   T
Sbjct: 1  MFAKFLKDESGATAIEYGILAALMAVIVIAAVPLLGDKIVTLFKGISTSFSYT 53


>gi|39936737|ref|NP_949013.1| Flp/Fap pilin protein [Rhodopseudomonas palustris CGA009]
 gi|192292563|ref|YP_001993168.1| Flp/Fap pilin component [Rhodopseudomonas palustris TIE-1]
 gi|39650593|emb|CAE29116.1| Flp/Fap pilin component [Rhodopseudomonas palustris CGA009]
 gi|192286312|gb|ACF02693.1| Flp/Fap pilin component [Rhodopseudomonas palustris TIE-1]
          Length = 54

 Score = 51.1 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 36/51 (70%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +IV  F++DESGATAIEYGL+ + I++ II +V  L GKL   F ++  A+
Sbjct: 3  NIVARFIKDESGATAIEYGLIAAGISLAIIAAVQGLAGKLNSTFTSVQNAL 53


>gi|187927691|ref|YP_001898178.1| Flp/Fap pilin component [Ralstonia pickettii 12J]
 gi|187724581|gb|ACD25746.1| Flp/Fap pilin component [Ralstonia pickettii 12J]
          Length = 56

 Score = 51.1 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 33/48 (68%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          + +L+D+ G T+IEY LL SLIA+VI+ SV  LG  +K  +E I  AI
Sbjct: 8  RKWLRDDQGVTSIEYALLGSLIAIVILGSVVALGSGVKSLYEMIAAAI 55


>gi|296444399|ref|ZP_06886364.1| Flp/Fap pilin component [Methylosinus trichosporium OB3b]
 gi|296258046|gb|EFH05108.1| Flp/Fap pilin component [Methylosinus trichosporium OB3b]
          Length = 54

 Score = 51.1 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 37/52 (71%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          ++  +F+++ESGATAIEYGL+ +LI+VVII +V  +G  L   F+ I + + 
Sbjct: 3  NLFASFVENESGATAIEYGLIGALISVVIIVAVKMVGTNLSNTFDKIAQNLT 54


>gi|188581657|ref|YP_001925102.1| Flp/Fap pilin component [Methylobacterium populi BJ001]
 gi|179345155|gb|ACB80567.1| Flp/Fap pilin component [Methylobacterium populi BJ001]
          Length = 64

 Score = 51.1 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 35/55 (63%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +I K F+ DESGATAIEYG++ +++ V I+   T  G KLK AF  +   + T +
Sbjct: 3  NIAKRFIADESGATAIEYGMVAAMVGVAIVGIFTQFGSKLKDAFTTLGTGLNTQT 57


>gi|220918099|ref|YP_002493403.1| Flp/Fap pilin component [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219955953|gb|ACL66337.1| Flp/Fap pilin component [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 66

 Score = 51.1 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 40/58 (68%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          +++   +D+ GATA+EYGL+V+ IA VI+  V +LGG++  AF+ +D  I +  PAA 
Sbjct: 9  MLRKLWKDDEGATAVEYGLMVAAIAAVIVVVVFSLGGRVNTAFQTVDTTIGSHQPAAQ 66


>gi|303247320|ref|ZP_07333593.1| Flp/Fap pilin component [Desulfovibrio fructosovorans JJ]
 gi|302491234|gb|EFL51123.1| Flp/Fap pilin component [Desulfovibrio fructosovorans JJ]
          Length = 56

 Score = 50.7 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 37/55 (67%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          +  +  F++DE GATA+EYGL+ +LIA VI+  VTTLG  L   F++I  +I  +
Sbjct: 2  LRAITKFVRDEEGATAVEYGLMAALIAAVIVGVVTTLGQNLSTTFDSIATSIKGS 56


>gi|148261013|ref|YP_001235140.1| Flp/Fap pilin component [Acidiphilium cryptum JF-5]
 gi|146402694|gb|ABQ31221.1| Flp/Fap pilin component [Acidiphilium cryptum JF-5]
          Length = 67

 Score = 50.7 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 34/51 (66%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          F +D  G TA+EYGL+ +L+AVVII + TTL G LK A + I  A+   +P
Sbjct: 16 FAKDNRGVTALEYGLIAALMAVVIIGAFTTLSGDLKGAIDGISNALSANTP 66


>gi|328542085|ref|YP_004302194.1| hypothetical protein SL003B_0463 [polymorphum gilvum SL003B-26A1]
 gi|326411835|gb|ADZ68898.1| hypothetical protein SL003B_0463 [Polymorphum gilvum SL003B-26A1]
          Length = 71

 Score = 50.7 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 36/57 (63%)

Query: 2  KMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +   ++ FL DE G TA+EYGL++++I+V I+ +V ++G ++   F  + + + T  
Sbjct: 15 RRSTLRRFLADERGVTAVEYGLILAMISVAIMATVLSIGEEIAADFTLLSEKLATAK 71


>gi|154250533|ref|YP_001411357.1| Flp/Fap pilin component [Parvibaculum lavamentivorans DS-1]
 gi|154154483|gb|ABS61700.1| Flp/Fap pilin component [Parvibaculum lavamentivorans DS-1]
          Length = 96

 Score = 50.7 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVT--TLGGKLKKAFEAIDKAIVTTSPAA 61
           ++ F++DESG +A+EYGLL + IAV +   V    +GG L+  FE++   +   +PA+
Sbjct: 36 FLRRFMKDESGISAVEYGLLAAGIAVGLWAFVGPDGIGGTLQGVFESVSDDLSEAAPAS 94


>gi|197295148|ref|YP_002153689.1| flp type pilus subunit [Burkholderia cenocepacia J2315]
 gi|195944627|emb|CAR57231.1| flp type pilus subunit [Burkholderia cenocepacia J2315]
          Length = 63

 Score = 50.7 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 33/54 (61%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
            F++DE G TAIEYGL+ +LIAV II +++T+G  LK  F  I   + +    
Sbjct: 9  SRFVRDEDGVTAIEYGLIAALIAVGIILALSTIGKDLKTVFSTIAADLDSAVAG 62


>gi|167587320|ref|ZP_02379708.1| Flp/Fap pilin component [Burkholderia ubonensis Bu]
          Length = 58

 Score = 50.7 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 35/54 (64%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          ++  FL++E G TAIEYGL+  LIAV I+TSVT +G +L   F  I   + T +
Sbjct: 4  MMIRFLKEEDGVTAIEYGLIAGLIAVAIMTSVTDIGTRLGLVFTNIYNQLATAA 57


>gi|170696790|ref|ZP_02887899.1| Flp/Fap pilin component [Burkholderia graminis C4D1M]
 gi|170138306|gb|EDT06525.1| Flp/Fap pilin component [Burkholderia graminis C4D1M]
          Length = 55

 Score = 50.7 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 31/51 (60%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
              +FL+D  G TA+EYGL+  LI VVI ++V  LG +L  AF+ I   +
Sbjct: 3  KFTASFLRDNRGVTALEYGLIAGLIVVVIGSTVQGLGTQLNTAFQTIAGLL 53


>gi|309778773|ref|ZP_07673546.1| conserved domain protein [Ralstonia sp. 5_7_47FAA]
 gi|308922481|gb|EFP68105.1| conserved domain protein [Ralstonia sp. 5_7_47FAA]
          Length = 59

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 31/56 (55%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          + +  FL+DE GATA+EYG++  LIA  I   V  LG +L   F  I  A+   + 
Sbjct: 3  NAILKFLRDEQGATAVEYGMIAGLIAAAITVIVGKLGTQLNTVFTNICTAVKGGTA 58


>gi|85716621|ref|ZP_01047591.1| Flp/Fap pilin component [Nitrobacter sp. Nb-311A]
 gi|85696622|gb|EAQ34510.1| Flp/Fap pilin component [Nitrobacter sp. Nb-311A]
          Length = 59

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 33/51 (64%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
               FL DESGATAIEY L+ S I++VI+ +V  +GG LK  F+ ++  +
Sbjct: 8  RFASKFLWDESGATAIEYALIASGISIVIVAAVIGIGGSLKDRFDGLNGLL 58


>gi|222147186|ref|YP_002548143.1| component of type 4 pilus pilin subunit protein [Agrobacterium
          vitis S4]
 gi|221734176|gb|ACM35139.1| component of type 4 pilus pilin subunit protein [Agrobacterium
          vitis S4]
          Length = 61

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 35/58 (60%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
           I   F++DESGATAIEYGL+ +LI+V ++   T+LG  L   F  +   +   + A+
Sbjct: 3  KIFARFMKDESGATAIEYGLIAALISVALVAGATSLGSSLNNTFTNLTTQMNKAATAS 60


>gi|323136420|ref|ZP_08071502.1| Flp/Fap pilin component [Methylocystis sp. ATCC 49242]
 gi|322398494|gb|EFY01014.1| Flp/Fap pilin component [Methylocystis sp. ATCC 49242]
          Length = 54

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 31/50 (62%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          +K F++DESGATAIEYGL+ SLI V II  V  LG  L   F  +   + 
Sbjct: 5  LKTFIRDESGATAIEYGLIASLIGVAIIAGVRALGTNLSGTFAKVSGNLA 54


>gi|220922776|ref|YP_002498078.1| Flp/Fap pilin protein [Methylobacterium nodulans ORS 2060]
 gi|219947383|gb|ACL57775.1| Flp/Fap pilin component [Methylobacterium nodulans ORS 2060]
          Length = 56

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 36/53 (67%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          ++K F +DESGATAIEYGLL +LIAV +IT+  ++GG L   F  +   + T 
Sbjct: 4  MLKRFAKDESGATAIEYGLLATLIAVALITAAKSVGGNLNSMFTKVAGNLATN 56


>gi|115351452|ref|YP_773291.1| Flp/Fap pilin component [Burkholderia ambifaria AMMD]
 gi|115281440|gb|ABI86957.1| Flp/Fap pilin component [Burkholderia ambifaria AMMD]
          Length = 54

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 36/50 (72%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++K FL++E G TAIEYGL+  LIA +IITSVTT+G K+   F  I  ++
Sbjct: 4  LIKRFLKEEDGVTAIEYGLIAGLIAALIITSVTTIGTKIAALFSTIASSL 53


>gi|302381759|ref|YP_003817582.1| Flp/Fap pilin component [Brevundimonas subvibrioides ATCC 15264]
 gi|302192387|gb|ADK99958.1| Flp/Fap pilin component [Brevundimonas subvibrioides ATCC 15264]
          Length = 55

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 26/51 (50%), Positives = 34/51 (66%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
            +  F  DESGATAIEYGL+ +LIAVVII ++T LG K+   F  +  A+
Sbjct: 3  KFITKFAHDESGATAIEYGLIAALIAVVIIGAITVLGEKITGTFTKVSTAM 53


>gi|206559890|ref|YP_002230654.1| flp type pilus subunit [Burkholderia cenocepacia J2315]
 gi|198035931|emb|CAR51823.1| flp type pilus subunit [Burkholderia cenocepacia J2315]
          Length = 56

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 35/50 (70%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          I+K FL++E G TA+EYGL+  LIAV ++++++TL G +  AF  I   +
Sbjct: 4  IIKRFLKEEDGVTAVEYGLIAGLIAVALVSAMSTLTGGISGAFTYIANQL 53


>gi|167570110|ref|ZP_02362984.1| pilin, putative [Burkholderia oklahomensis C6786]
          Length = 65

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 31/54 (57%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
           ++  FL +E+G TAIEYGL+  LIAV I T+V TLG  L   F  I   +   
Sbjct: 12 QLMNRFLTEEAGVTAIEYGLIAGLIAVAIATTVGTLGTDLSNLFSTIAGKLPAA 65


>gi|39934951|ref|NP_947227.1| Flp/Fap pilin protein [Rhodopseudomonas palustris CGA009]
 gi|39648802|emb|CAE27323.1| Flp/Fap pilin component [Rhodopseudomonas palustris CGA009]
          Length = 63

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 31/51 (60%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           ++  F  D  GATAIEY ++ + +++VI+  VTTLG  L   + ++  A+
Sbjct: 12 RLISRFWADTRGATAIEYAMIAAGLSIVILGVVTTLGNSLAGKYTSVSDAL 62


>gi|302381760|ref|YP_003817583.1| Flp/Fap pilin component [Brevundimonas subvibrioides ATCC 15264]
 gi|302192388|gb|ADK99959.1| Flp/Fap pilin component [Brevundimonas subvibrioides ATCC 15264]
          Length = 55

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 28/51 (54%), Positives = 36/51 (70%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
            +  F QDESGATAIEYGL+ +LIAVVII ++TTLG K+   F  +  A+
Sbjct: 3  KFITKFAQDESGATAIEYGLIAALIAVVIIGAITTLGTKITGTFTKVANAM 53


>gi|91976437|ref|YP_569096.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB5]
 gi|91682893|gb|ABE39195.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB5]
          Length = 55

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 34/54 (62%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M   ++  F+ D SGATAIEY +L   I++VII  V  LG KL  +++++  AI
Sbjct: 1  MLRRLISRFVSDTSGATAIEYAILAVGISIVIIGVVNGLGTKLNSSYDSVSSAI 54


>gi|311107636|ref|YP_003980489.1| Flp/Fap pilin component family protein [Achromobacter
          xylosoxidans A8]
 gi|310762325|gb|ADP17774.1| Flp/Fap pilin component family protein [Achromobacter
          xylosoxidans A8]
          Length = 65

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 29/58 (50%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
           +  F  DE G TA+EYGL+  ++AV +I +V    G LK  FE +   +       +
Sbjct: 4  TLAQFWNDEDGITALEYGLIAGMVAVALIVAVGAFTGSLKGMFEELGTKLDNAKTGTT 61


>gi|167562919|ref|ZP_02355835.1| pilin, putative [Burkholderia oklahomensis EO147]
          Length = 65

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 31/54 (57%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
           ++  FL +E+G TAIEYGL+  LIAV I T+V TLG  L   F  I   +   
Sbjct: 12 QLMNRFLTEEAGVTAIEYGLIAGLIAVAIATTVGTLGTDLSNLFTTIAGKLPAA 65


>gi|121534393|ref|ZP_01666217.1| Flp/Fap pilin component [Thermosinus carboxydivorans Nor1]
 gi|121307163|gb|EAX48081.1| Flp/Fap pilin component [Thermosinus carboxydivorans Nor1]
          Length = 57

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 34/54 (62%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M   ++K +L+ + G   +EYGL+++LIAVV+I ++T +G  L+  F  +   +
Sbjct: 3  MWWEMIKTYLRCQKGQGMVEYGLILALIAVVVIGALTLMGTNLQGMFNNVAGNV 56


>gi|220913388|ref|YP_002488697.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6]
 gi|219860266|gb|ACL40608.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6]
          Length = 70

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 37/53 (69%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +K+    E GATA+EYG++V LIAVVII +V+TLGG L   F++I+  +   +
Sbjct: 15 LKDRFSSEKGATAVEYGIMVGLIAVVIIVAVSTLGGTLDGFFDSINTELAPKT 67


>gi|187926423|ref|YP_001892768.1| Flp/Fap pilin component [Ralstonia pickettii 12J]
 gi|241665910|ref|YP_002984269.1| Flp/Fap pilin component [Ralstonia pickettii 12D]
 gi|187728177|gb|ACD29341.1| Flp/Fap pilin component [Ralstonia pickettii 12J]
 gi|240867937|gb|ACS65597.1| Flp/Fap pilin component [Ralstonia pickettii 12D]
          Length = 59

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          + +  F++DE GATA+EYG++  LIA  I   V  LG +L   F  I  A+   + 
Sbjct: 3  NAILKFIRDEQGATAVEYGMIAGLIAAAITVIVGKLGTQLNTVFTNICTAVKGGTA 58


>gi|78060320|ref|YP_366895.1| Flp/Fap pilin component [Burkholderia sp. 383]
 gi|77964870|gb|ABB06251.1| Flp/Fap pilin component [Burkholderia sp. 383]
          Length = 63

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 34/55 (61%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          +  F+QD+ G TAIEYGL+ +LIA+ I+ ++TT+G  LK  F  I   + +    
Sbjct: 8  IAWFVQDQDGVTAIEYGLIAALIAIGIVVALTTIGTDLKTVFSTIAADLDSAVAG 62


>gi|53719513|ref|YP_108499.1| putative fimbriae assembly related protein [Burkholderia
          pseudomallei K96243]
 gi|167816015|ref|ZP_02447695.1| pilin, flp/fap family protein [Burkholderia pseudomallei 91]
 gi|167919164|ref|ZP_02506255.1| pilin, flp/fap family protein [Burkholderia pseudomallei BCC215]
 gi|52209927|emb|CAH35899.1| putative fimbriae assembly related protein [Burkholderia
          pseudomallei K96243]
          Length = 56

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 31/54 (57%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
           ++  F ++E+G TAIEYGL+  LIAV I T+V T+G  L   F  I   +   
Sbjct: 3  QLMHRFFKEEAGVTAIEYGLIAGLIAVAIATTVGTVGTDLSALFSTIASKLPAA 56


>gi|328545282|ref|YP_004305391.1| PilA2 pilus assembly protein [polymorphum gilvum SL003B-26A1]
 gi|326415024|gb|ADZ72087.1| PilA2 pilus assembly protein [Polymorphum gilvum SL003B-26A1]
          Length = 60

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 26/58 (44%), Positives = 36/58 (62%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          ++   F +DESGATAIEYGL+  LI+VVI+ +V T+G  L   F  I   +    PA+
Sbjct: 3  NLFARFAKDESGATAIEYGLIAGLISVVIVGTVVTIGTDLSSVFTKISTELAKAKPAS 60


>gi|75674502|ref|YP_316923.1| Flp/Fap pilin component [Nitrobacter winogradskyi Nb-255]
 gi|74419372|gb|ABA03571.1| Flp/Fap pilin component [Nitrobacter winogradskyi Nb-255]
          Length = 55

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/51 (50%), Positives = 36/51 (70%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++   FL+DESGATAIEYGL+ + IAV IIT+V TLG  L   F  +++ +
Sbjct: 3  NLFSRFLKDESGATAIEYGLIAAGIAVAIITAVNTLGTSLNTTFTKVEQDL 53


>gi|296444400|ref|ZP_06886365.1| Flp/Fap pilin component [Methylosinus trichosporium OB3b]
 gi|296258047|gb|EFH05109.1| Flp/Fap pilin component [Methylosinus trichosporium OB3b]
          Length = 54

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 35/51 (68%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          ++  F+ +ESGATAIEYGL+ +LI+VVII +V  +G  L   F+ I + + 
Sbjct: 4  MIARFVGNESGATAIEYGLIGALISVVIIVAVKMVGTNLSNTFDKIAQNLT 54


>gi|307730010|ref|YP_003907234.1| Flp/Fap pilin component [Burkholderia sp. CCGE1003]
 gi|307584545|gb|ADN57943.1| Flp/Fap pilin component [Burkholderia sp. CCGE1003]
          Length = 59

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 32/55 (58%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
              +FL+D  G TA+EYGL+  LI VVI ++V  LG +L  AF+ +   +   S
Sbjct: 3  KFATSFLRDNRGVTALEYGLIAGLIVVVIGSTVQGLGTQLNTAFQTVAGLLPAIS 57


>gi|209886528|ref|YP_002290385.1| hypothetical protein OCAR_7417 [Oligotropha carboxidovorans OM5]
 gi|209874724|gb|ACI94520.1| conserved domain protein [Oligotropha carboxidovorans OM5]
          Length = 54

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 34/51 (66%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++   F++DESGATAIEY L+ + IAVVII +V  +G  +   FE I  ++
Sbjct: 3  NLFARFVKDESGATAIEYALIAAGIAVVIIAAVNGVGSAISSKFETIKSSL 53


>gi|107022590|ref|YP_620917.1| Flp/Fap pilin component [Burkholderia cenocepacia AU 1054]
 gi|116689539|ref|YP_835162.1| Flp/Fap pilin component [Burkholderia cenocepacia HI2424]
 gi|170732843|ref|YP_001764790.1| Flp/Fap pilin component [Burkholderia cenocepacia MC0-3]
 gi|105892779|gb|ABF75944.1| Flp/Fap pilin component [Burkholderia cenocepacia AU 1054]
 gi|116647628|gb|ABK08269.1| Flp/Fap pilin component [Burkholderia cenocepacia HI2424]
 gi|169816085|gb|ACA90668.1| Flp/Fap pilin component [Burkholderia cenocepacia MC0-3]
          Length = 56

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 35/53 (66%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          I+K FL++E G TA+EYGL+  LIAV ++T+++TL   +  AF  I   + + 
Sbjct: 4  IIKRFLKEEDGVTAVEYGLIAGLIAVALVTAMSTLTTGISGAFSYIASKLPSV 56


>gi|218530651|ref|YP_002421467.1| Flp/Fap pilin component [Methylobacterium chloromethanicum CM4]
 gi|218522954|gb|ACK83539.1| Flp/Fap pilin component [Methylobacterium chloromethanicum CM4]
          Length = 61

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 34/55 (61%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +I K F+ DESGATAIEYGL+ +++ + ++T     G  L  AF  I  A+ T +
Sbjct: 3  NITKRFIADESGATAIEYGLVAAMMGIAVVTIFKAFGTSLGNAFSTIGTALNTQA 57


>gi|51245390|ref|YP_065274.1| pilus assembly protein pilin subunit [Desulfotalea psychrophila
          LSv54]
 gi|50876427|emb|CAG36267.1| related to pilus assembly protein pilin subunit [Desulfotalea
          psychrophila LSv54]
          Length = 59

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 39/55 (70%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          + +++ F++DESG TAIEYGL+ +LIAVVII +VT +G  L   F+ I  A+ + 
Sbjct: 5  LSMIRTFVKDESGVTAIEYGLIAALIAVVIIAAVTAVGVALNTTFQRIATALESA 59


>gi|46204006|ref|ZP_00209209.1| COG3847: Flp pilus assembly protein, pilin Flp [Magnetospirillum
          magnetotacticum MS-1]
          Length = 68

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 35/55 (63%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +I K F+ DESGATAIEYGL+ +++ + ++      G KL  AFE +  ++ T +
Sbjct: 7  NIAKRFIADESGATAIEYGLVAAMMGIAVVAVFKAFGSKLTTAFETLGTSLNTQT 61


>gi|110636419|ref|YP_676627.1| Flp/Fap pilin component [Mesorhizobium sp. BNC1]
 gi|110287403|gb|ABG65462.1| Flp/Fap pilin component [Chelativorans sp. BNC1]
          Length = 60

 Score = 48.8 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 36/56 (64%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          +   FL+DESGATA+EYGL+V+LIA  II  V ++GG++  AF  +   +     A
Sbjct: 4  LFARFLKDESGATAVEYGLIVALIAAGIIAVVGSIGGQITNAFTRVSTGLTGEGIA 59


>gi|225872751|ref|YP_002754208.1| hypothetical protein ACP_1103 [Acidobacterium capsulatum ATCC
           51196]
 gi|225793767|gb|ACO33857.1| hypothetical protein ACP_1103 [Acidobacterium capsulatum ATCC
           51196]
          Length = 106

 Score = 48.8 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 33/55 (60%)

Query: 5   IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
           ++ N LQDESG   IEY L+ +LI +  + +++ +   +K AF +++  + T + 
Sbjct: 52  VLNNLLQDESGQDLIEYALVAALIGLAAVAAMSGVANGIKNAFNSVNNQLTTATS 106


>gi|188586931|ref|YP_001918476.1| Flp/Fap pilin component [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179351618|gb|ACB85888.1| Flp/Fap pilin component [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 69

 Score = 48.8 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 31/53 (58%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +K    +E G   +EYGL+++L+AVV+I +++ LG  +   FE I   +   +
Sbjct: 5  LKRLWTEEDGQGMVEYGLILALVAVVVIGALSFLGDNVAGIFEHITDEVGDET 57


>gi|307726370|ref|YP_003909583.1| Flp/Fap pilin component [Burkholderia sp. CCGE1003]
 gi|307586895|gb|ADN60292.1| Flp/Fap pilin component [Burkholderia sp. CCGE1003]
          Length = 57

 Score = 48.4 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 34/53 (64%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          ++  K F++DE G TAIEYGL+ +LIA+VIIT VT +G  L   F  I   + 
Sbjct: 5  INSTKAFIRDEDGVTAIEYGLIATLIALVIITGVTAVGTNLAAKFLFISTKLA 57


>gi|116254028|ref|YP_769866.1| pilus component protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258676|emb|CAK09780.1| putative pilus component protein [Rhizobium leguminosarum bv.
          viciae 3841]
          Length = 55

 Score = 48.4 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 32/55 (58%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          M I+K FL D+ GATAIEYGL+ +LI   +++ +    G L+  F  I+  +   
Sbjct: 1  MRILKAFLADDRGATAIEYGLIAALICGALVSGLGVFTGALQGVFNVINNNMTVN 55


>gi|103487278|ref|YP_616839.1| Flp/Fap pilin component [Sphingopyxis alaskensis RB2256]
 gi|98977355|gb|ABF53506.1| Flp/Fap pilin component [Sphingopyxis alaskensis RB2256]
          Length = 54

 Score = 48.4 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 31/53 (58%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          M  +K F++D   ATAIEYGL+ +LIAV  I+++  +G  +   F  +   + 
Sbjct: 1  MKFIKKFVRDTKAATAIEYGLIAALIAVAGISAMGLVGNSVSNTFNEVSTELN 53


>gi|16263306|ref|NP_436099.1| PilA2 pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|307304375|ref|ZP_07584126.1| Flp/Fap pilin component [Sinorhizobium meliloti BL225C]
 gi|307318082|ref|ZP_07597518.1| Flp/Fap pilin component [Sinorhizobium meliloti AK83]
 gi|14523985|gb|AAK65511.1| PilA2 pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|306896123|gb|EFN26873.1| Flp/Fap pilin component [Sinorhizobium meliloti AK83]
 gi|306902577|gb|EFN33171.1| Flp/Fap pilin component [Sinorhizobium meliloti BL225C]
          Length = 56

 Score = 48.4 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (66%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          +++  F ++ESGATAIEYGL+  LI+VV+IT + T+G  L   F AI  A+   
Sbjct: 3  NLLARFARNESGATAIEYGLIAGLISVVLITVMGTIGTGLTTRFTAIGTALTGG 56


>gi|27382252|ref|NP_773781.1| components of type IV pilus pilin subunit [Bradyrhizobium
          japonicum USDA 110]
 gi|27355423|dbj|BAC52406.1| components of type IV pilus pilin subunit [Bradyrhizobium
          japonicum USDA 110]
          Length = 78

 Score = 48.4 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 35/51 (68%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++V  F++DESGATAIEYGL+ + IA+ IIT V  LG  L   F +I  ++
Sbjct: 27 NLVARFVKDESGATAIEYGLIAAGIALAIITVVNNLGSTLNTKFTSISTSL 77


>gi|296134301|ref|YP_003641548.1| Flp/Fap pilin component [Thermincola sp. JR]
 gi|296032879|gb|ADG83647.1| Flp/Fap pilin component [Thermincola potens JR]
          Length = 54

 Score = 48.4 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 33/52 (63%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          + ++K   ++ESG    EYGL+++LI + +I  + T+GG LK  FE +  A+
Sbjct: 2  LTMIKKLWKEESGQGMTEYGLILALIVIAVIAIMATMGGNLKNKFENVSNAL 53


>gi|92116016|ref|YP_575745.1| Flp/Fap pilin component [Nitrobacter hamburgensis X14]
 gi|91798910|gb|ABE61285.1| Flp/Fap pilin component [Nitrobacter hamburgensis X14]
          Length = 56

 Score = 48.4 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 34/54 (62%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          ++VK F +DESGATAIEYGL+ + IAV II++V  +G  L   F  +   +   
Sbjct: 3  NLVKRFAKDESGATAIEYGLIAAGIAVAIISAVNLVGTNLISKFTQVSDQLAKP 56


>gi|330816711|ref|YP_004360416.1| Flp/Fap pilin component [Burkholderia gladioli BSR3]
 gi|327369104|gb|AEA60460.1| Flp/Fap pilin component [Burkholderia gladioli BSR3]
          Length = 57

 Score = 48.4 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 31/53 (58%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          ++  FL++E G TA+EYGL+  L+AV ++  VT L G ++  F  +   +   
Sbjct: 4  LINRFLKEEDGVTAVEYGLIAGLMAVALVAGVTALSGSIQNLFTYLKGVLDAA 56


>gi|323529418|ref|YP_004231570.1| Flp/Fap pilin component [Burkholderia sp. CCGE1001]
 gi|323386420|gb|ADX58510.1| Flp/Fap pilin component [Burkholderia sp. CCGE1001]
          Length = 57

 Score = 48.4 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 35/52 (67%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++  K F++DE G TAIEYGL+ +LIA+VIIT VT++G  L   F  I   +
Sbjct: 5  INTAKAFVRDEDGVTAIEYGLIATLIALVIITGVTSVGTNLAAKFVLIASKL 56


>gi|307943142|ref|ZP_07658487.1| Flp/Fap pilin component [Roseibium sp. TrichSKD4]
 gi|307773938|gb|EFO33154.1| Flp/Fap pilin component [Roseibium sp. TrichSKD4]
          Length = 56

 Score = 48.0 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 30/54 (55%), Positives = 38/54 (70%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          ++   F +DESGATAIEYGL+  LIAVVII +VTTLG  L   FE I+  + T+
Sbjct: 3  NVFARFAKDESGATAIEYGLIAGLIAVVIIGTVTTLGTTLNGIFETINTDLTTS 56


>gi|304392390|ref|ZP_07374331.1| Flp/Fap pilin component [Ahrensia sp. R2A130]
 gi|303295494|gb|EFL89853.1| Flp/Fap pilin component [Ahrensia sp. R2A130]
          Length = 53

 Score = 48.0 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 35/53 (66%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          M  +K F +DESGATAIEYGLL +LI++V I ++TT+G  L     A   A+ 
Sbjct: 1  MTNIKRFFKDESGATAIEYGLLAALISIVAIGAMTTIGTNLNTKLGAAGTALS 53


>gi|254420002|ref|ZP_05033726.1| Flp/Fap pilin component superfamily [Brevundimonas sp. BAL3]
 gi|196186179|gb|EDX81155.1| Flp/Fap pilin component superfamily [Brevundimonas sp. BAL3]
          Length = 56

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 35/54 (64%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
            +  F +DESGATAIEYGL+ +LIAVVIIT + T+G +L    + + K +   
Sbjct: 3  KFISRFAKDESGATAIEYGLIAALIAVVIITVLGTIGTQLDIKLKEVAKGLGAA 56


>gi|197295147|ref|YP_002153688.1| flp type pilus subunit [Burkholderia cenocepacia J2315]
 gi|195944626|emb|CAR57230.1| flp type pilus subunit [Burkholderia cenocepacia J2315]
          Length = 63

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 33/55 (60%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          +  F+QD+ G TAIEYGL+ +LIA+ I+ ++ T+G  LK  F  I   + +    
Sbjct: 8  IAWFVQDQDGVTAIEYGLIAALIAIGIVAALATVGTDLKTVFSTIAADLDSAVAG 62


>gi|220924565|ref|YP_002499867.1| Flp/Fap pilin protein [Methylobacterium nodulans ORS 2060]
 gi|219949172|gb|ACL59564.1| Flp/Fap pilin component [Methylobacterium nodulans ORS 2060]
          Length = 53

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 36/53 (67%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          +VK F+ DESGATAIEYGLL +LIAV +IT+ +++G  L   F  I   + + 
Sbjct: 1  MVKRFIVDESGATAIEYGLLATLIAVALITAASSVGTNLSSLFNKIAGNLASN 53


>gi|303247319|ref|ZP_07333592.1| Flp/Fap pilin component [Desulfovibrio fructosovorans JJ]
 gi|302491233|gb|EFL51122.1| Flp/Fap pilin component [Desulfovibrio fructosovorans JJ]
          Length = 56

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 39/55 (70%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          +  + NF+++E GATA+EYGL+ +LIA VI+T VTTLG  L   F++I  +I  +
Sbjct: 2  LRAITNFVRNEEGATAVEYGLMAALIAAVIVTVVTTLGQNLSTTFDSIATSIKGS 56


>gi|94312583|ref|YP_585792.1| Flp/Fap pilin component [Cupriavidus metallidurans CH34]
 gi|93356435|gb|ABF10523.1| Flp/Fap pilin component [Cupriavidus metallidurans CH34]
          Length = 63

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 30/56 (53%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          M+      F + + GATAIEYGL+  LIAV I+  VT LG  L   F  +   + T
Sbjct: 1  MRQVKASLFRKAQRGATAIEYGLIAGLIAVAIVAGVTNLGQNLGTGFSNLATKVTT 56


>gi|239833240|ref|ZP_04681569.1| Flp/Fap pilin component [Ochrobactrum intermedium LMG 3301]
 gi|239825507|gb|EEQ97075.1| Flp/Fap pilin component [Ochrobactrum intermedium LMG 3301]
          Length = 107

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 14/54 (25%), Positives = 31/54 (57%)

Query: 5   IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
           ++  F+++ +G+TAIEY L+ +L+++ II+ V  + G +   F    +     +
Sbjct: 52  LMTRFMKNRAGSTAIEYALIGTLVSIAIISGVALMAGSVGDKFNETARQFEQAT 105


>gi|240139023|ref|YP_002963498.1| Flp/Fap pilin component [Methylobacterium extorquens AM1]
 gi|240008995|gb|ACS40221.1| Flp/Fap pilin component [Methylobacterium extorquens AM1]
          Length = 69

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 32/56 (57%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          +I K F+ DESGATAIEYG++ ++I + I+    +    L  AF  +   + T + 
Sbjct: 7  NIAKRFISDESGATAIEYGMVAAMIGIAIVGIFASFKTNLTTAFTTLGTGLNTQTS 62


>gi|118589700|ref|ZP_01547105.1| flp/fap pilin component [Stappia aggregata IAM 12614]
 gi|118437786|gb|EAV44422.1| flp/fap pilin component [Stappia aggregata IAM 12614]
          Length = 62

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 33/54 (61%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          ++  F+ DESGATAIEYGL+  L+++VI+ +V   G  +   F  I   + T +
Sbjct: 4  LINRFVNDESGATAIEYGLIAGLLSIVIVGAVAATGTSISGIFTKIQGEMNTAA 57


>gi|146342539|ref|YP_001207587.1| putative Flp/Fap pilin component [Bradyrhizobium sp. ORS278]
 gi|146195345|emb|CAL79370.1| putative Flp/Fap pilin component [Bradyrhizobium sp. ORS278]
          Length = 53

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 37/52 (71%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M ++  FL+DESGATAIEYGL+ + I++ II SV  LG KL   F +I+ ++
Sbjct: 1  MSVILRFLKDESGATAIEYGLIAAGISIAIIASVNGLGSKLNTKFTSINSSL 52


>gi|163851900|ref|YP_001639943.1| Flp/Fap pilin component [Methylobacterium extorquens PA1]
 gi|163663505|gb|ABY30872.1| Flp/Fap pilin component [Methylobacterium extorquens PA1]
          Length = 65

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 32/56 (57%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          +I K F+ DESGATAIEYG++ ++I + I+    +    L  AF  +   + T + 
Sbjct: 3  NIAKRFISDESGATAIEYGMVAAMIGIAIVGIFASFKTNLTTAFTTLGTGLNTQTS 58


>gi|307726371|ref|YP_003909584.1| Flp/Fap pilin component [Burkholderia sp. CCGE1003]
 gi|307586896|gb|ADN60293.1| Flp/Fap pilin component [Burkholderia sp. CCGE1003]
          Length = 57

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          +  +  F++DE G TAIEYGL+ +LIA+ IIT VT +G  L+  F  I   + 
Sbjct: 5  IQSIDAFVRDEEGVTAIEYGLIATLIALAIITGVTAIGTNLEAKFMLIAGYLT 57


>gi|227823968|ref|YP_002827941.1| probable PilA pilus assembly protein [Sinorhizobium fredii
          NGR234]
 gi|227342970|gb|ACP27188.1| probable PilA pilus assembly protein [Sinorhizobium fredii
          NGR234]
          Length = 60

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 33/53 (62%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          I    ++DESGATAIEYGL+ +LI+V +IT  T LG  L   F A+   + T 
Sbjct: 4  IFARLMKDESGATAIEYGLIAALISVALITGATALGDSLDSMFNALSGQMTTA 56


>gi|315121899|ref|YP_004062388.1| hypothetical protein CKC_00745 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
 gi|313495301|gb|ADR51900.1| hypothetical protein CKC_00745 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
          Length = 55

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 32/54 (59%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          ++  K  L+DESG   +EYGLL +L+A+V I ++T LG KL   F  +   +  
Sbjct: 2  VNCFKKMLKDESGTAFLEYGLLAALVAIVAIGAITNLGTKLTGTFTTVSDKLKA 55


>gi|241206511|ref|YP_002977607.1| Flp/Fap pilin component [Rhizobium leguminosarum bv. trifolii
          WSM1325]
 gi|240860401|gb|ACS58068.1| Flp/Fap pilin component [Rhizobium leguminosarum bv. trifolii
          WSM1325]
          Length = 55

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 32/55 (58%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          M ++K F+ D  GATAIEYGL+ +LI   +++++    G L+  F  I+  +   
Sbjct: 1  MRLLKAFVADNRGATAIEYGLVAALIGGALVSALGIFSGSLQDVFNVINNNLTVN 55


>gi|323525742|ref|YP_004227895.1| Flp/Fap pilin component [Burkholderia sp. CCGE1001]
 gi|323382744|gb|ADX54835.1| Flp/Fap pilin component [Burkholderia sp. CCGE1001]
          Length = 57

 Score = 47.3 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 31/51 (60%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
              +FL+D  G TA+EYGL+  LI VVI ++V  LG +L  AF+ +   +
Sbjct: 3  KFAASFLRDNRGVTALEYGLIAGLIVVVIGSTVQGLGTQLNTAFQTVAALL 53


>gi|219883043|ref|YP_002478207.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6]
 gi|219862049|gb|ACL42390.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6]
          Length = 70

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 34/54 (62%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          K  L  ESGATA+EYGLLV LIAV II ++  LG +L   F ++ +++     A
Sbjct: 16 KKRLSGESGATAVEYGLLVGLIAVGIIAALVILGPQLAGLFTSVTESLPGAPAA 69


>gi|187919321|ref|YP_001888352.1| Flp/Fap pilin component [Burkholderia phytofirmans PsJN]
 gi|187717759|gb|ACD18982.1| Flp/Fap pilin component [Burkholderia phytofirmans PsJN]
          Length = 58

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 32/56 (57%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          + +K FL++E G  AIEY LL  LIAV II +V  +   LK  F AI  A+   + 
Sbjct: 3  NTIKKFLREEDGVAAIEYALLAGLIAVAIIVTVQNMTTNLKAMFNAIGTALTNAAA 58


>gi|144898052|emb|CAM74916.1| hypothetical protein MGR_1741 [Magnetospirillum gryphiswaldense
          MSR-1]
          Length = 59

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 31/52 (59%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          ++    +DE GATAIEYGL+ +L+A+VII  +  L G L   F+ +   +  
Sbjct: 8  MLTKLNRDERGATAIEYGLIAALVAIVIIGGLQALSGGLNTLFQTVATTLGG 59


>gi|73542325|ref|YP_296845.1| Flp/Fap pilin component [Ralstonia eutropha JMP134]
 gi|72119738|gb|AAZ62001.1| Flp/Fap pilin component [Ralstonia eutropha JMP134]
          Length = 74

 Score = 47.3 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 35/52 (67%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++++ + L +++  T+IEY LL  LIA+ I+ SV+++G  +K  +E+I   +
Sbjct: 22 LNLIADLLHEDAAVTSIEYALLGMLIAIAIVGSVSSVGDAVKTLYESIAAKM 73


>gi|317122050|ref|YP_004102053.1| Flp/Fap pilin component [Thermaerobacter marianensis DSM 12885]
 gi|315592030|gb|ADU51326.1| Flp/Fap pilin component [Thermaerobacter marianensis DSM 12885]
          Length = 63

 Score = 47.3 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 33/53 (62%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          VK  L+DE+G   +EYGL+++LIAVV+I ++  L G L   F  + + +  T 
Sbjct: 11 VKFRLRDEAGQGMVEYGLIIALIAVVLIGALVALSGGLGSIFSRVTQQLNNTQ 63


>gi|150377238|ref|YP_001313833.1| Flp/Fap pilin component [Sinorhizobium medicae WSM419]
 gi|150031785|gb|ABR63900.1| Flp/Fap pilin component [Sinorhizobium medicae WSM419]
          Length = 55

 Score = 47.3 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 35/53 (66%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          +++  F ++ESGATAIEYGL+  LI+VVII  + T+G  L   F AI  A+  
Sbjct: 3  NLLVRFARNESGATAIEYGLIAGLISVVIIAVMATVGTGLTTRFTAIGTALTG 55


>gi|16127178|ref|NP_421742.1| pilus subunit protein PilA [Caulobacter crescentus CB15]
 gi|221235979|ref|YP_002518416.1| type IV pilin protein pilA [Caulobacter crescentus NA1000]
 gi|7208422|gb|AAF40189.1|AF229646_1 PilA [Caulobacter crescentus CB15]
 gi|13424576|gb|AAK24910.1| pilus subunit protein PilA [Caulobacter crescentus CB15]
 gi|220965152|gb|ACL96508.1| type IV pilin protein pilA [Caulobacter crescentus NA1000]
          Length = 59

 Score = 46.9 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 41/55 (74%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
            V  FL+DESGATAIEYGL+V+LIAVVI+T+VTTLG  L+ AF     A+ T +
Sbjct: 3  KFVTRFLKDESGATAIEYGLIVALIAVVIVTAVTTLGTNLRTAFTKAGAAVSTAA 57


>gi|148253065|ref|YP_001237650.1| putative Flp/Fap pilin component [Bradyrhizobium sp. BTAi1]
 gi|146405238|gb|ABQ33744.1| putative Flp/Fap pilin component [Bradyrhizobium sp. BTAi1]
          Length = 56

 Score = 46.9 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 24/49 (48%), Positives = 29/49 (59%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +  ESG TAIEYGLL +LIAVVII  VT +G  L+  F  I   +    
Sbjct: 7  IDSESGVTAIEYGLLAALIAVVIIVGVTLIGTNLQAIFNYIGGKLKVPG 55


>gi|115525746|ref|YP_782657.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisA53]
 gi|115519693|gb|ABJ07677.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisA53]
          Length = 81

 Score = 46.9 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 35/52 (67%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          +I+  FL+DESGATAIEYGL+ + IA+ IIT+V T+G  L   F  I   + 
Sbjct: 27 NILARFLKDESGATAIEYGLIAAGIALAIITAVNTVGTDLSTKFGEISTELT 78


>gi|146343301|ref|YP_001208349.1| putative Flp/Fap pilin component [Bradyrhizobium sp. ORS278]
 gi|146196107|emb|CAL80134.1| putative Flp/Fap pilin component [Bradyrhizobium sp. ORS278]
          Length = 53

 Score = 46.9 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 32/53 (60%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          ++  F +DESGATAIEYGL+ + IA+ IIT +  LG  L+  F  +   +   
Sbjct: 1  MLLKFYEDESGATAIEYGLICAGIALAIITILNKLGLTLEGIFTTLTTKLNGG 53


>gi|254488860|ref|ZP_05102065.1| Flp/Fap pilin component family [Roseobacter sp. GAI101]
 gi|214045729|gb|EEB86367.1| Flp/Fap pilin component family [Roseobacter sp. GAI101]
          Length = 67

 Score = 46.9 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 31/51 (60%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          V+ F +DE GATAIEYGL  +L+  VI+ SV  LG +  K F  +  A+  
Sbjct: 12 VRTFCKDEDGATAIEYGLFAALVGAVIVGSVAGLGKQTDKGFTTMASALTA 62


>gi|149184276|ref|ZP_01862594.1| hypothetical protein ED21_26198 [Erythrobacter sp. SD-21]
 gi|148831596|gb|EDL50029.1| hypothetical protein ED21_26198 [Erythrobacter sp. SD-21]
          Length = 60

 Score = 46.9 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 32/57 (56%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          +  +K    DE GATA+EYGL+++LI V I+ +V+T G      +  +  A+    P
Sbjct: 2  VQFLKKLGHDERGATAVEYGLILALIFVSIMGAVSTFGETTIDMWNTVSSAVSAARP 58


>gi|126442904|ref|YP_001064072.1| Flp/Fap pilin [Burkholderia pseudomallei 668]
 gi|126456583|ref|YP_001076984.1| Flp/Fap pilin [Burkholderia pseudomallei 1106a]
 gi|134281737|ref|ZP_01768444.1| Flp/Fap pilin [Burkholderia pseudomallei 305]
 gi|167725241|ref|ZP_02408477.1| hypothetical protein BpseD_39846 [Burkholderia pseudomallei DM98]
 gi|167744171|ref|ZP_02416945.1| hypothetical protein Bpse14_39228 [Burkholderia pseudomallei 14]
 gi|167829709|ref|ZP_02461180.1| hypothetical protein Bpseu9_38880 [Burkholderia pseudomallei 9]
 gi|167851178|ref|ZP_02476686.1| hypothetical protein BpseB_38421 [Burkholderia pseudomallei
          B7210]
 gi|167908125|ref|ZP_02495330.1| hypothetical protein BpseN_38236 [Burkholderia pseudomallei NCTC
          13177]
 gi|167916472|ref|ZP_02503563.1| hypothetical protein Bpse112_38727 [Burkholderia pseudomallei
          112]
 gi|217424381|ref|ZP_03455880.1| Flp/Fap pilin [Burkholderia pseudomallei 576]
 gi|226194001|ref|ZP_03789602.1| Flp/Fap pilin [Burkholderia pseudomallei Pakistan 9]
 gi|237507574|ref|ZP_04520289.1| conserved domain protein [Burkholderia pseudomallei MSHR346]
 gi|242313440|ref|ZP_04812457.1| Flp/Fap pilin [Burkholderia pseudomallei 1106b]
 gi|254182588|ref|ZP_04889182.1| Flp/Fap pilin [Burkholderia pseudomallei 1655]
 gi|254192452|ref|ZP_04898891.1| Flp/Fap pilin [Burkholderia pseudomallei S13]
 gi|254264094|ref|ZP_04954959.1| Flp/Fap pilin [Burkholderia pseudomallei 1710a]
 gi|126222395|gb|ABN85900.1| Flp/Fap pilin [Burkholderia pseudomallei 668]
 gi|126230351|gb|ABN93764.1| Flp/Fap pilin [Burkholderia pseudomallei 1106a]
 gi|134246799|gb|EBA46886.1| Flp/Fap pilin [Burkholderia pseudomallei 305]
 gi|169649210|gb|EDS81903.1| Flp/Fap pilin [Burkholderia pseudomallei S13]
 gi|184213123|gb|EDU10166.1| Flp/Fap pilin [Burkholderia pseudomallei 1655]
 gi|217392846|gb|EEC32869.1| Flp/Fap pilin [Burkholderia pseudomallei 576]
 gi|225933946|gb|EEH29932.1| Flp/Fap pilin [Burkholderia pseudomallei Pakistan 9]
 gi|234999779|gb|EEP49203.1| conserved domain protein [Burkholderia pseudomallei MSHR346]
 gi|242136679|gb|EES23082.1| Flp/Fap pilin [Burkholderia pseudomallei 1106b]
 gi|254215096|gb|EET04481.1| Flp/Fap pilin [Burkholderia pseudomallei 1710a]
          Length = 48

 Score = 46.9 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 30/47 (63%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           +L+DES  +AIEY L+ SLIA+VII +V  +G  L+  F  +   +
Sbjct: 2  RWLRDESAVSAIEYALIASLIAIVIIGAVQVVGTNLQSVFSTVASDV 48


>gi|118588530|ref|ZP_01545939.1| hypothetical protein SIAM614_24652 [Stappia aggregata IAM 12614]
 gi|118439236|gb|EAV45868.1| hypothetical protein SIAM614_24652 [Stappia aggregata IAM 12614]
          Length = 75

 Score = 46.9 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKL-KKAFEAIDKAIVTT 57
          K F++DE GAT IEYGL+V  I+++I+ ++T +G  +    F  I   +   
Sbjct: 20 KEFVRDERGATMIEYGLIVGFISIIILITMTAIGTTMRDDIFGKISTTLQGV 71


>gi|293606496|ref|ZP_06688854.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
          43553]
 gi|292815119|gb|EFF74242.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
          43553]
          Length = 58

 Score = 46.5 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 26/52 (50%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          +  F  DE G TA+EYGL+  L+AV +I +V T    L   F  +   +   
Sbjct: 5  LAQFWNDEDGITALEYGLIAGLVAVALIAAVGTFTDALSNMFTGLGAKLDAA 56


>gi|304392387|ref|ZP_07374328.1| Flp/Fap pilin component [Ahrensia sp. R2A130]
 gi|303295491|gb|EFL89850.1| Flp/Fap pilin component [Ahrensia sp. R2A130]
          Length = 53

 Score = 46.5 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 35/53 (66%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          M  +K F +DESGATAIEYGLL +LI++V I ++TT+G  L     A   A+ 
Sbjct: 1  MTNLKKFFKDESGATAIEYGLLAALISIVAIGAMTTIGTNLNTKLGAAGSALT 53


>gi|319795777|ref|YP_004157417.1| flp/fap pilin component [Variovorax paradoxus EPS]
 gi|315598240|gb|ADU39306.1| Flp/Fap pilin component [Variovorax paradoxus EPS]
          Length = 61

 Score = 46.5 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSV---TTLGGKLKKAFEAIDKAIVTTSP 59
          +  F++DE GATAIEYG++  ++AV+++       TL G ++  F  I  A+ T +P
Sbjct: 5  ITRFIRDEEGATAIEYGIIAGMMAVLLVAVFSPSGTLYGAIEGVFGRISTALDTVTP 61


>gi|283769327|ref|ZP_06342226.1| Flp/Fap pilin component [Bulleidia extructa W1219]
 gi|283103984|gb|EFC05368.1| Flp/Fap pilin component [Bulleidia extructa W1219]
          Length = 56

 Score = 46.5 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 34/51 (66%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          + +  F ++ESG   +EYGL+++LIAVV+I ++  + G +   F+AI  A+
Sbjct: 3  NFMNWFTEEESGQGMVEYGLIIALIAVVLIVALQAMQGGIANTFQAITNAL 53


>gi|254420564|ref|ZP_05034288.1| Flp/Fap pilin component superfamily [Brevundimonas sp. BAL3]
 gi|196186741|gb|EDX81717.1| Flp/Fap pilin component superfamily [Brevundimonas sp. BAL3]
          Length = 59

 Score = 46.5 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 25/54 (46%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
               FL D+ GATAIEYGL+  LI V I+  +  LG      +    + I   
Sbjct: 3  RFTARFLNDDRGATAIEYGLICGLIFVAILGGLNALGASNGGLYNQTMQKIADA 56


>gi|46201036|ref|ZP_00055934.2| COG3847: Flp pilus assembly protein, pilin Flp [Magnetospirillum
          magnetotacticum MS-1]
          Length = 57

 Score = 46.5 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 29/50 (58%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++    +DE GATAIEYGL+ +LI+VV I  +  LG KL   F  I    
Sbjct: 8  MITKMTRDEQGATAIEYGLIAALISVVAIPGMLVLGPKLSTLFTTISGKF 57


>gi|167841421|ref|ZP_02468105.1| hypothetical protein Bpse38_32405 [Burkholderia thailandensis
          MSMB43]
          Length = 48

 Score = 46.1 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 30/46 (65%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +L+DES  +AIEY L+ SLIA+VII +V  +G  L+  F  +   +
Sbjct: 3  WLRDESAVSAIEYALIASLIAIVIIGAVQVVGTNLQSVFSTVASDV 48


>gi|192290480|ref|YP_001991085.1| Flp/Fap pilin component [Rhodopseudomonas palustris TIE-1]
 gi|192284229|gb|ACF00610.1| Flp/Fap pilin component [Rhodopseudomonas palustris TIE-1]
          Length = 54

 Score = 46.1 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 32/51 (62%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           ++  F  D  GATAIEY ++ + +++VI+  VTTLG  L   + ++ +A+
Sbjct: 3  RLISRFWADTRGATAIEYAMIAAGLSIVILGVVTTLGNSLAGKYTSVSEAM 53


>gi|323529417|ref|YP_004231569.1| Flp/Fap pilin component [Burkholderia sp. CCGE1001]
 gi|323386419|gb|ADX58509.1| Flp/Fap pilin component [Burkholderia sp. CCGE1001]
          Length = 57

 Score = 46.1 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 33/53 (62%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
             +  F++DE G TAIEYGL+ +LIA+ I+  VT++G  L+  F AI   + 
Sbjct: 5  NQTIGAFVRDEEGVTAIEYGLIATLIALAIVVGVTSIGTNLEAKFMAIAGYLT 57


>gi|21673265|ref|NP_661330.1| hypothetical protein CT0426 [Chlorobium tepidum TLS]
 gi|21646353|gb|AAM71672.1| hypothetical protein CT0426 [Chlorobium tepidum TLS]
          Length = 69

 Score = 46.1 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          ++ + G T IEY L+ SLIAV +I  + T+G  LK  F  +   + T
Sbjct: 23 VKSQKGVTMIEYALIASLIAVAVIAVLLTVGSNLKTVFSYVGSNLTT 69


>gi|86159253|ref|YP_466038.1| Flp/Fap pilin component [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85775764|gb|ABC82601.1| Flp/Fap pilin component [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 59

 Score = 46.1 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 27/57 (47%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          +  +K   +DE   TA+EY ++V++I +VII     LG  +   F      +   + 
Sbjct: 2  LQTLKRLWKDEEAPTAVEYAIMVAVIGLVIIVGAQILGTNVNTTFNNAANRVPGGAA 58


>gi|209551110|ref|YP_002283027.1| Flp/Fap pilin component [Rhizobium leguminosarum bv. trifolii
          WSM2304]
 gi|209536866|gb|ACI56801.1| Flp/Fap pilin component [Rhizobium leguminosarum bv. trifolii
          WSM2304]
          Length = 55

 Score = 46.1 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 31/55 (56%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          M I K FL D+ GATA+EYGL+ ++I   +++ +    G L+  F  I+  +   
Sbjct: 1  MRIFKAFLADDVGATAVEYGLIAAIICTALVSGLGFFTGALQNVFNVINNNMTVN 55


>gi|190893600|ref|YP_001980142.1| pilus component protein [Rhizobium etli CIAT 652]
 gi|190698879|gb|ACE92964.1| putative pilus component protein [Rhizobium etli CIAT 652]
          Length = 55

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 31/55 (56%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          M ++K F  D++GATA+EYGL+ ++I   +++ +    G L+  F  +   I   
Sbjct: 1  MRLLKAFFADDTGATAVEYGLIAAVICTALVSGLGFFTGSLQNVFSVVSNNITVN 55


>gi|315121898|ref|YP_004062387.1| hypothetical protein CKC_00740 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
 gi|313495300|gb|ADR51899.1| hypothetical protein CKC_00740 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
          Length = 35

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/32 (68%), Positives = 27/32 (84%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVI 32
          MK++I++ FLQDESGATAIEYGLL +LI   I
Sbjct: 1  MKVNIIRKFLQDESGATAIEYGLLAALIIFCI 32


>gi|304320644|ref|YP_003854287.1| hypothetical protein PB2503_05357 [Parvularcula bermudensis
          HTCC2503]
 gi|303299546|gb|ADM09145.1| hypothetical protein PB2503_05357 [Parvularcula bermudensis
          HTCC2503]
          Length = 60

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 40/56 (71%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
           ++   F++DE GATAIEYGL+ +LIAV II++V++LG +++ AF+ ++  +    
Sbjct: 2  NNLFNRFVKDEDGATAIEYGLIAALIAVAIISAVSSLGTRIQGAFDDVNTTLENNG 57


>gi|299131747|ref|ZP_07024942.1| Flp/Fap pilin component [Afipia sp. 1NLS2]
 gi|298591884|gb|EFI52084.1| Flp/Fap pilin component [Afipia sp. 1NLS2]
          Length = 53

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 33/52 (63%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M  +K F  D+SGAT+IEY ++ + +++VI+ +V  +G  L   +E I  A+
Sbjct: 1  MKTLKRFFLDQSGATSIEYAIIAAGLSIVILVAVNGIGSALNGKYEMIRAAV 52


>gi|325964119|ref|YP_004242025.1| Flp pilus assembly protein, pilin Flp [Arthrobacter
          phenanthrenivorans Sphe3]
 gi|323470206|gb|ADX73891.1| Flp pilus assembly protein, pilin Flp [Arthrobacter
          phenanthrenivorans Sphe3]
          Length = 63

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 34/49 (69%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +KN L +E GATA+EYG++V LIAVVII +V  LG  L   F+ ++  I
Sbjct: 15 LKNRLSNEKGATAVEYGIMVGLIAVVIIVAVQLLGTTLDGMFDKVNVTI 63


>gi|134299956|ref|YP_001113452.1| Flp/Fap pilin component [Desulfotomaculum reducens MI-1]
 gi|134052656|gb|ABO50627.1| Flp/Fap pilin component [Desulfotomaculum reducens MI-1]
          Length = 59

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 34/55 (61%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
           ++ N L++E+G    EYGL+++LIAVV + ++TTLG  L   F  ++  +   +
Sbjct: 3  QMLMNLLKEENGQGMAEYGLILALIAVVCVGALTTLGNGLTAKFTDVNAKLTPAA 57


>gi|187923641|ref|YP_001895283.1| Flp/Fap pilin component [Burkholderia phytofirmans PsJN]
 gi|187714835|gb|ACD16059.1| Flp/Fap pilin component [Burkholderia phytofirmans PsJN]
          Length = 59

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 30/57 (52%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
             + FL D  G TAIEYGL+  L+ +VI T+VT +G  +    + +   I   + +
Sbjct: 3  KFAQRFLADNKGVTAIEYGLIAGLVVLVIATAVTNVGTNVSTVLQQVADKITAPAAS 59


>gi|91977982|ref|YP_570641.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB5]
 gi|91684438|gb|ABE40740.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB5]
          Length = 78

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 34/51 (66%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +I+  F++DESGATAIEYGL+ + IA+ II +V  LG  L   F ++   +
Sbjct: 27 NILARFVKDESGATAIEYGLIAAGIALAIIAAVNGLGTALNARFGSVSSQL 77


>gi|148553539|ref|YP_001261121.1| Flp/Fap pilin component [Sphingomonas wittichii RW1]
 gi|148498729|gb|ABQ66983.1| Flp/Fap pilin component [Sphingomonas wittichii RW1]
          Length = 61

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 32/51 (62%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
           +   +D  GATA+EYGL++SLI + I+ +V +LG  ++  +  I + + +
Sbjct: 10 FRALARDCRGATAVEYGLILSLIFMAIMGAVASLGSSVQSRWNDIAERVTS 60


>gi|94309596|ref|YP_582806.1| Flp/Fap pilin component [Cupriavidus metallidurans CH34]
 gi|93353448|gb|ABF07537.1| Flp/Fap pilin component; Putative pilus subunit protein
          [Cupriavidus metallidurans CH34]
          Length = 57

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 30/46 (65%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          F +D  G T+IEY LL +LIA+VII +V+ LG  LK  ++ +   +
Sbjct: 11 FRRDTRGVTSIEYALLGALIAMVIIGAVSLLGTNLKALYDMVAAEV 56


>gi|254561618|ref|YP_003068713.1| Flp/Fap pilin component [Methylobacterium extorquens DM4]
 gi|254268896|emb|CAX24857.1| Flp/Fap pilin component [Methylobacterium extorquens DM4]
          Length = 68

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 31/55 (56%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +I K F+ DESGATAIEYG++ ++I + I+    +    L  AF  +   +   +
Sbjct: 7  NIAKRFISDESGATAIEYGMVAAMIGIAIVGIFASFKTNLTTAFATLGTGLNAQT 61


>gi|92116959|ref|YP_576688.1| Flp/Fap pilin component [Nitrobacter hamburgensis X14]
 gi|91799853|gb|ABE62228.1| Flp/Fap pilin component [Nitrobacter hamburgensis X14]
          Length = 54

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 34/51 (66%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           +  +FL+DESGATAIEY L+ + I+++I+ +VT +G  +   F A+   +
Sbjct: 3  KLTSDFLRDESGATAIEYALIATGISILIVVAVTGIGSSVNGRFTAVGDLL 53


>gi|225174965|ref|ZP_03728962.1| Flp/Fap pilin component [Dethiobacter alkaliphilus AHT 1]
 gi|225169605|gb|EEG78402.1| Flp/Fap pilin component [Dethiobacter alkaliphilus AHT 1]
          Length = 57

 Score = 45.3 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/55 (25%), Positives = 28/55 (50%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +++   +++E G    EYGL++  +A+ +I  +T +G  L   F  I   +V   
Sbjct: 3  NLMMRLVREEKGQGLAEYGLILVFVALAVIVGLTAVGTNLNTLFSNIAGRLVAPQ 57


>gi|194288841|ref|YP_002004748.1| flp pilin component [Cupriavidus taiwanensis LMG 19424]
 gi|193222676|emb|CAQ68679.1| Flp pilin component [Cupriavidus taiwanensis LMG 19424]
          Length = 61

 Score = 45.3 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (66%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          + + FL+DE G TAIEYGL+ +LIA+VII SV T+G +L   F  I   + + +
Sbjct: 7  MFQQFLRDEDGVTAIEYGLIAALIAIVIIVSVQTVGTQLNSVFSKIGSYLTSAN 60


>gi|114705460|ref|ZP_01438368.1| probable PilA2 pilus assembly protein [Fulvimarina pelagi
          HTCC2506]
 gi|114540245|gb|EAU43365.1| probable PilA2 pilus assembly protein [Fulvimarina pelagi
          HTCC2506]
          Length = 62

 Score = 45.3 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 30/53 (56%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
               FL++ESGATAIEY L+  +IAV +IT + TLG  +   F  I   +  
Sbjct: 10 KTFARFLKNESGATAIEYALIAGMIAVGLITILGTLGSNMVAGFTKISDEVAG 62


>gi|307943137|ref|ZP_07658482.1| Flp/Fap pilin component [Roseibium sp. TrichSKD4]
 gi|307773933|gb|EFO33149.1| Flp/Fap pilin component [Roseibium sp. TrichSKD4]
          Length = 59

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 36/57 (63%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          +++   L+DE+G T+IEY L+  L+++++I +VT +G  L   FE ++  +   S +
Sbjct: 3  NLLVRLLKDEAGTTSIEYALIGVLLSIIMIGAVTMMGTSLNSMFEGVESGLSIGSSS 59


>gi|15966374|ref|NP_386727.1| hypothetical protein SMc02446 [Sinorhizobium meliloti 1021]
 gi|307313039|ref|ZP_07592666.1| Flp/Fap pilin component [Sinorhizobium meliloti BL225C]
 gi|307321045|ref|ZP_07600451.1| Flp/Fap pilin component [Sinorhizobium meliloti AK83]
 gi|15075645|emb|CAC47200.1| Putative pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|306893320|gb|EFN24100.1| Flp/Fap pilin component [Sinorhizobium meliloti AK83]
 gi|306899358|gb|EFN29992.1| Flp/Fap pilin component [Sinorhizobium meliloti BL225C]
          Length = 57

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 28/55 (50%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          M  ++  L+D  GATA+EYGLL +LI+V ++  +    G L      +   I   
Sbjct: 1  METLRRLLRDHDGATAVEYGLLAALISVGLLIGLQNFSGALLGMLTFVTNTIEAA 55


>gi|313902399|ref|ZP_07835802.1| Flp/Fap pilin component [Thermaerobacter subterraneus DSM 13965]
 gi|313467330|gb|EFR62841.1| Flp/Fap pilin component [Thermaerobacter subterraneus DSM 13965]
          Length = 66

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 33/53 (62%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          VK  L+DE+G   +EYGL+++LIAVV+I ++  + G L   FE +   +   +
Sbjct: 11 VKFRLRDEAGQGMVEYGLIIALIAVVLIGALVAMQGGLSAIFERVSTTLEKAA 63


>gi|21673264|ref|NP_661329.1| hypothetical protein CT0425 [Chlorobium tepidum TLS]
 gi|21646352|gb|AAM71671.1| hypothetical protein CT0425 [Chlorobium tepidum TLS]
          Length = 69

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 27/47 (57%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          ++ + G T IEY L+ SLIAV +I  + T+G  L+  F  +   + T
Sbjct: 23 VKSQKGVTMIEYALIASLIAVAVIAVLLTVGSNLQTVFSYVGSNLTT 69


>gi|325108086|ref|YP_004269154.1| Flp/Fap pilin component [Planctomyces brasiliensis DSM 5305]
 gi|324968354|gb|ADY59132.1| Flp/Fap pilin component [Planctomyces brasiliensis DSM 5305]
          Length = 57

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 33/50 (66%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          VK+F++ E G TA+EY ++++LI VV +T+V  +G      FE++  A+ 
Sbjct: 8  VKHFIECEDGPTAVEYAVMLALIVVVCLTAVRAIGTNANTQFESVRDALS 57


>gi|329847250|ref|ZP_08262278.1| flp/Fap pilin component family protein [Asticcacaulis
          biprosthecum C19]
 gi|328842313|gb|EGF91882.1| flp/Fap pilin component family protein [Asticcacaulis
          biprosthecum C19]
          Length = 56

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 30/49 (61%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKA 53
          +++ F+ DE GATAIEYGL+  L+ + ++ ++T  G      +E I  +
Sbjct: 1  MLRRFIADERGATAIEYGLVAGLLFLGVVGAITAYGDAFTTMYEGIRDS 49


>gi|167566928|ref|ZP_02359844.1| putative pilus subunit protein [Burkholderia oklahomensis EO147]
 gi|167573997|ref|ZP_02366871.1| putative pilus subunit protein [Burkholderia oklahomensis C6786]
          Length = 56

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 34/52 (65%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +  VK F++DE G +AIEYGL+ +LIA+VII SV T+G  L   F  I   +
Sbjct: 5  VQYVKQFVRDEGGVSAIEYGLIAALIAIVIIGSVKTVGTNLNSVFSTIGNDL 56


>gi|218462815|ref|ZP_03502906.1| putative pilus component protein [Rhizobium etli Kim 5]
 gi|218661044|ref|ZP_03516974.1| putative pilus component protein [Rhizobium etli IE4771]
          Length = 55

 Score = 45.0 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 30/55 (54%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          M ++K F  D +GATA+EYGL+ +LI   +++ +    G L+  F  +   I   
Sbjct: 1  MRLLKAFFADGTGATAVEYGLIAALICTALVSGLGFFTGSLQNVFSLLSNNITVN 55


>gi|239905276|ref|YP_002952015.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
 gi|239905277|ref|YP_002952016.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
 gi|239905278|ref|YP_002952017.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
 gi|239905279|ref|YP_002952018.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
 gi|239905280|ref|YP_002952019.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
 gi|239795140|dbj|BAH74129.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
 gi|239795141|dbj|BAH74130.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
 gi|239795142|dbj|BAH74131.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
 gi|239795143|dbj|BAH74132.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
 gi|239795144|dbj|BAH74133.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
          Length = 55

 Score = 45.0 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 37/54 (68%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          +  +  F++DE GATA+EYGL+ +LIA VIIT+VT++G  L   F  +  ++ +
Sbjct: 2  LTAITQFIRDEEGATAVEYGLMAALIAAVIITAVTSIGTNLTTTFNTVATSLGS 55


>gi|329888706|ref|ZP_08267304.1| flp/Fap pilin component family protein [Brevundimonas diminuta
          ATCC 11568]
 gi|328847262|gb|EGF96824.1| flp/Fap pilin component family protein [Brevundimonas diminuta
          ATCC 11568]
          Length = 60

 Score = 45.0 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 30/57 (52%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
           +  F +DE GATAIEYGL+  LI +VII +V+    +    ++ I   I      A
Sbjct: 4  FICRFHRDEGGATAIEYGLICGLIFLVIIAAVSAFAARSTAMYDYISTTISGAIGGA 60


>gi|114797760|ref|YP_761694.1| flp/Fap pilus protein [Hyphomonas neptunium ATCC 15444]
 gi|114737934|gb|ABI76059.1| flp/fap pilus protein [Hyphomonas neptunium ATCC 15444]
          Length = 57

 Score = 45.0 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 29/57 (50%), Positives = 38/57 (66%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          +   FL+DESGATAIEYGL+ +LIAV II  V+ LG ++   F+ I+K I T    A
Sbjct: 1  MFARFLKDESGATAIEYGLIAALIAVAIIGGVSALGTQVDTTFDEIEKGIRTGEAPA 57


>gi|114797894|ref|YP_761847.1| flp/Fap pilus protein [Hyphomonas neptunium ATCC 15444]
 gi|114738068|gb|ABI76193.1| flp/fap pilus protein [Hyphomonas neptunium ATCC 15444]
          Length = 59

 Score = 45.0 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 29/53 (54%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          ++    +DE GATAIEYGL+  L+ + II  VT       + ++ ++  +V  
Sbjct: 7  LMLRLARDERGATAIEYGLIAGLMVLAIIGGVTAFADANNEIYQTVEDNLVQA 59


>gi|146338126|ref|YP_001203174.1| putative Flp/Fap pilin component [Bradyrhizobium sp. ORS278]
 gi|146190932|emb|CAL74937.1| putative Flp/Fap pilin component [Bradyrhizobium sp. ORS278]
          Length = 46

 Score = 45.0 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 32/45 (71%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++DESGATAIEYGL+ + I++ II +V  LG  L   F +I+ ++
Sbjct: 1  MKDESGATAIEYGLIAAGISLAIIAAVNGLGSSLSSKFGSINSSL 45


>gi|218530763|ref|YP_002421579.1| Flp/Fap pilin component [Methylobacterium chloromethanicum CM4]
 gi|218523066|gb|ACK83651.1| Flp/Fap pilin component [Methylobacterium chloromethanicum CM4]
          Length = 56

 Score = 44.6 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
            +  F + ESGATAIEYGL  + I + +I +    G  L   F  I
Sbjct: 3  RSLVRFARHESGATAIEYGLASTFIGIAVIGAFRAYGTALGSFFPKI 49


>gi|152985381|ref|YP_001350209.1| hypothetical protein PSPA7_4873 [Pseudomonas aeruginosa PA7]
 gi|150960539|gb|ABR82564.1| hypothetical protein PSPA7_4873 [Pseudomonas aeruginosa PA7]
          Length = 72

 Score = 44.6 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 4/61 (6%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSV----TTLGGKLKKAFEAIDKAIVTTSPAA 61
           + FL DE GA AIEY ++  LIAV +I  +    + + G LK  F+ + + +   +P+A
Sbjct: 12 FRAFLADEEGANAIEYAVIAGLIAVALIAVLSPTDSGIVGGLKAFFDGVGEKVGGLAPSA 71

Query: 62 S 62
          +
Sbjct: 72 N 72


>gi|75675346|ref|YP_317767.1| Flp/Fap pilin component [Nitrobacter winogradskyi Nb-255]
 gi|74420216|gb|ABA04415.1| Flp/Fap pilin component [Nitrobacter winogradskyi Nb-255]
          Length = 57

 Score = 44.6 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
                L D SGATAIEY L+ S I++VI+ +V+ +GG L+  F+A++  +
Sbjct: 6  KFASELLWDTSGATAIEYALIASGISIVIVAAVSGIGGSLRDRFDALNGLL 56


>gi|304322119|ref|YP_003855762.1| hypothetical protein PB2503_12914 [Parvularcula bermudensis
          HTCC2503]
 gi|303301021|gb|ADM10620.1| hypothetical protein PB2503_12914 [Parvularcula bermudensis
          HTCC2503]
          Length = 54

 Score = 44.6 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTT-LGGKLKKAFEAIDKAIVTTS 58
          +K FL DE GATA+EYGL+V++IAV ++ +V    G +L+KAF         T+
Sbjct: 1  MKWFLSDEEGATAMEYGLIVAIIAVALVVAVQGETGTRLQKAFNDAASGFDGTT 54


>gi|294102195|ref|YP_003554053.1| Flp/Fap pilin component [Aminobacterium colombiense DSM 12261]
 gi|293617175|gb|ADE57329.1| Flp/Fap pilin component [Aminobacterium colombiense DSM 12261]
          Length = 53

 Score = 44.6 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 34/52 (65%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +  ++N + DE G   +EYGLL++LIAVV+I ++ TLG K+   F  ++  +
Sbjct: 2  LKRLRNLVTDEEGQGMVEYGLLLALIAVVVIAALLTLGPKVAGIFTEVEGKL 53


>gi|167821370|ref|ZP_02453050.1| hypothetical protein Bpse9_39988 [Burkholderia pseudomallei 91]
 gi|167899809|ref|ZP_02487210.1| hypothetical protein Bpse7_39160 [Burkholderia pseudomallei 7894]
 gi|167924328|ref|ZP_02511419.1| hypothetical protein BpseBC_37578 [Burkholderia pseudomallei
          BCC215]
 gi|254187139|ref|ZP_04893654.1| Flp/Fap pilin [Burkholderia pseudomallei Pasteur 52237]
 gi|254296480|ref|ZP_04963936.1| Flp/Fap pilin [Burkholderia pseudomallei 406e]
 gi|157806473|gb|EDO83643.1| Flp/Fap pilin [Burkholderia pseudomallei 406e]
 gi|157934822|gb|EDO90492.1| Flp/Fap pilin [Burkholderia pseudomallei Pasteur 52237]
          Length = 48

 Score = 44.6 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 29/47 (61%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
            L+DES  +AIEY L+ SLIA+VII +V  +G  L+  F  +   +
Sbjct: 2  RRLRDESAVSAIEYALIASLIAIVIIGAVQVVGTNLQSVFSTVASDV 48


>gi|113866748|ref|YP_725237.1| flp pilus assembly protein, pilin Flp [Ralstonia eutropha H16]
 gi|113525524|emb|CAJ91869.1| flp pilus assembly protein, pilin Flp [Ralstonia eutropha H16]
          Length = 57

 Score = 44.6 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 22/48 (45%), Positives = 32/48 (66%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          K+FL+D+ G ++IEY LL SLIA+ I+ SV TL   +K  +E I   +
Sbjct: 9  KDFLRDDWGVSSIEYALLGSLIAMAIVVSVATLSNAVKAMYELIASRM 56


>gi|326387192|ref|ZP_08208802.1| hypothetical protein Y88_1242 [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326208373|gb|EGD59180.1| hypothetical protein Y88_1242 [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 69

 Score = 44.6 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 29/57 (50%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
           ++     DESGATAIEYGL+ +LIA   I ++ +LG  L   F  +   +      
Sbjct: 11 DLLARIGNDESGATAIEYGLIAALIATGAIVAMGSLGNSLSNTFSLVSTDMGKAQSG 67


>gi|153009816|ref|YP_001371031.1| Flp/Fap pilin component [Ochrobactrum anthropi ATCC 49188]
 gi|151561704|gb|ABS15202.1| Flp/Fap pilin component [Ochrobactrum anthropi ATCC 49188]
          Length = 59

 Score = 44.6 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 36/55 (65%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
           ++  F + ESGATAIEYGL+ +LIAVVII + T+LG  ++  F AI  AI    
Sbjct: 3  KLIARFRKSESGATAIEYGLIAALIAVVIIGATTSLGTTIRTQFTAIATAIGGAG 57


>gi|23016176|ref|ZP_00055935.1| COG3847: Flp pilus assembly protein, pilin Flp [Magnetospirillum
          magnetotacticum MS-1]
          Length = 57

 Score = 44.6 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 30/50 (60%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++    +DE GATAIEYGL+ +LI+VV I  +  LG KL   F  I   +
Sbjct: 8  MIAKMARDEQGATAIEYGLIAALISVVAIPGMLVLGPKLSTLFTTISGNM 57


>gi|222524696|ref|YP_002569167.1| Flp/Fap pilin component [Chloroflexus sp. Y-400-fl]
 gi|222448575|gb|ACM52841.1| Flp/Fap pilin component [Chloroflexus sp. Y-400-fl]
          Length = 52

 Score = 44.6 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 29/52 (55%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          ++++F   E G   +EY L++ LIAVV+I ++T LG  +   F  +   I  
Sbjct: 1  MLRSFFAKEEGQGLVEYALILVLIAVVVIGALTLLGQNISDLFNNLAGTIQP 52


>gi|148258232|ref|YP_001242817.1| putative Flp/Fap pilin component [Bradyrhizobium sp. BTAi1]
 gi|146410405|gb|ABQ38911.1| Putative Flp/Fap pilin component [Bradyrhizobium sp. BTAi1]
          Length = 54

 Score = 44.6 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 30/40 (75%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKL 43
          +++  F++DESGATAIEYGL+ + I++ II +V  LG  L
Sbjct: 3  NLLARFVKDESGATAIEYGLIAAGISLAIIAAVNGLGTSL 42


>gi|304392389|ref|ZP_07374330.1| Flp/Fap pilin component [Ahrensia sp. R2A130]
 gi|303295493|gb|EFL89852.1| Flp/Fap pilin component [Ahrensia sp. R2A130]
          Length = 51

 Score = 44.6 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 34/51 (66%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          +   FL+DESGATAIEYGLL +LI++V I ++TT+G  L     A   A+ 
Sbjct: 1  MFMKFLKDESGATAIEYGLLAALISIVAIGAMTTIGTNLNTKLGAAGTALT 51


>gi|167566929|ref|ZP_02359845.1| hypothetical protein BoklE_30496 [Burkholderia oklahomensis
          EO147]
 gi|167573998|ref|ZP_02366872.1| hypothetical protein BoklC_29450 [Burkholderia oklahomensis
          C6786]
          Length = 48

 Score = 44.2 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 31/47 (65%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++L+DES  +AIEY L+ SLIA+VII +V  +G  L+  F  +   +
Sbjct: 2  SWLRDESAVSAIEYALIASLIAIVIIGAVQVVGTNLQSVFSTVASDV 48


>gi|332798620|ref|YP_004460119.1| Flp/Fap pilin component [Tepidanaerobacter sp. Re1]
 gi|332696355|gb|AEE90812.1| Flp/Fap pilin component [Tepidanaerobacter sp. Re1]
          Length = 60

 Score = 44.2 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 31/51 (60%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          + +  F  +ESG   +EYGL+++L+AV++I ++  +   L+  F  +  A+
Sbjct: 3  NFLNWFTSEESGQGMVEYGLIIALVAVILIVALQGMTDGLESIFGEVTDAL 53


>gi|328952518|ref|YP_004369852.1| Flp/Fap pilin component [Desulfobacca acetoxidans DSM 11109]
 gi|328452842|gb|AEB08671.1| Flp/Fap pilin component [Desulfobacca acetoxidans DSM 11109]
          Length = 65

 Score = 44.2 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 35/55 (63%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          ++ +  +DE+GATAIEYGL+V ++A  +IT++ T   KL+  F AI+  +     
Sbjct: 4  LLISLWRDEAGATAIEYGLIVGIMAATLITALGTFSEKLESLFSAINTKLSEAES 58


>gi|163758977|ref|ZP_02166063.1| hypothetical protein HPDFL43_04415 [Hoeflea phototrophica DFL-43]
 gi|162283381|gb|EDQ33666.1| hypothetical protein HPDFL43_04415 [Hoeflea phototrophica DFL-43]
          Length = 86

 Score = 44.2 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 32/54 (59%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M+  +    L D +GAT+IEYGL+ +++++ + + V  +G  L  +FE +   +
Sbjct: 1  MRKKLCTRALADRAGATSIEYGLIAAVLSLALFSGVGVIGQSLSTSFERVAANL 54


>gi|115361029|ref|YP_778166.1| Flp/Fap pilin component [Burkholderia ambifaria AMMD]
 gi|115286357|gb|ABI91832.1| Flp/Fap pilin component [Burkholderia ambifaria AMMD]
          Length = 68

 Score = 44.2 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 32/60 (53%)

Query: 2  KMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          +   +  ++ DE G TAIEY LL ++ A V++ SV TL G L+  ++ I   +      A
Sbjct: 6  RADAISRWIDDEQGVTAIEYALLAAMFATVVLGSVVTLKGSLQDMYDMIASVVTVAVDTA 65


>gi|163846875|ref|YP_001634919.1| Flp/Fap pilin component [Chloroflexus aurantiacus J-10-fl]
 gi|163668164|gb|ABY34530.1| Flp/Fap pilin component [Chloroflexus aurantiacus J-10-fl]
          Length = 55

 Score = 44.2 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 29/52 (55%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          ++++F   E G   +EY L++ LIAVV+I ++T LG  +   F  +   I  
Sbjct: 4  MLRSFFAKEEGQGLVEYALILVLIAVVVIGALTLLGQNISDLFNNLAGTIQP 55


>gi|89899598|ref|YP_522069.1| Flp/Fap pilin component [Rhodoferax ferrireducens T118]
 gi|89344335|gb|ABD68538.1| Flp/Fap pilin component [Rhodoferax ferrireducens T118]
          Length = 72

 Score = 44.2 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 31/52 (59%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
             +L DESG TA+EYGLL +LIAV II +++  G  L   ++   + ++  
Sbjct: 20 FAEWLIDESGVTAMEYGLLAALIAVTIIGAISATGTSLTTIYDYWSETVIAA 71


>gi|326404413|ref|YP_004284495.1| putative pilin subunit protein [Acidiphilium multivorum AIU301]
 gi|325051275|dbj|BAJ81613.1| putative pilin subunit protein [Acidiphilium multivorum AIU301]
          Length = 63

 Score = 44.2 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          F +D  G TA+EYGL+ +L+AVVII +   LG  L      ++  + 
Sbjct: 16 FAKDNRGVTAMEYGLIAALMAVVIIAAFGILGNGLGNVMTELNNKLA 62


>gi|56477534|ref|YP_159123.1| pilus assembly protein, pilin component [Aromatoleum aromaticum
          EbN1]
 gi|56313577|emb|CAI08222.1| pilus assembly protein, pilin component [Aromatoleum aromaticum
          EbN1]
          Length = 66

 Score = 44.2 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 32/57 (56%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          + ++K F++D+ G T+IEY LL +LI   I+ SV+ LG  ++  +  +   +     
Sbjct: 10 VELLKGFIEDQDGVTSIEYALLAALIFGAIVVSVSLLGSSVETLYGDVADKVSAAVS 66


>gi|90423304|ref|YP_531674.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB18]
 gi|90105318|gb|ABD87355.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB18]
          Length = 54

 Score = 44.2 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 33/51 (64%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           ++  FL D SGAT++EY L+ + +++VI+ +V T+G  +   + ++  AI
Sbjct: 3  RLLCKFLGDRSGATSLEYALIAAGLSIVILGAVQTIGTAVTAKYTSVGSAI 53


>gi|323702110|ref|ZP_08113778.1| Flp/Fap pilin component [Desulfotomaculum nigrificans DSM 574]
 gi|323532992|gb|EGB22863.1| Flp/Fap pilin component [Desulfotomaculum nigrificans DSM 574]
          Length = 54

 Score = 43.8 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 30/50 (60%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          I+ N L+DE+G    EYGL+++LIA V I +  TLG  +      +++ +
Sbjct: 4  IIMNLLRDENGQGMAEYGLILALIAAVCIVAFKTLGSSINTKMGDVNQQL 53


>gi|53723202|ref|YP_112187.1| pilus subunit protein [Burkholderia pseudomallei K96243]
 gi|76818517|ref|YP_336463.1| putative pilus subunit protein [Burkholderia pseudomallei 1710b]
 gi|126444256|ref|YP_001064071.1| putative pilus subunit protein [Burkholderia pseudomallei 668]
 gi|126456774|ref|YP_001076983.1| putative pilus subunit protein [Burkholderia pseudomallei 1106a]
 gi|134281902|ref|ZP_01768609.1| putative pilus subunit protein [Burkholderia pseudomallei 305]
 gi|167725240|ref|ZP_02408476.1| putative pilus subunit protein [Burkholderia pseudomallei DM98]
 gi|167744170|ref|ZP_02416944.1| putative pilus subunit protein [Burkholderia pseudomallei 14]
 gi|167821369|ref|ZP_02453049.1| putative pilus subunit protein [Burkholderia pseudomallei 91]
 gi|167829708|ref|ZP_02461179.1| putative pilus subunit protein [Burkholderia pseudomallei 9]
 gi|167851177|ref|ZP_02476685.1| putative pilus subunit protein [Burkholderia pseudomallei B7210]
 gi|167899808|ref|ZP_02487209.1| putative pilus subunit protein [Burkholderia pseudomallei 7894]
 gi|167908124|ref|ZP_02495329.1| putative pilus subunit protein [Burkholderia pseudomallei NCTC
          13177]
 gi|167916471|ref|ZP_02503562.1| putative pilus subunit protein [Burkholderia pseudomallei 112]
 gi|167924327|ref|ZP_02511418.1| putative pilus subunit protein [Burkholderia pseudomallei BCC215]
 gi|217424250|ref|ZP_03455749.1| putative pilus subunit protein [Burkholderia pseudomallei 576]
 gi|226194052|ref|ZP_03789653.1| putative pilus subunit protein [Burkholderia pseudomallei
          Pakistan 9]
 gi|237509208|ref|ZP_04521923.1| putative pilin [Burkholderia pseudomallei MSHR346]
 gi|242312447|ref|ZP_04811464.1| putative pilus subunit protein [Burkholderia pseudomallei 1106b]
 gi|254182589|ref|ZP_04889183.1| putative pilus subunit protein [Burkholderia pseudomallei 1655]
 gi|254187140|ref|ZP_04893655.1| putative pilus subunit protein [Burkholderia pseudomallei Pasteur
          52237]
 gi|254192539|ref|ZP_04898978.1| putative pilus subunit protein [Burkholderia pseudomallei S13]
 gi|254262622|ref|ZP_04953487.1| putative pilus subunit protein [Burkholderia pseudomallei 1710a]
 gi|254296479|ref|ZP_04963935.1| putative pilus subunit protein [Burkholderia pseudomallei 406e]
 gi|52213616|emb|CAH39670.1| putative pilus subunit protein [Burkholderia pseudomallei K96243]
 gi|76582990|gb|ABA52464.1| putative pilus subunit protein [Burkholderia pseudomallei 1710b]
 gi|126223747|gb|ABN87252.1| putative pilus subunit protein [Burkholderia pseudomallei 668]
 gi|126230542|gb|ABN93955.1| putative pilus subunit protein [Burkholderia pseudomallei 1106a]
 gi|134246964|gb|EBA47051.1| putative pilus subunit protein [Burkholderia pseudomallei 305]
 gi|157806367|gb|EDO83537.1| putative pilus subunit protein [Burkholderia pseudomallei 406e]
 gi|157934823|gb|EDO90493.1| putative pilus subunit protein [Burkholderia pseudomallei Pasteur
          52237]
 gi|169649297|gb|EDS81990.1| putative pilus subunit protein [Burkholderia pseudomallei S13]
 gi|184213124|gb|EDU10167.1| putative pilus subunit protein [Burkholderia pseudomallei 1655]
 gi|217392715|gb|EEC32738.1| putative pilus subunit protein [Burkholderia pseudomallei 576]
 gi|225933997|gb|EEH29983.1| putative pilus subunit protein [Burkholderia pseudomallei
          Pakistan 9]
 gi|235001413|gb|EEP50837.1| putative pilin [Burkholderia pseudomallei MSHR346]
 gi|242135686|gb|EES22089.1| putative pilus subunit protein [Burkholderia pseudomallei 1106b]
 gi|254213624|gb|EET03009.1| putative pilus subunit protein [Burkholderia pseudomallei 1710a]
          Length = 56

 Score = 43.8 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 34/52 (65%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +  VK F++DE G +AIEYGL+ +LIA+VII +V T+G  L   F  I   +
Sbjct: 5  VQYVKQFVRDEGGVSAIEYGLIAALIAIVIIGAVKTVGTNLNSVFSTIGNDL 56


>gi|304393805|ref|ZP_07375730.1| phosphoribosyl-AMP cyclohydrolase [Ahrensia sp. R2A130]
 gi|303294004|gb|EFL88379.1| phosphoribosyl-AMP cyclohydrolase [Ahrensia sp. R2A130]
          Length = 65

 Score = 43.8 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 31/62 (50%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          +K    K F  DE GATAIEYGL   +IA+  I  ++  G   K+      + +  +S  
Sbjct: 2  LKRGFTKRFAGDERGATAIEYGLAAGMIALAAIGGMSAAGEGTKRPLNCAGETLQASSKG 61

Query: 61 AS 62
          +S
Sbjct: 62 SS 63


>gi|296158790|ref|ZP_06841619.1| Flp/Fap pilin component [Burkholderia sp. Ch1-1]
 gi|295890995|gb|EFG70784.1| Flp/Fap pilin component [Burkholderia sp. Ch1-1]
          Length = 57

 Score = 43.8 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 30/55 (54%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
             + FL++  G TAIEYGL+  L+ +VI  +VT++G  +      +   IV  S
Sbjct: 3  KFTQRFLKENKGVTAIEYGLIAGLVVIVIAGAVTSVGANISTVMTKVANLIVAPS 57


>gi|297618084|ref|YP_003703243.1| Flp/Fap pilin component [Syntrophothermus lipocalidus DSM 12680]
 gi|297145921|gb|ADI02678.1| Flp/Fap pilin component [Syntrophothermus lipocalidus DSM 12680]
          Length = 53

 Score = 43.8 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 33/52 (63%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          + +VK  L +E G    EYGL+++L+A+ +IT +  +GG +K  F+ +  A+
Sbjct: 2  LSLVKRLLVEEEGQGMAEYGLILALVAIAVITVLGLMGGSIKDKFQEVIDAL 53


>gi|219848813|ref|YP_002463246.1| Flp/Fap pilin component [Chloroflexus aggregans DSM 9485]
 gi|219543072|gb|ACL24810.1| Flp/Fap pilin component [Chloroflexus aggregans DSM 9485]
          Length = 52

 Score = 43.8 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 29/52 (55%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          ++++F   E G   +EY L++ LIAVV+I ++T LG  +   F  +   I  
Sbjct: 1  MLRSFFAKEEGQGLVEYALILVLIAVVVIGALTALGTNISGLFSQLADTIQP 52


>gi|154250686|ref|YP_001411510.1| Flp/Fap pilin component [Parvibaculum lavamentivorans DS-1]
 gi|154154636|gb|ABS61853.1| Flp/Fap pilin component [Parvibaculum lavamentivorans DS-1]
          Length = 54

 Score = 43.8 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 27/52 (51%), Positives = 37/52 (71%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
            +K+F+++ESGATAIEYGL+ + IAVVII +V ++G  L   F AI  AI 
Sbjct: 3  QFLKSFVKNESGATAIEYGLIAAGIAVVIIVAVDSVGAALITQFTAIATAIN 54


>gi|145219386|ref|YP_001130095.1| Flp/Fap pilin component [Prosthecochloris vibrioformis DSM 265]
 gi|145205550|gb|ABP36593.1| Flp/Fap pilin component [Chlorobium phaeovibrioides DSM 265]
          Length = 74

 Score = 43.8 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 28/48 (58%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          ++ + GAT IEY L+  L++V +I +VT +G  +   F  I  A+ T 
Sbjct: 23 VKSQKGATMIEYALIAGLVSVAVIGAVTLIGTDVNLVFGEITDALETV 70


>gi|194335911|ref|YP_002017705.1| Flp/Fap pilin component [Pelodictyon phaeoclathratiforme BU-1]
 gi|194308388|gb|ACF43088.1| Flp/Fap pilin component [Pelodictyon phaeoclathratiforme BU-1]
          Length = 81

 Score = 43.8 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          ++ + G T IEY L+  LI+V  I +VT +G  L + FE I  A+  
Sbjct: 34 IRSQKGVTMIEYALIAGLISVATIAAVTLIGTSLNEVFEKISDALDG 80


>gi|218508205|ref|ZP_03506083.1| putative pilus component protein [Rhizobium etli Brasil 5]
 gi|327193400|gb|EGE60300.1| putative pilus component protein [Rhizobium etli CNPAF512]
          Length = 55

 Score = 43.8 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 30/55 (54%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          M ++K F  D +GATA+EYGL+ ++I   +++ +    G L+  F  +   I   
Sbjct: 1  MRLLKAFFADGTGATAVEYGLIAAVICTALVSGLGFFTGSLQNVFSVVSNNITVN 55


>gi|197118223|ref|YP_002138650.1| Flp/Fap pilin [Geobacter bemidjiensis Bem]
 gi|197087583|gb|ACH38854.1| Flp/Fap pilin [Geobacter bemidjiensis Bem]
          Length = 63

 Score = 43.8 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 35/52 (67%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          +++ LQD+ GAT +EYGL+++LIA V +T V ++G + +  F+ I  A+   
Sbjct: 11 MRSKLQDQKGATMVEYGLMLALIAAVCVTVVGSIGTQAESTFQTIVDALTPA 62


>gi|119962026|ref|YP_948616.1| hypothetical protein AAur_2907 [Arthrobacter aurescens TC1]
 gi|119948885|gb|ABM07796.1| hypothetical protein AAur_2907 [Arthrobacter aurescens TC1]
          Length = 65

 Score = 43.8 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 35/48 (72%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
           F  +E GATA+EYGLLV+LIA +I+ +V  LG  + K F+ ++KA+V
Sbjct: 18 RFTNEEKGATAVEYGLLVALIAALIVGTVVLLGQDVLKGFDTVEKALV 65


>gi|78060318|ref|YP_366893.1| Flp/Fap pilin component [Burkholderia sp. 383]
 gi|77964868|gb|ABB06249.1| Flp/Fap pilin component [Burkholderia sp. 383]
          Length = 68

 Score = 43.8 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 30/46 (65%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFE 48
          M +V+ ++ DE G T+IEY LL ++ AV ++ +V TL G L   +E
Sbjct: 5  MRVVRRWISDEQGVTSIEYALLGAMFAVAVLGTVVTLKGSLADVYE 50


>gi|311743547|ref|ZP_07717353.1| conserved hypothetical protein [Aeromicrobium marinum DSM 15272]
 gi|311312677|gb|EFQ82588.1| conserved hypothetical protein [Aeromicrobium marinum DSM 15272]
          Length = 90

 Score = 43.4 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 26/44 (59%)

Query: 11 QDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +++ GATA+EY L+V+ IAV ++ +V   G  L   F  +   I
Sbjct: 45 REDKGATAVEYALIVAGIAVGLLVAVQAFGTALATFFTGLGAQI 88


>gi|13475419|ref|NP_106983.1| pilin subunit [Mesorhizobium loti MAFF303099]
 gi|14026171|dbj|BAB52769.1| pilin subunit [Mesorhizobium loti MAFF303099]
          Length = 87

 Score = 43.4 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 33/57 (57%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          M + + F  DE+GA  +EY +L+ +I V +I +V  +G  +   + A++ A+ T + 
Sbjct: 31 MTMTRQFRDDENGAAMVEYTVLLGIITVAVIATVVLVGTWVSGRWTALNSALTTATA 87


>gi|86750604|ref|YP_487100.1| Flp/Fap pilin component [Rhodopseudomonas palustris HaA2]
 gi|86573632|gb|ABD08189.1| Flp/Fap pilin component [Rhodopseudomonas palustris HaA2]
          Length = 54

 Score = 43.4 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 33/51 (64%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           ++  F    SGATAIEY L+ + +++VI+ +V  LG KL  ++ +++ A+
Sbjct: 3  RLISRFTCGTSGATAIEYALIAAGLSIVILVTVNGLGSKLNTSYTSVNTAL 53


>gi|94497282|ref|ZP_01303853.1| hypothetical protein SKA58_07008 [Sphingomonas sp. SKA58]
 gi|94423145|gb|EAT08175.1| hypothetical protein SKA58_07008 [Sphingomonas sp. SKA58]
          Length = 54

 Score = 43.0 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 36/52 (69%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M  V+  L++E GATAIEYGL+ +LIAV  I ++T+LGG LK  F ++   +
Sbjct: 1  MQFVRKMLKNEKGATAIEYGLIAALIAVAAIGAMTSLGGNLKNTFNSVSDNL 52


>gi|316934953|ref|YP_004109935.1| Flp/Fap pilin component [Rhodopseudomonas palustris DX-1]
 gi|315602667|gb|ADU45202.1| Flp/Fap pilin component [Rhodopseudomonas palustris DX-1]
          Length = 54

 Score = 43.0 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 28/51 (54%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           ++  F  D  GAT+IEY L+   I++VI+    TLG  L   + A+  A+
Sbjct: 3  RLISRFRTDTRGATSIEYALIAVGISIVIVGLSATLGTNLAAKYSAVKDAL 53


>gi|119717345|ref|YP_924310.1| Flp/Fap pilin component [Nocardioides sp. JS614]
 gi|119538006|gb|ABL82623.1| Flp/Fap pilin component [Nocardioides sp. JS614]
          Length = 67

 Score = 43.0 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 12 DESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          DE GA+A+EYGLL+  IA VI+  V  LG ++K+ F     ++   + A  
Sbjct: 17 DERGASAVEYGLLIGGIAAVIVVLVFALGDQVKELFTDTCTSVEAKTTAQC 67


>gi|149173516|ref|ZP_01852146.1| hypothetical protein PM8797T_22268 [Planctomyces maris DSM 8797]
 gi|148847698|gb|EDL62031.1| hypothetical protein PM8797T_22268 [Planctomyces maris DSM 8797]
          Length = 57

 Score = 43.0 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 29/56 (51%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          M  +K FL +E G TA+EY ++++ I +V I ++  +G +    FE     +    
Sbjct: 1  MQYLKRFLIEEDGPTAVEYAVMLAAIVMVCIAAIAAIGTRTNDLFENATTEMQNHG 56


>gi|225182001|ref|ZP_03735433.1| Flp/Fap pilin component [Dethiobacter alkaliphilus AHT 1]
 gi|225167286|gb|EEG76105.1| Flp/Fap pilin component [Dethiobacter alkaliphilus AHT 1]
          Length = 59

 Score = 43.0 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 33/52 (63%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          +V+ F  +ESG    EY L+++L+++V I ++  +GG++++ FE I  +   
Sbjct: 4  MVRRFFTEESGQGMTEYALILALVSIVAIGALFAMGGRIEEIFEQITGSFSG 55


>gi|156741109|ref|YP_001431238.1| Flp/Fap pilin component [Roseiflexus castenholzii DSM 13941]
 gi|156232437|gb|ABU57220.1| Flp/Fap pilin component [Roseiflexus castenholzii DSM 13941]
          Length = 52

 Score = 43.0 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 31/51 (60%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          +V++F   E G   +EY L++ LIA+V+I  +T LG ++ + F  I+  + 
Sbjct: 1  MVRSFFAKEEGQGLVEYALILVLIAIVVIGILTLLGNRVSQVFSQINSGLS 51


>gi|239817409|ref|YP_002946319.1| Flp/Fap pilin component [Variovorax paradoxus S110]
 gi|239803986|gb|ACS21053.1| Flp/Fap pilin component [Variovorax paradoxus S110]
          Length = 60

 Score = 43.0 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSV---TTLGGKLKKAFEAIDKAIVTT 57
          +  +  FL+DE GATAIEYG++  L+A+V++ +    T +G  L   F AI   + +T
Sbjct: 2  LRSITRFLRDEEGATAIEYGIIAGLMAIVLVAAFSKTTGIGLALTNMFTAIAGKLPST 59


>gi|220922530|ref|YP_002497832.1| Flp/Fap pilin protein [Methylobacterium nodulans ORS 2060]
 gi|219947137|gb|ACL57529.1| Flp/Fap pilin component [Methylobacterium nodulans ORS 2060]
          Length = 53

 Score = 43.0 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 32/52 (61%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M+ +  FL+DE GA  +EY +L+ ++ V +I ++  +G  +   + A++ A+
Sbjct: 1  MNRLSKFLRDEDGAALVEYTVLLGILLVAVIATIGGVGTWINGKWTALNSAL 52


>gi|168701154|ref|ZP_02733431.1| hypothetical protein GobsU_16634 [Gemmata obscuriglobus UQM 2246]
 gi|168701155|ref|ZP_02733432.1| hypothetical protein GobsU_16639 [Gemmata obscuriglobus UQM 2246]
 gi|168703133|ref|ZP_02735410.1| hypothetical protein GobsU_26621 [Gemmata obscuriglobus UQM 2246]
 gi|168705822|ref|ZP_02738099.1| hypothetical protein GobsU_40192 [Gemmata obscuriglobus UQM 2246]
          Length = 66

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 34/57 (59%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          + NFL+ E G TA+EY ++++LI VV I ++TTLG      F  +  +I   +  A+
Sbjct: 8  LVNFLKAEDGPTAVEYAVMLALIVVVCIAAITTLGSNANSTFSFVGSSIKPPTGGAA 64


>gi|218893399|ref|YP_002442268.1| Type IVb pilin, Flp [Pseudomonas aeruginosa LESB58]
 gi|218773627|emb|CAW29441.1| Type IVb pilin, Flp [Pseudomonas aeruginosa LESB58]
          Length = 70

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSV----TTLGGKLKKAFEAIDKAIVTTSP 59
          ++ FL DE GA AIEY ++  LIAV +I  +    + + G LK  F+ +   +   +P
Sbjct: 12 LRAFLADEEGANAIEYAVIAGLIAVALIAVLSPTDSGIVGGLKAFFDGVGTKVGGLAP 69


>gi|170701159|ref|ZP_02892132.1| Flp/Fap pilin component [Burkholderia ambifaria IOP40-10]
 gi|170133940|gb|EDT02295.1| Flp/Fap pilin component [Burkholderia ambifaria IOP40-10]
          Length = 68

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 29/56 (51%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          +  ++ DE G T+IEY L+ ++ A V++ SV TL   L+  +  I   +      A
Sbjct: 10 ILRWIDDEQGVTSIEYALIAAMFATVVLASVVTLKDSLEDMYNMIASVVTDAVNTA 65


>gi|91976668|ref|YP_569327.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB5]
 gi|91683124|gb|ABE39426.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB5]
          Length = 56

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 27/50 (54%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++  F  D  GAT+IEY ++   I +VI++ V  LG +    +  +  ++
Sbjct: 6  LLSRFFADRRGATSIEYAIIAGGICLVIVSVVNGLGVQTGAMYTNVANSL 55


>gi|146339727|ref|YP_001204775.1| putative Flp/Fap pilin component [Bradyrhizobium sp. ORS278]
 gi|146192533|emb|CAL76538.1| Putative Flp/Fap pilin component [Bradyrhizobium sp. ORS278]
          Length = 54

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 34/51 (66%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           ++ +FL+ ++GAT+IEY ++   +++VI+ +V  LG  L   F +I+ +I
Sbjct: 3  QLIASFLRHQAGATSIEYAIIAGGLSIVILAAVNGLGSGLSSKFTSINSSI 53


>gi|15599502|ref|NP_252996.1| Type IVb pilin, Flp [Pseudomonas aeruginosa PAO1]
 gi|9950529|gb|AAG07694.1|AE004847_1 Type IVb pilin, Flp [Pseudomonas aeruginosa PAO1]
          Length = 72

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 4/61 (6%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSV----TTLGGKLKKAFEAIDKAIVTTSPAA 61
          V+ FL DE GA AIEY ++  LIAV +I  +    + + G LK  F+ + + +   +P A
Sbjct: 12 VRAFLADEEGANAIEYAVIAGLIAVALIAVLSPTDSGIVGGLKAFFDGVGEKVGGLAPTA 71

Query: 62 S 62
          +
Sbjct: 72 N 72


>gi|49082500|gb|AAT50650.1| PA4306 [synthetic construct]
          Length = 73

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 4/61 (6%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSV----TTLGGKLKKAFEAIDKAIVTTSPAA 61
          V+ FL DE GA AIEY ++  LIAV +I  +    + + G LK  F+ + + +   +P A
Sbjct: 12 VRAFLADEEGANAIEYAVIAGLIAVALIAVLSPTDSGIVGGLKAFFDGVGEKVGGLAPTA 71

Query: 62 S 62
          +
Sbjct: 72 N 72


>gi|296282443|ref|ZP_06860441.1| hypothetical protein CbatJ_02425 [Citromicrobium bathyomarinum
          JL354]
          Length = 82

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 33/52 (63%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M I ++ L+DE+G +AIEY ++++LI V ++ ++  LG +   ++     A+
Sbjct: 1  MMITRHLLRDETGTSAIEYAVIMALIGVGLVGALNALGTETANSYSNAAVAL 52


>gi|260462609|ref|ZP_05810815.1| Flp/Fap pilin component [Mesorhizobium opportunistum WSM2075]
 gi|259031515|gb|EEW32785.1| Flp/Fap pilin component [Mesorhizobium opportunistum WSM2075]
          Length = 64

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 33/57 (57%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          M + + F  DE+GA  +EY +L+ +I V +I +V  +G  +   +  ++  + T+SP
Sbjct: 5  MTMTRQFRDDENGAAMVEYTVLLGIITVAVIATVALVGTWVSGKWVTLNSTLTTSSP 61


>gi|254239024|ref|ZP_04932347.1| hypothetical protein PACG_05201 [Pseudomonas aeruginosa C3719]
 gi|254244883|ref|ZP_04938205.1| hypothetical protein PA2G_05756 [Pseudomonas aeruginosa 2192]
 gi|126170955|gb|EAZ56466.1| hypothetical protein PACG_05201 [Pseudomonas aeruginosa C3719]
 gi|126198261|gb|EAZ62324.1| hypothetical protein PA2G_05756 [Pseudomonas aeruginosa 2192]
          Length = 72

 Score = 42.7 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 4/61 (6%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSV----TTLGGKLKKAFEAIDKAIVTTSPAA 61
          ++ FL DE GA AIEY ++  LIAV +I  +    + + G LK  F+ + + +   +P A
Sbjct: 12 LRAFLADEEGANAIEYAVIAGLIAVALIAVLSPTDSGIVGGLKAFFDGVGEKVGGLAPTA 71

Query: 62 S 62
          +
Sbjct: 72 N 72


>gi|322436081|ref|YP_004218293.1| hypothetical protein AciX9_2480 [Acidobacterium sp. MP5ACTX9]
 gi|321163808|gb|ADW69513.1| hypothetical protein AciX9_2480 [Acidobacterium sp. MP5ACTX9]
          Length = 60

 Score = 42.7 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 25/54 (46%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
            +   L+DE+G   IEY L+  LI +  + S      K++ AF +I   +   
Sbjct: 6  QFLNELLRDETGQDLIEYALVAGLIGLGAVVSFGGFENKVRGAFNSIGNQLTNA 59


>gi|302381311|ref|YP_003817134.1| Flp/Fap pilin component [Brevundimonas subvibrioides ATCC 15264]
 gi|302191939|gb|ADK99510.1| Flp/Fap pilin component [Brevundimonas subvibrioides ATCC 15264]
          Length = 57

 Score = 42.7 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          M +++ FL DE GATAIEYG++V  I +VI+   T    K+   F    +A+   +
Sbjct: 1  MSLIRRFLSDERGATAIEYGMIVGAIFLVIVAGATAFSDKVIVMFNRASEAMTAAA 56


>gi|296391005|ref|ZP_06880480.1| Type IVb pilin, Flp [Pseudomonas aeruginosa PAb1]
 gi|313106825|ref|ZP_07793037.1| Type IVb pilin, Flp [Pseudomonas aeruginosa 39016]
 gi|310879539|gb|EFQ38133.1| Type IVb pilin, Flp [Pseudomonas aeruginosa 39016]
          Length = 70

 Score = 42.7 bits (99), Expect = 0.020,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSV----TTLGGKLKKAFEAIDKAIVTTSP 59
          V+ FL DE GA AIEY ++  LIAV +I  +    + + G LK  F+ +   +   +P
Sbjct: 12 VRAFLADEEGANAIEYAVIAGLIAVALIAVLSPTDSGIVGGLKAFFDGVGTKVGGLAP 69


>gi|303241716|ref|ZP_07328213.1| Flp/Fap pilin component [Acetivibrio cellulolyticus CD2]
 gi|303241717|ref|ZP_07328214.1| Flp/Fap pilin component [Acetivibrio cellulolyticus CD2]
 gi|302590717|gb|EFL60468.1| Flp/Fap pilin component [Acetivibrio cellulolyticus CD2]
 gi|302590718|gb|EFL60469.1| Flp/Fap pilin component [Acetivibrio cellulolyticus CD2]
          Length = 60

 Score = 42.7 bits (99), Expect = 0.020,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 30/57 (52%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          M    +K  + ++ G   +EYGL++SLIAV  I ++  LG K+   F  +  +I   
Sbjct: 4  MYFDYLKALVGNKKGQGMVEYGLIISLIAVACIAALVVLGPKIATLFNGVANSITAP 60


>gi|107028252|ref|YP_625347.1| Flp/Fap pilin component [Burkholderia cenocepacia AU 1054]
 gi|116687163|ref|YP_840410.1| Flp/Fap pilin component [Burkholderia cenocepacia HI2424]
 gi|105897416|gb|ABF80374.1| Flp/Fap pilin component [Burkholderia cenocepacia AU 1054]
 gi|116652878|gb|ABK13517.1| Flp/Fap pilin component [Burkholderia cenocepacia HI2424]
          Length = 68

 Score = 42.3 bits (98), Expect = 0.021,   Method: Composition-based stats.
 Identities = 22/48 (45%), Positives = 31/48 (64%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          M + + ++ DE G T+IEY LL S+ AV ++ SV TL G L  A+E I
Sbjct: 5  MRVARGWIADEQGVTSIEYALLASMFAVAVLGSVVTLKGSLGDAYEMI 52


>gi|51891533|ref|YP_074224.1| pilus subunit protein [Symbiobacterium thermophilum IAM 14863]
 gi|51855222|dbj|BAD39380.1| pilus subunit protein [Symbiobacterium thermophilum IAM 14863]
          Length = 63

 Score = 42.3 bits (98), Expect = 0.021,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
           +  +  + G    EYGL+++LIAVV+IT++T L   L K F  +   +  T
Sbjct: 8  FRRLVVRQEGQGMTEYGLIIALIAVVLITTLTGLNKTLDKTFNKVTTQLNNT 59


>gi|322434112|ref|YP_004216324.1| Flp/Fap pilin component [Acidobacterium sp. MP5ACTX9]
 gi|321161839|gb|ADW67544.1| Flp/Fap pilin component [Acidobacterium sp. MP5ACTX9]
          Length = 60

 Score = 42.3 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 30/54 (55%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
           ++ + L+DESG   IEY L+ +LI +  + ++     K+K AF ++  ++   
Sbjct: 6  DLLSDLLEDESGQDLIEYALVAALIGLGAVVAMNGFSTKVKTAFNSVGSSLTNA 59


>gi|172065269|ref|YP_001815981.1| Flp/Fap pilin component [Burkholderia ambifaria MC40-6]
 gi|171997511|gb|ACB68428.1| Flp/Fap pilin component [Burkholderia ambifaria MC40-6]
          Length = 68

 Score = 42.3 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 30/54 (55%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
           ++ D+ G T+IEY L+ +LIA +++ SV TLGG L   +  I   +      A
Sbjct: 12 RWIGDDQGVTSIEYALIGALIATLVMASVMTLGGSLDDTYNMIASVVTDAVNTA 65


>gi|116878541|ref|YP_842255.1| hypothetical protein Pcar_3315 [Pelobacter carbinolicus DSM 2380]
 gi|114843177|gb|ABI81934.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380]
          Length = 59

 Score = 42.3 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 30/49 (61%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAID 51
          M  +++ +  E GAT+ EY ++++LI +V I +++ LG K+   F  + 
Sbjct: 5  MSKLRDLVWKEEGATSPEYAVMLALIIIVCIAAISYLGKKVNNTFNDMA 53


>gi|150397710|ref|YP_001328177.1| Flp/Fap pilin protein [Sinorhizobium medicae WSM419]
 gi|150029225|gb|ABR61342.1| Flp/Fap pilin component [Sinorhizobium medicae WSM419]
          Length = 57

 Score = 42.3 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 25/55 (45%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          M  +K   +D  GAT +EYGLL +LI+V ++  +      L      I   +   
Sbjct: 1  METLKRLFEDRDGATVVEYGLLAALISVGLLIGLQNFSSALLDMLTFITGTLEAA 55


>gi|302185187|ref|ZP_07261860.1| Flp/Fap pilin component [Pseudomonas syringae pv. syringae 642]
          Length = 68

 Score = 42.3 bits (98), Expect = 0.026,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 34/53 (64%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +++F +D+  A+AIEY ++V+++A+V+   VT LG  +K  F  I   +  T+
Sbjct: 14 IQSFFKDKEAASAIEYAVIVAMVALVLFAFVTPLGDAIKGKFNDIVTGLGGTT 66


>gi|296283732|ref|ZP_06861730.1| hypothetical protein CbatJ_08924 [Citromicrobium bathyomarinum
          JL354]
          Length = 62

 Score = 42.3 bits (98), Expect = 0.026,   Method: Composition-based stats.
 Identities = 12/46 (26%), Positives = 27/46 (58%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKA 53
             +DE GATA+EYGL+++L+ + ++ ++ T    +   ++ +   
Sbjct: 7  RLTRDERGATAVEYGLILALVFLAMVGAIGTFSDGVIGTWDTVRTT 52


>gi|170734872|ref|YP_001773986.1| Flp/Fap pilin component [Burkholderia cenocepacia MC0-3]
 gi|169820910|gb|ACA95491.1| Flp/Fap pilin component [Burkholderia cenocepacia MC0-3]
          Length = 68

 Score = 42.3 bits (98), Expect = 0.026,   Method: Composition-based stats.
 Identities = 22/48 (45%), Positives = 31/48 (64%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          M + + ++ DE G T+IEY LL S+ AV ++ SV TL G L  A+E I
Sbjct: 5  MRVARGWIVDEQGVTSIEYALLASMFAVAVLGSVVTLKGSLGDAYEMI 52


>gi|220927008|ref|YP_002502310.1| hypothetical protein Mnod_7268 [Methylobacterium nodulans ORS
          2060]
 gi|219951615|gb|ACL62007.1| conserved hypothetical protein [Methylobacterium nodulans ORS
          2060]
          Length = 66

 Score = 42.3 bits (98), Expect = 0.026,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 29/55 (52%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          ++   V+ FL D +G+TAIEY ++  LI + +  S+   G      + ++   +V
Sbjct: 6  LRARSVRRFLNDGAGSTAIEYAMIAGLIFLAVAVSLNLYGASTGSLYTSLGNKVV 60


>gi|116052340|ref|YP_792651.1| hypothetical protein PA14_55940 [Pseudomonas aeruginosa
          UCBPP-PA14]
 gi|115587561|gb|ABJ13576.1| putative pilus assembly protein [Pseudomonas aeruginosa
          UCBPP-PA14]
          Length = 70

 Score = 42.3 bits (98), Expect = 0.026,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSV----TTLGGKLKKAFEAIDKAIVTTSP 59
          V+ FL DE GA AIEY ++  LIAV +I  +    + + G LK  F+ +   +   +P
Sbjct: 12 VRAFLADEEGANAIEYAVIAGLIAVALIAVLSPTDSGIVGGLKAFFDGVGTKVGGLAP 69


>gi|296121140|ref|YP_003628918.1| Flp/Fap pilin component [Planctomyces limnophilus DSM 3776]
 gi|296013480|gb|ADG66719.1| Flp/Fap pilin component [Planctomyces limnophilus DSM 3776]
          Length = 57

 Score = 41.9 bits (97), Expect = 0.027,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 29/56 (51%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          M  V  FL+ E G TA+EY +++++I +V+IT V+  G      +  I   +    
Sbjct: 1  MESVIRFLRSEDGPTAVEYAVMLAMILLVVITGVSAFGNAQANYWGGIQSDLEGHG 56


>gi|220922529|ref|YP_002497831.1| Flp/Fap pilin protein [Methylobacterium nodulans ORS 2060]
 gi|219947136|gb|ACL57528.1| Flp/Fap pilin component [Methylobacterium nodulans ORS 2060]
          Length = 53

 Score = 41.9 bits (97), Expect = 0.027,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 32/52 (61%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M+ +  FL+DE GA  +EY +L+ ++ V +I ++  +G  +   + A++ A+
Sbjct: 1  MNRLSKFLRDEDGAALVEYTVLLGILLVAVIATIGGVGTWVNGKWTALNSAL 52


>gi|87199922|ref|YP_497179.1| Flp/Fap pilin component [Novosphingobium aromaticivorans DSM
          12444]
 gi|87135603|gb|ABD26345.1| Flp/Fap pilin component [Novosphingobium aromaticivorans DSM
          12444]
          Length = 59

 Score = 41.9 bits (97), Expect = 0.028,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 35/59 (59%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          M + +N L +  GATAIEYGL+ +L+AV  I ++++LG  L   F  +   +   SP A
Sbjct: 1  MKLFRNLLANNEGATAIEYGLIAALVAVAAIGAMSSLGTSLSTTFNNVSTEMDNASPTA 59


>gi|218673962|ref|ZP_03523631.1| putative pilus component protein [Rhizobium etli GR56]
          Length = 62

 Score = 41.9 bits (97), Expect = 0.028,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 32/59 (54%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          M ++K FL D +GATA+EYGL+ ++I   +++ +    G  +K        + +   AA
Sbjct: 1  MRLLKAFLADGTGATAVEYGLIAAVICTALVSGLGLFSGSCQKRLSVSATILPSIEEAA 59


>gi|319785611|ref|YP_004145087.1| Flp/Fap pilin component [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
 gi|317171499|gb|ADV15037.1| Flp/Fap pilin component [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
          Length = 60

 Score = 41.9 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 35/58 (60%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          +++  F++DESGATAIEYGL+ +LIA+ IIT   TLG  L   F  I   +      +
Sbjct: 3  NLIARFVKDESGATAIEYGLIAALIALAIITGAGTLGNALNAKFTNIGSTLNNAPTGS 60


>gi|316933042|ref|YP_004108024.1| Flp/Fap pilin component [Rhodopseudomonas palustris DX-1]
 gi|315600756|gb|ADU43291.1| Flp/Fap pilin component [Rhodopseudomonas palustris DX-1]
          Length = 55

 Score = 41.9 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 35/52 (67%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          +IV  F++DESGATAIEYGL+ + IA+ II +V  +GG+L   F  I   + 
Sbjct: 3  NIVARFIKDESGATAIEYGLIAAGIALAIIAAVQGVGGQLSTNFTKIKDELA 54


>gi|83717167|ref|YP_440451.1| PilA-like protein [Burkholderia thailandensis E264]
 gi|167579108|ref|ZP_02371982.1| PilA-related protein [Burkholderia thailandensis TXDOH]
 gi|167617223|ref|ZP_02385854.1| PilA-related protein [Burkholderia thailandensis Bt4]
 gi|257141098|ref|ZP_05589360.1| PilA-related protein [Burkholderia thailandensis E264]
 gi|83650992|gb|ABC35056.1| PilA-related protein [Burkholderia thailandensis E264]
          Length = 56

 Score = 41.9 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 34/52 (65%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +  VK F+++E G +AIEYGL+ +LIA+VII +V T+G  L   F  I   +
Sbjct: 5  VQYVKQFVREEGGVSAIEYGLIAALIAIVIIGAVKTVGTNLNSVFSTIGSDL 56


>gi|91783007|ref|YP_558213.1| putative pilus subunit protein, PilA like [Burkholderia
          xenovorans LB400]
 gi|91686961|gb|ABE30161.1| Putative pilus subunit protein, PilA like protein [Burkholderia
          xenovorans LB400]
          Length = 55

 Score = 41.9 bits (97), Expect = 0.032,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 29/53 (54%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
             + FL++  G TAIEYGL+  L+ +VI  +V+++G  +      +   I T
Sbjct: 3  KFTQRFLKENKGVTAIEYGLIAGLVVLVIAGAVSSVGSNISAVMTKVASLITT 55


>gi|91788406|ref|YP_549358.1| Flp/Fap pilin component [Polaromonas sp. JS666]
 gi|91697631|gb|ABE44460.1| Flp/Fap pilin component [Polaromonas sp. JS666]
          Length = 67

 Score = 41.9 bits (97), Expect = 0.034,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 37/55 (67%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          M+ ++ F++ E G TAIEYGL+ +LIA+VII +VT +G +L   F ++  A+   
Sbjct: 9  MNFIQKFMRKEDGVTAIEYGLIAALIAIVIIAAVTIVGTQLCIVFNSVATALGGA 63


>gi|224824208|ref|ZP_03697316.1| Flp/Fap pilin component [Lutiella nitroferrum 2002]
 gi|224603627|gb|EEG09802.1| Flp/Fap pilin component [Lutiella nitroferrum 2002]
          Length = 64

 Score = 41.9 bits (97), Expect = 0.034,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 31/57 (54%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          I+ +   D+ G T+IEY LL SLIAVVI++SV  LG  L   F  +   I      A
Sbjct: 7  ILTSLFNDDEGVTSIEYALLGSLIAVVILSSVLGLGTNLTALFANVATQIADAIGGA 63


>gi|283778146|ref|YP_003368901.1| Flp/Fap pilin component [Pirellula staleyi DSM 6068]
 gi|283436599|gb|ADB15041.1| Flp/Fap pilin component [Pirellula staleyi DSM 6068]
          Length = 58

 Score = 41.5 bits (96), Expect = 0.035,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 29/55 (52%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          M  + NFL++E G TA+EY +++++I +V I  V  +G     +       + T 
Sbjct: 1  MQWISNFLREEDGPTAVEYAVMLAMIIMVCIAGVVLIGQAANDSITDSGNKLNTA 55


>gi|90425193|ref|YP_533563.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB18]
 gi|90107207|gb|ABD89244.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisB18]
          Length = 53

 Score = 41.5 bits (96), Expect = 0.035,   Method: Composition-based stats.
 Identities = 27/51 (52%), Positives = 36/51 (70%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +IV  FL+DESGATAIEYGL+ + IA+ IIT+V T+G  L   F +I   +
Sbjct: 3  NIVARFLKDESGATAIEYGLIAAGIALAIITAVNTVGSNLSAKFTSIGSKL 53


>gi|323700356|ref|ZP_08112268.1| Flp/Fap pilin component [Desulfovibrio sp. ND132]
 gi|323460288|gb|EGB16153.1| Flp/Fap pilin component [Desulfovibrio desulfuricans ND132]
          Length = 60

 Score = 41.5 bits (96), Expect = 0.036,   Method: Composition-based stats.
 Identities = 22/60 (36%), Positives = 35/60 (58%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          M  + N ++DE GATAIEYGL+ +LIA  I+ + + LG ++   F+ I   +   +   S
Sbjct: 1  MTKLMNLIRDEEGATAIEYGLIAALIAAGIVAATSALGDQVVSTFDYITGQMSAATTTGS 60


>gi|315497468|ref|YP_004086272.1| flp/fap pilin component [Asticcacaulis excentricus CB 48]
 gi|315415480|gb|ADU12121.1| Flp/Fap pilin component [Asticcacaulis excentricus CB 48]
          Length = 57

 Score = 41.5 bits (96), Expect = 0.036,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 29/55 (52%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          M IV+ FL D+SGATAIEY L+ SL+ +    ++   G   K  +  I   +   
Sbjct: 1  MQIVREFLSDKSGATAIEYALIASLVFLAASGAILAYGESFKNMYSFISAKLTPA 55


>gi|66047616|ref|YP_237457.1| Flp/Fap pilin component [Pseudomonas syringae pv. syringae B728a]
 gi|63258323|gb|AAY39419.1| Flp/Fap pilin component [Pseudomonas syringae pv. syringae B728a]
 gi|330969409|gb|EGH69475.1| Flp/Fap pilin component [Pseudomonas syringae pv. aceris str.
          M302273PT]
          Length = 68

 Score = 41.5 bits (96), Expect = 0.036,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 34/53 (64%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +++F +D+  A+AIEY ++V+++A+V+   VT LG  +K  F  I   +  T+
Sbjct: 14 IQSFFKDKEAASAIEYAVIVAMVALVLFAFVTPLGDAIKGKFNDIVTGLGGTT 66


>gi|197117448|ref|YP_002137875.1| Flp/Fap pilin [Geobacter bemidjiensis Bem]
 gi|197086808|gb|ACH38079.1| Flp/Fap pilin [Geobacter bemidjiensis Bem]
          Length = 64

 Score = 41.5 bits (96), Expect = 0.037,   Method: Composition-based stats.
 Identities = 13/52 (25%), Positives = 29/52 (55%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          K  L++ +G   +EY L++ L+++V+I ++  LG +  K F  +   + +  
Sbjct: 13 KQVLKNTNGQGLVEYALILVLMSIVVIAALKNLGDETNKVFCNVSDRLESGK 64


>gi|197123321|ref|YP_002135272.1| Flp/Fap pilin component [Anaeromyxobacter sp. K]
 gi|196173170|gb|ACG74143.1| Flp/Fap pilin component [Anaeromyxobacter sp. K]
          Length = 59

 Score = 41.5 bits (96), Expect = 0.037,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 27/57 (47%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          +  +K   +DE   TA+EY ++V++I +VII     LG  +   F      +   + 
Sbjct: 2  LQTLKRLWKDEEAPTAVEYAIMVAVIGLVIIIGAAALGTNVNTTFGNAASRVPGGAA 58


>gi|283779849|ref|YP_003370604.1| Flp/Fap pilin component [Pirellula staleyi DSM 6068]
 gi|283438302|gb|ADB16744.1| Flp/Fap pilin component [Pirellula staleyi DSM 6068]
          Length = 62

 Score = 41.5 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 31/55 (56%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          V+ FL  E G TA+EY ++++LI +V +T++  +G      F ++   + +   +
Sbjct: 8  VQRFLVSEDGPTAVEYAVMLALIVIVCLTAIQAIGTNANATFNSVATKLSSGGGS 62


>gi|229588197|ref|YP_002870316.1| hypothetical protein PFLU0649 [Pseudomonas fluorescens SBW25]
 gi|229360063|emb|CAY46917.1| putative membrane protein [Pseudomonas fluorescens SBW25]
          Length = 63

 Score = 41.5 bits (96), Expect = 0.040,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 33/48 (68%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          F Q + GA+ IEY ++V+++A+VI+ + + LG K+K  F+++   + T
Sbjct: 16 FFQRKEGASGIEYAIIVAMVALVIVGAGSGLGTKIKSIFDSVATKMTT 63


>gi|149179075|ref|ZP_01857647.1| hypothetical protein PM8797T_30414 [Planctomyces maris DSM 8797]
 gi|148842066|gb|EDL56457.1| hypothetical protein PM8797T_30414 [Planctomyces maris DSM 8797]
          Length = 57

 Score = 41.5 bits (96), Expect = 0.041,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 32/50 (64%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          +KNFL  E G TA+EY ++++LI +V +T++  +G      FEA+  A+ 
Sbjct: 8  IKNFLVSEDGPTAVEYAVMLALIVIVCLTAIQAVGTNANAKFEAVRDALT 57


>gi|170720036|ref|YP_001747724.1| Flp/Fap pilin component [Pseudomonas putida W619]
 gi|169758039|gb|ACA71355.1| Flp/Fap pilin component [Pseudomonas putida W619]
          Length = 59

 Score = 41.5 bits (96), Expect = 0.041,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 28/49 (57%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          K FL  + GA+ IEY ++ +++AV++   V  + G +   F AI  A+ 
Sbjct: 11 KQFLHRKDGASGIEYAVIAAMVAVILAGFVPGISGNISTMFTAIQTALN 59


>gi|197295149|ref|YP_002153690.1| flp type pilus subunit [Burkholderia cenocepacia J2315]
 gi|195944628|emb|CAR57232.1| flp type pilus subunit [Burkholderia cenocepacia J2315]
          Length = 72

 Score = 41.5 bits (96), Expect = 0.042,   Method: Composition-based stats.
 Identities = 21/48 (43%), Positives = 31/48 (64%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          M + + ++ DE G T+IEY LL S+ A+ ++ SV TL G L  A+E I
Sbjct: 5  MRVARCWIADERGVTSIEYALLASMFAIAVLGSVVTLKGSLGAAYEMI 52


>gi|13474657|ref|NP_106226.1| fimbriae associated protein [Mesorhizobium loti MAFF303099]
 gi|14025412|dbj|BAB52012.1| fimbriae associated protein [Mesorhizobium loti MAFF303099]
          Length = 58

 Score = 41.5 bits (96), Expect = 0.044,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          ++   F++DESGATAIEYGL+ +LIA+ IIT    LG  +   F  I   + ++  
Sbjct: 3  NLFARFVKDESGATAIEYGLIAALIALAIITGAGALGNAINSKFTNIGTTLNSSGS 58


>gi|85859142|ref|YP_461344.1| flp/Fap pilin component [Syntrophus aciditrophicus SB]
 gi|85722233|gb|ABC77176.1| flp/fap pilin component [Syntrophus aciditrophicus SB]
          Length = 54

 Score = 41.5 bits (96), Expect = 0.044,   Method: Composition-based stats.
 Identities = 21/47 (44%), Positives = 30/47 (63%), Gaps = 1/47 (2%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKA-FEAIDKAI 54
          FL+ E GATAIEY L+  LI + I++SV+ LG  +K   ++ I  A 
Sbjct: 7  FLKSEDGATAIEYALIAGLIFLAIVSSVSFLGQSVKTVLYDKIADAF 53


>gi|115523899|ref|YP_780810.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisA53]
 gi|115517846|gb|ABJ05830.1| Flp/Fap pilin component [Rhodopseudomonas palustris BisA53]
          Length = 54

 Score = 41.5 bits (96), Expect = 0.044,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 32/51 (62%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           ++  F+ DE+ AT++EY L+ + I++ I+ +V  +G  + + + AI  AI
Sbjct: 3  RLLSRFVADETAATSLEYALIAAGISITIVGAVQVIGTSVTERYTAIGTAI 53


>gi|322434110|ref|YP_004216322.1| hypothetical protein AciX9_0470 [Acidobacterium sp. MP5ACTX9]
 gi|321161837|gb|ADW67542.1| hypothetical protein AciX9_0470 [Acidobacterium sp. MP5ACTX9]
          Length = 60

 Score = 41.1 bits (95), Expect = 0.047,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 29/49 (59%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
           LQDESG   IEY L+  LI +  + ++T L GK++ +F ++  ++   
Sbjct: 11 LLQDESGQDLIEYALVAGLIGLGAVVAMTGLSGKIQSSFNSVGSSLTNA 59


>gi|27376553|ref|NP_768082.1| pilus assembly protein pilin subunit [Bradyrhizobium japonicum
          USDA 110]
 gi|27349694|dbj|BAC46707.1| pilus assembly protein pilin subunit [Bradyrhizobium japonicum
          USDA 110]
          Length = 54

 Score = 41.1 bits (95), Expect = 0.047,   Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 34/51 (66%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +++  F +DESGATAIEYGL+ + IA+ IIT V  LG  L   F +I  ++
Sbjct: 3  NLIARFAKDESGATAIEYGLIAAGIALAIITVVNNLGSTLNTKFTSISTSL 53


>gi|153833206|ref|ZP_01985873.1| conserved domain protein [Vibrio harveyi HY01]
 gi|148870477|gb|EDL69392.1| conserved domain protein [Vibrio harveyi HY01]
          Length = 68

 Score = 41.1 bits (95), Expect = 0.049,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG--GKLKKAFEAIDKAIVTTS 58
           +  F  DE G TAIEYGL+   +AV++ T+V + G  GKL+ AF+ +  AI T S
Sbjct: 12 FLSKFKNDERGVTAIEYGLIAVAMAVLVTTAVGSDGFIGKLEGAFDQVAGAIDTAS 67


>gi|220913387|ref|YP_002488696.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6]
 gi|219860265|gb|ACL40607.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6]
          Length = 71

 Score = 41.1 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 30/55 (54%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          +   ++F + E GATA EYG+LV+ +A  ++  V+  G  L   ++ +   + T 
Sbjct: 13 LRTFRHFNRSEKGATATEYGILVAFLAFALVLGVSAFGQALNLHYQDMTSDLRTA 67


>gi|27378229|ref|NP_769758.1| PilA2 pilus assembly protein [Bradyrhizobium japonicum USDA 110]
 gi|27351376|dbj|BAC48383.1| bsl3118 [Bradyrhizobium japonicum USDA 110]
          Length = 54

 Score = 41.1 bits (95), Expect = 0.055,   Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 1/52 (1%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGK-LKKAFEAIDKA 53
          M ++K+FL DES ATAIEY L+ + IA+VI+T V   G   L   F +ID A
Sbjct: 1  MALLKSFLADESAATAIEYCLIAAGIALVIVTVVNNTGSALLNNKFNSIDAA 52


>gi|163801680|ref|ZP_02195578.1| hypothetical protein 1103602000597_AND4_09507 [Vibrio sp. AND4]
 gi|159174597|gb|EDP59399.1| hypothetical protein AND4_09507 [Vibrio sp. AND4]
          Length = 70

 Score = 40.7 bits (94), Expect = 0.062,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG--GKLKKAFEAIDKAIVTTSP 59
           +  F +DE G TAIEYGL+   +AVV+  ++ T G  G+L  AF+ ++  I    P
Sbjct: 12 FLSEFNKDERGVTAIEYGLIAVAMAVVLGLALGTDGFIGQLDAAFDEVESTIQGVLP 68


>gi|149184275|ref|ZP_01862593.1| hypothetical protein ED21_26193 [Erythrobacter sp. SD-21]
 gi|148831595|gb|EDL50028.1| hypothetical protein ED21_26193 [Erythrobacter sp. SD-21]
          Length = 60

 Score = 40.7 bits (94), Expect = 0.063,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 37/58 (63%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          M  +    ++E GATAIEYGL+ +LIAV  IT++ +LGG+L   F  +  A+ T + A
Sbjct: 1  MKFINKLRRNEEGATAIEYGLIAALIAVAAITAMQSLGGELTTTFNTVSSAMSTANNA 58


>gi|13472987|ref|NP_104554.1| PilA-like protein [Mesorhizobium loti MAFF303099]
 gi|14023735|dbj|BAB50340.1| PilA [Mesorhizobium loti MAFF303099]
          Length = 59

 Score = 40.7 bits (94), Expect = 0.065,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 32/53 (60%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          ++  FL+DE+GATA+EYGL+V+++++ I+  ++ +   +   F      +   
Sbjct: 4  VLLRFLKDETGATAVEYGLIVAVLSLTIVAGISQVFNSITWLFSDNGSRLANA 56


>gi|320101689|ref|YP_004177280.1| Flp/Fap pilin component [Isosphaera pallida ATCC 43644]
 gi|319748971|gb|ADV60731.1| Flp/Fap pilin component [Isosphaera pallida ATCC 43644]
          Length = 62

 Score = 40.7 bits (94), Expect = 0.067,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          + +FL+ E G TA+EY ++V+LI VV I ++TTLG    + F     A+   + A+
Sbjct: 7  IVDFLKAEDGPTAVEYAVMVALIIVVCIAAITTLGQSANETFTIAGDAVQAGNNAS 62


>gi|307293402|ref|ZP_07573248.1| Flp/Fap pilin component [Sphingobium chlorophenolicum L-1]
 gi|306881468|gb|EFN12684.1| Flp/Fap pilin component [Sphingobium chlorophenolicum L-1]
          Length = 53

 Score = 40.7 bits (94), Expect = 0.067,   Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 34/52 (65%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M  ++  L++E GATAIEYGL+ +LIAV  I +++T+G  LK  F  +   +
Sbjct: 1  MQFIRKMLKNEKGATAIEYGLIAALIAVAAIGAMSTIGTNLKGTFNNVATNL 52


>gi|296121064|ref|YP_003628842.1| Flp/Fap pilin component [Planctomyces limnophilus DSM 3776]
 gi|296013404|gb|ADG66643.1| Flp/Fap pilin component [Planctomyces limnophilus DSM 3776]
          Length = 57

 Score = 40.7 bits (94), Expect = 0.067,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 32/54 (59%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          ++ VK FL  E G TA+EY ++++LI +V +T+V  +G      F+ +   + T
Sbjct: 4  INSVKKFLVSEDGPTAVEYAVMLALIVIVCLTAVQAIGTNAAAKFQNVADTLAT 57


>gi|322419948|ref|YP_004199171.1| Flp/Fap pilin component [Geobacter sp. M18]
 gi|320126335|gb|ADW13895.1| Flp/Fap pilin component [Geobacter sp. M18]
          Length = 64

 Score = 40.7 bits (94), Expect = 0.068,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 31/54 (57%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          + ++  L ++SG   +EY L++ LIA+ +   V TLG +L   +E I+ ++   
Sbjct: 9  NRLRLVLGNDSGQGLVEYALILVLIAIAVFAMVQTLGVQLNGTYEKINTSVDNA 62


>gi|85373828|ref|YP_457890.1| hypothetical protein ELI_05005 [Erythrobacter litoralis HTCC2594]
 gi|84786911|gb|ABC63093.1| hypothetical protein ELI_05005 [Erythrobacter litoralis HTCC2594]
          Length = 66

 Score = 40.7 bits (94), Expect = 0.070,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 33/50 (66%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKA 53
           ++ + LQDE+GATA+EYGL+++L+ + ++ +V  +G +    ++ +   
Sbjct: 7  KLITSLLQDEAGATAVEYGLILALVFLAMVAAVQGVGNETVAMWDHVSST 56


>gi|194366093|ref|YP_002028703.1| Flp/Fap pilin component [Stenotrophomonas maltophilia R551-3]
 gi|194348897|gb|ACF52020.1| Flp/Fap pilin component [Stenotrophomonas maltophilia R551-3]
          Length = 63

 Score = 40.7 bits (94), Expect = 0.076,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          ++ FL++E G TA+EYGLL ++IA V+I        ++K  FE + + +   +  AS
Sbjct: 5  IRRFLKEEDGVTALEYGLLAAVIAGVLIA---LGSTQIKDFFETLFENLTKLADKAS 58


>gi|258405295|ref|YP_003198037.1| Flp/Fap pilin component [Desulfohalobium retbaense DSM 5692]
 gi|257797522|gb|ACV68459.1| Flp/Fap pilin component [Desulfohalobium retbaense DSM 5692]
          Length = 56

 Score = 40.3 bits (93), Expect = 0.081,   Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 29/52 (55%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++ +  F  DE GATA EY +++SLIAVVII +VT LG      F       
Sbjct: 2  LNGLFTFFFDEQGATATEYAIMISLIAVVIIVAVTALGLATNDLFSEAKNEF 53


>gi|300021851|ref|YP_003754462.1| Flp/Fap pilin component [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523672|gb|ADJ22141.1| Flp/Fap pilin component [Hyphomicrobium denitrificans ATCC 51888]
          Length = 58

 Score = 40.3 bits (93), Expect = 0.084,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 33/56 (58%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          M    V+ F  DE+GAT+IEY L+ S++++ I+ ++  + G L   FE++     +
Sbjct: 1  MLPSSVREFAADENGATSIEYALIASIVSIAIVGALMGVKGSLVSVFESVVAGFSS 56


>gi|327540757|gb|EGF27324.1| Flp/Fap pilin component [Rhodopirellula baltica WH47]
          Length = 59

 Score = 40.3 bits (93), Expect = 0.087,   Method: Composition-based stats.
 Identities = 21/49 (42%), Positives = 29/49 (59%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          FL++E G TA+EY +L++LI VV I +VTT+G      F     AI   
Sbjct: 11 FLKEEDGPTAVEYAVLLALIIVVCIGAVTTIGSNANAKFGEAGAAIAAN 59


>gi|296283731|ref|ZP_06861729.1| hypothetical protein CbatJ_08919 [Citromicrobium bathyomarinum
          JL354]
          Length = 57

 Score = 40.3 bits (93), Expect = 0.092,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          M   +  + D+ GATAIEYGL+ +LIAV  IT++ +LG +L   F  +   +   +
Sbjct: 1  MKFFRELMNDDQGATAIEYGLIAALIAVAAITAMGSLGNQLSNTFTTVSTDMAPKA 56


>gi|107028253|ref|YP_625348.1| Flp/Fap pilin component [Burkholderia cenocepacia AU 1054]
 gi|116686246|ref|YP_839493.1| Flp/Fap pilin component [Burkholderia cenocepacia HI2424]
 gi|170734873|ref|YP_001773987.1| Flp/Fap pilin component [Burkholderia cenocepacia MC0-3]
 gi|105897417|gb|ABF80375.1| Flp/Fap pilin component [Burkholderia cenocepacia AU 1054]
 gi|116651961|gb|ABK12600.1| Flp/Fap pilin component [Burkholderia cenocepacia HI2424]
 gi|169820911|gb|ACA95492.1| Flp/Fap pilin component [Burkholderia cenocepacia MC0-3]
          Length = 63

 Score = 40.3 bits (93), Expect = 0.095,   Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 34/53 (64%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
           F++DE G TAIEYGL+ +LIA+ II +++T+G  LK  F  I   + +   A
Sbjct: 10 RFVRDEDGVTAIEYGLIAALIAIGIIAALSTVGKDLKTVFTTIADDLDSAVAA 62


>gi|167584953|ref|ZP_02377341.1| hypothetical protein BuboB_06431 [Burkholderia ubonensis Bu]
          Length = 60

 Score = 40.3 bits (93), Expect = 0.097,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 31/57 (54%)

Query: 2  KMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
           +  V  ++ D+ G TAIEY LL SLIA+ I+ +V TLG  L   +  +   I   +
Sbjct: 4  GIKAVARWIDDKGGVTAIEYALLASLIAMAIVVAVATLGTTLDGVYMDVATRITAAT 60


>gi|294012382|ref|YP_003545842.1| putative pilin Flp [Sphingobium japonicum UT26S]
 gi|292675712|dbj|BAI97230.1| putative pilin Flp [Sphingobium japonicum UT26S]
          Length = 61

 Score = 40.3 bits (93), Expect = 0.10,   Method: Composition-based stats.
 Identities = 12/45 (26%), Positives = 27/45 (60%)

Query: 13 ESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          + GATA+EYGL+++LI + I+ +++ +  K    +  +   ++  
Sbjct: 17 QRGATAVEYGLILALICLAIVGALSNVANKTIGMWNNVATEVLAH 61


>gi|253701798|ref|YP_003022987.1| hypothetical protein GM21_3202 [Geobacter sp. M21]
 gi|251776648|gb|ACT19229.1| conserved hypothetical protein [Geobacter sp. M21]
          Length = 64

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 29/48 (60%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          K  L++ +G   +EY L++ L+A+V+I ++ ++G +  K F  +   I
Sbjct: 13 KQILKNTNGQGLVEYALILVLVAIVVIAALKSIGSETNKVFCNVSDHI 60


>gi|326797324|ref|YP_004315144.1| Flp/Fap pilin component [Marinomonas mediterranea MMB-1]
 gi|326548088|gb|ADZ93308.1| Flp/Fap pilin component [Marinomonas mediterranea MMB-1]
          Length = 65

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG---GKLKKAFEAIDKAIVTTS 58
          +K FL DE G TAIEYG+L + +A  I     + G     LK  F +I   I  T+
Sbjct: 5  IKRFLSDERGVTAIEYGILAAAMAAAIGVIFGSDGVFVTALKDRFSSIADQITNTN 60


>gi|299069502|emb|CBJ40771.1| putative Flp/Fap pilin component [Ralstonia solanacearum CMR15]
          Length = 58

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 28/55 (50%), Positives = 38/55 (69%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          + +  FL+DE GATAIEYGLL  LIA  I  +VTTLG ++K AF ++  AI  ++
Sbjct: 3  NAILQFLRDEQGATAIEYGLLAGLIAAAIAATVTTLGTEIKTAFGSVCTAIKGSA 57


>gi|330953051|gb|EGH53311.1| hypothetical protein PSYCIT7_17084 [Pseudomonas syringae Cit 7]
          Length = 68

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 37/55 (67%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          +++FL+D+ GA+AIEY ++V+++A+V+   VT +G  +K  F  I  A+  T  +
Sbjct: 14 IQSFLKDKEGASAIEYAVIVAMVALVLFAMVTPMGDAVKAQFNKIILALGGTVAS 68


>gi|258405296|ref|YP_003198038.1| Flp/Fap pilin component [Desulfohalobium retbaense DSM 5692]
 gi|257797523|gb|ACV68460.1| Flp/Fap pilin component [Desulfohalobium retbaense DSM 5692]
          Length = 56

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 35/56 (62%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          M  + NF + E GATA+EYGL+V+LIA+VII +VT LG  L   F  +   + +  
Sbjct: 1  MDKLMNFFRAEEGATAVEYGLMVALIAIVIIAAVTFLGNSLNNIFNEVANKVDSAG 56


>gi|328953764|ref|YP_004371098.1| Flp/Fap pilin component [Desulfobacca acetoxidans DSM 11109]
 gi|328454088|gb|AEB09917.1| Flp/Fap pilin component [Desulfobacca acetoxidans DSM 11109]
          Length = 60

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 33/57 (57%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          ++K F+++E GA+A+EY +LV  I  V+I  +    G+L  A ++    I T   A+
Sbjct: 4  LIKKFIREEDGASAVEYAVLVGAIGAVLIAGIYAFYGRLNTAIDSAATKIGTNGGAS 60


>gi|28871964|ref|NP_794583.1| hypothetical protein PSPTO_4849 [Pseudomonas syringae pv. tomato
          str. DC3000]
 gi|213968018|ref|ZP_03396164.1| hypothetical protein PSPTOT1_4617 [Pseudomonas syringae pv.
          tomato T1]
 gi|301383666|ref|ZP_07232084.1| hypothetical protein PsyrptM_13578 [Pseudomonas syringae pv.
          tomato Max13]
 gi|302059965|ref|ZP_07251506.1| hypothetical protein PsyrptK_08235 [Pseudomonas syringae pv.
          tomato K40]
 gi|302131631|ref|ZP_07257621.1| hypothetical protein PsyrptN_09572 [Pseudomonas syringae pv.
          tomato NCPPB 1108]
 gi|28855217|gb|AAO58278.1| conserved protein of unknown function [Pseudomonas syringae pv.
          tomato str. DC3000]
 gi|213927361|gb|EEB60910.1| hypothetical protein PSPTOT1_4617 [Pseudomonas syringae pv.
          tomato T1]
 gi|331014710|gb|EGH94766.1| hypothetical protein PLA106_02360 [Pseudomonas syringae pv.
          lachrymans str. M302278PT]
          Length = 68

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 37/54 (68%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          +++FL+D+  A+AIEY ++V+++A+V+   VT +G  +K  F  I +A+  T+ 
Sbjct: 14 IQSFLKDKEAASAIEYAVIVAMVALVLFAMVTPMGTAIKARFNEIIEALGGTAA 67


>gi|326387727|ref|ZP_08209333.1| hypothetical protein Y88_0641 [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326207773|gb|EGD58584.1| hypothetical protein Y88_0641 [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 61

 Score = 40.0 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 32/60 (53%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          M ++++ L+D  GATA+EYG+LV + ++ II   T    +L   +  + +       A +
Sbjct: 1  MTMLRHILRDTQGATAVEYGILVGIFSIGIIFGFTEFTNQLYNLWLIVGENTDAAVAAHN 60


>gi|283779850|ref|YP_003370605.1| Flp/Fap pilin component [Pirellula staleyi DSM 6068]
 gi|283438303|gb|ADB16745.1| Flp/Fap pilin component [Pirellula staleyi DSM 6068]
          Length = 62

 Score = 40.0 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 14/55 (25%), Positives = 31/55 (56%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          +  FL+ E G TA+EY ++++LI +V +T++  +G      F ++   + +   +
Sbjct: 8  IGRFLKSEDGPTAVEYAVMLALIVIVCLTAIQAIGTNANATFNSVATKLSSGGGS 62


>gi|87312297|ref|ZP_01094395.1| Flp/Fap pilin component [Blastopirellula marina DSM 3645]
 gi|87285001|gb|EAQ76937.1| Flp/Fap pilin component [Blastopirellula marina DSM 3645]
          Length = 67

 Score = 40.0 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 32/54 (59%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          ++NFL  E G TA+EY ++++LI +V +T++  +G +    F  I   + T + 
Sbjct: 8  IQNFLVSEDGPTAVEYAVMLALIVIVCLTAIQAIGTQANATFTKIGNDMSTANA 61


>gi|238027566|ref|YP_002911797.1| Flp/Fap pilin component [Burkholderia glumae BGR1]
 gi|237876760|gb|ACR29093.1| Flp/Fap pilin component [Burkholderia glumae BGR1]
          Length = 65

 Score = 40.0 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 32/56 (57%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          ++  FL++E G TA+EYGL+  L+AV ++ +V  L G +  AF  I   +     A
Sbjct: 4  LINRFLKEEDGVTAVEYGLIAGLMAVALVAAVGVLSGGISNAFSYIAGKLTGLGAA 59


>gi|326387726|ref|ZP_08209332.1| hypothetical protein Y88_0640 [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326207772|gb|EGD58583.1| hypothetical protein Y88_0640 [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 63

 Score = 39.6 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 35/57 (61%)

Query: 2  KMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          K+ I++    D  GATAIEYGL+ +L+AV  I+++  LG  L   F+A+   +  ++
Sbjct: 3  KVRILRQLRDDRRGATAIEYGLIAALVAVAAISAMGALGNGLSNTFQAVANDMSNST 59


>gi|85373827|ref|YP_457889.1| hypothetical protein ELI_05000 [Erythrobacter litoralis HTCC2594]
 gi|84786910|gb|ABC63092.1| hypothetical protein ELI_05000 [Erythrobacter litoralis HTCC2594]
          Length = 54

 Score = 39.6 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 32/53 (60%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          M    N ++DE GATAIEYGL+ +LIAV  I ++  LG +L   F ++   + 
Sbjct: 1  MKFFNNLMKDEQGATAIEYGLIAALIAVAAIVAMQGLGNQLSNTFSSVSTTMS 53


>gi|319782175|ref|YP_004141651.1| Flp/Fap pilin component [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
 gi|317168063|gb|ADV11601.1| Flp/Fap pilin component [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
          Length = 72

 Score = 39.6 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 33/60 (55%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          M + + F  DE+GA  +EY +L+ +IAV  I +V  +GG +   F A+  A+   S  + 
Sbjct: 5  MTMTRQFRDDENGAAMVEYSILIGIIAVASIMTVLAIGGWVNGRFSALCTALEAASVGSC 64


>gi|322434101|ref|YP_004216313.1| Flp/Fap pilin component [Acidobacterium sp. MP5ACTX9]
 gi|321161828|gb|ADW67533.1| Flp/Fap pilin component [Acidobacterium sp. MP5ACTX9]
          Length = 60

 Score = 39.6 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 31/54 (57%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          +++   L DESG   IEY L+  LI +  + ++T L GK++ +F ++  ++   
Sbjct: 6  NVIAALLNDESGQDLIEYALVAGLIGLGAVVAMTGLSGKIQSSFNSVGSSLTNA 59


>gi|312882141|ref|ZP_07741890.1| Flp pilus assembly protein [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309370187|gb|EFP97690.1| Flp pilus assembly protein [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 68

 Score = 39.6 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG--GKLKKAFEAIDKAIVTTS 58
           +  F  DE G TAIEYGL+   +AV++ T+V T G  G+L+ AF ++  AI T  
Sbjct: 12 FLSQFKNDERGVTAIEYGLIAVAMAVLVTTAVGTEGFIGRLETAFTSVATAIETAG 67


>gi|170744075|ref|YP_001772730.1| hypothetical protein M446_6019 [Methylobacterium sp. 4-46]
 gi|168198349|gb|ACA20296.1| hypothetical protein M446_6019 [Methylobacterium sp. 4-46]
          Length = 66

 Score = 39.6 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 28/57 (49%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          ++   V+ FL D SG+TAIEY ++   I + ++  ++  G +    +      +V  
Sbjct: 6  LRAKTVRLFLCDSSGSTAIEYVMIAGFIFLALVGGLSLYGNQTGNLYANFSSQVVNV 62


>gi|162147488|ref|YP_001601949.1| Flp/Fap pilin component [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545595|ref|YP_002277824.1| Flp/Fap pilin component [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786065|emb|CAP55647.1| putative Flp/Fap pilin component [Gluconacetobacter
          diazotrophicus PAl 5]
 gi|209533272|gb|ACI53209.1| Flp/Fap pilin component [Gluconacetobacter diazotrophicus PAl 5]
          Length = 56

 Score = 39.6 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 20/41 (48%), Positives = 28/41 (68%)

Query: 14 SGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
           G TA+EYGL+ +LIA VI+T+V T+G KL   F +I   +
Sbjct: 16 RGVTALEYGLIAALIAAVIMTAVGTIGSKLNTVFSSIGTDL 56


>gi|330873639|gb|EGH07788.1| hypothetical protein PSYMP_04385 [Pseudomonas syringae pv.
          morsprunorum str. M302280PT]
 gi|330963440|gb|EGH63700.1| hypothetical protein PSYAC_02082 [Pseudomonas syringae pv.
          actinidiae str. M302091]
          Length = 68

 Score = 39.6 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 37/55 (67%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          +++FL+D+  A+AIEY ++V+++A+V+   VT +G  +K  F  I  A+  T+ +
Sbjct: 14 IQSFLKDKEAASAIEYAVIVAMVALVLFAMVTPMGTAIKARFNEIITALGGTAAS 68


>gi|170749895|ref|YP_001756155.1| Flp/Fap pilin component [Methylobacterium radiotolerans JCM 2831]
 gi|170656417|gb|ACB25472.1| Flp/Fap pilin component [Methylobacterium radiotolerans JCM 2831]
          Length = 54

 Score = 39.6 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 32/51 (62%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          +   F  DESGATAIEYG++ +LIAV IIT++ T+G  L   F  I   + 
Sbjct: 4  LFTRFASDESGATAIEYGMIAALIAVAIITALKTVGTSLTSKFSQISGNLN 54


>gi|312115331|ref|YP_004012927.1| Flp/Fap pilin component [Rhodomicrobium vannielii ATCC 17100]
 gi|311220460|gb|ADP71828.1| Flp/Fap pilin component [Rhodomicrobium vannielii ATCC 17100]
          Length = 60

 Score = 39.6 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 28/51 (54%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          ++ F  DE GA AIE GL+ +   V +IT    +  ++K  FE + + + +
Sbjct: 5  LEEFWMDEQGAAAIELGLIAAGFCVALITLAGQMNDEVKIMFERVREMLRS 55


>gi|294012383|ref|YP_003545843.1| putative pilin Flp [Sphingobium japonicum UT26S]
 gi|292675713|dbj|BAI97231.1| putative pilin Flp [Sphingobium japonicum UT26S]
          Length = 53

 Score = 39.6 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 35/52 (67%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          M  ++  +++E GATAIEYGL+ +LIAV  I ++++LGGKL   F  +   +
Sbjct: 1  MQFIRKMMKNEKGATAIEYGLIAALIAVAAIGAMSSLGGKLGNTFNNVSGNL 52


>gi|255262164|ref|ZP_05341506.1| hypothetical protein TR2A62_2320 [Thalassiobium sp. R2A62]
 gi|255104499|gb|EET47173.1| hypothetical protein TR2A62_2320 [Thalassiobium sp. R2A62]
          Length = 90

 Score = 39.2 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 21/49 (42%), Positives = 29/49 (59%)

Query: 14 SGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
           GA  IEYGLLV L+AVV   SV+TLG ++   F  +   + + +  AS
Sbjct: 27 RGAALIEYGLLVGLVAVVANGSVSTLGEEIDGTFANVTAELSSNTAGAS 75


>gi|254502513|ref|ZP_05114664.1| Flp/Fap pilin component family [Labrenzia alexandrii DFL-11]
 gi|222438584|gb|EEE45263.1| Flp/Fap pilin component family [Labrenzia alexandrii DFL-11]
          Length = 72

 Score = 39.2 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKL-KKAFEAIDKAIVTTSPAA 61
          ++     + D SGAT +EYGLLV+ +++ I+ +V ++G  +    F+ I   ++T +  A
Sbjct: 10 VNQFTRLIHDRSGATMVEYGLLVATLSIAILLTVGSIGETVRDDIFQVISNVMLTGANEA 69

Query: 62 S 62
          +
Sbjct: 70 A 70


>gi|77456878|ref|YP_346383.1| Flp/Fap pilin component [Pseudomonas fluorescens Pf0-1]
 gi|77380881|gb|ABA72394.1| putative Flp/Fap pilin component [Pseudomonas fluorescens Pf0-1]
          Length = 81

 Score = 39.2 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 27/53 (50%)

Query: 2  KMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++   K  ++D  GA+ IEY ++  ++AV +   VT +   +   F  I  A+
Sbjct: 29 QITFYKGLVKDTEGASGIEYAIIAGMVAVALAAFVTPISTAITTMFNTIQAAL 81


>gi|220913378|ref|YP_002488687.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6]
 gi|219860256|gb|ACL40598.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6]
          Length = 66

 Score = 39.2 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 28/51 (54%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          VK+    E GATA EY LLV+ IA++II  VT  G  L   F  +   + T
Sbjct: 15 VKDRFSSEKGATATEYSLLVAFIALLIIAGVTLFGNALSGWFSTLGSRVGT 65


>gi|116748926|ref|YP_845613.1| Flp/Fap pilin component [Syntrophobacter fumaroxidans MPOB]
 gi|116697990|gb|ABK17178.1| Flp/Fap pilin component [Syntrophobacter fumaroxidans MPOB]
          Length = 57

 Score = 39.2 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 33/55 (60%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          M     FL+DE G TAIEYGL+ +LIAV II +VT++G  L   F  +   ++  
Sbjct: 1  MKKFIKFLKDEEGVTAIEYGLIAALIAVAIIVAVTSVGTNLTAVFNRVAAELLGA 55


>gi|332185257|ref|ZP_08387006.1| flp/Fap pilin component family protein [Sphingomonas sp. S17]
 gi|332014981|gb|EGI57037.1| flp/Fap pilin component family protein [Sphingomonas sp. S17]
          Length = 57

 Score = 39.2 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 34/55 (61%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          M+ ++  +++  GATAIEYGL+ +L+AV  I  ++ LGG L  AF  I   + T 
Sbjct: 1  MNTLRKMVKNNKGATAIEYGLIAALVAVAAIAGMSKLGGSLGTAFNTIGGKLDTN 55


>gi|260461952|ref|ZP_05810197.1| Flp/Fap pilin component [Mesorhizobium opportunistum WSM2075]
 gi|259032199|gb|EEW33465.1| Flp/Fap pilin component [Mesorhizobium opportunistum WSM2075]
          Length = 58

 Score = 39.2 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          ++   F++DESGATAIEYGL+ +LIA+ IIT    LG  +   F  I   + ++  
Sbjct: 3  NLFARFVKDESGATAIEYGLIAALIALAIITGAGALGNAINAKFTTIGTTLNSSGA 58


>gi|156977412|ref|YP_001448318.1| Flp pilus assembly protein [Vibrio harveyi ATCC BAA-1116]
 gi|156529006|gb|ABU74091.1| hypothetical protein VIBHAR_06199 [Vibrio harveyi ATCC BAA-1116]
          Length = 68

 Score = 39.2 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG--GKLKKAFEAIDKAIVTTS 58
           +  F  DE G TAIEYGL+   +AV++ T+V+  G  G L+ AFE +  AI    
Sbjct: 12 FLSKFKNDERGVTAIEYGLIAVAMAVLVTTAVSPSGFIGSLEAAFEQVATAISNAG 67


>gi|153008056|ref|YP_001369271.1| Flp/Fap pilin component [Ochrobactrum anthropi ATCC 49188]
 gi|151559944|gb|ABS13442.1| Flp/Fap pilin component [Ochrobactrum anthropi ATCC 49188]
          Length = 60

 Score = 39.2 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 32/48 (66%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFE 48
          M   ++  F+++ +G+TAIEY L+ +L++++II+ V  + G + + F 
Sbjct: 1  MMPTLMTRFMKNRAGSTAIEYALIGTLVSIMIISGVALVAGNVGEKFN 48


>gi|84385687|ref|ZP_00988718.1| hypothetical protein V12B01_26174 [Vibrio splendidus 12B01]
 gi|84379667|gb|EAP96519.1| hypothetical protein V12B01_26174 [Vibrio splendidus 12B01]
          Length = 68

 Score = 39.2 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG--GKLKKAFEAIDKAIVTTSP 59
           +  F  DE G TAIEYGL+   +AV++ T+V   G  GKL+ AF  +  AI T S 
Sbjct: 12 FLSQFKNDERGVTAIEYGLIAVAMAVLVTTAVGADGFIGKLEAAFTKVGDAITTASS 68


>gi|170741514|ref|YP_001770169.1| Flp/Fap pilin component [Methylobacterium sp. 4-46]
 gi|168195788|gb|ACA17735.1| Flp/Fap pilin component [Methylobacterium sp. 4-46]
          Length = 51

 Score = 39.2 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 36/50 (72%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++K+F  DESGATAIEYGLL +LIA+ +I + +++G  L  AF+ +   +
Sbjct: 1  MIKSFFYDESGATAIEYGLLAALIAIALIAAASSVGTNLGTAFQNVAGNL 50


>gi|194288840|ref|YP_002004747.1| flp pilin component [Cupriavidus taiwanensis LMG 19424]
 gi|193222675|emb|CAQ68678.1| Flp pilin component [Cupriavidus taiwanensis LMG 19424]
          Length = 57

 Score = 39.2 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 31/49 (63%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +     D++G T+IEY LL  LIAV I+++V+T+G  +K  +E I   +
Sbjct: 8  ISKLSHDDAGVTSIEYALLGMLIAVAIVSTVSTVGDAVKLMYEMIASRM 56


>gi|294012241|ref|YP_003545701.1| Flp pilus assembly protein pilin Flp [Sphingobium japonicum
          UT26S]
 gi|292675571|dbj|BAI97089.1| Flp pilus assembly protein pilin Flp [Sphingobium japonicum
          UT26S]
          Length = 65

 Score = 38.8 bits (89), Expect = 0.23,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 30/60 (50%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          M+ ++N   D SGA+A EY L+++++   I  +   LG  +  A       I +   +++
Sbjct: 1  MNFLRNLWNDHSGASAAEYALILAIVGTGIALAAVGLGESISTAMNEASNCIKSPPTSST 60


>gi|320103318|ref|YP_004178909.1| hypothetical protein Isop_1777 [Isosphaera pallida ATCC 43644]
 gi|319750600|gb|ADV62360.1| hypothetical protein Isop_1777 [Isosphaera pallida ATCC 43644]
          Length = 77

 Score = 38.8 bits (89), Expect = 0.23,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 22/42 (52%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
           +     E  AT+IEY +++ LI + +I S+ T GG     +
Sbjct: 7  FRRLHHQEEAATSIEYAVMLLLILLAVIGSIQTFGGSNNGVW 48


>gi|82703480|ref|YP_413046.1| Flp/Fap pilin component [Nitrosospira multiformis ATCC 25196]
 gi|82411545|gb|ABB75654.1| Flp/Fap pilin component [Nitrosospira multiformis ATCC 25196]
          Length = 60

 Score = 38.8 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 32/52 (61%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          +K FL DE G TAIEY L+ +LIAV IIT+V  +G  L   F AI  A+   
Sbjct: 8  MKQFLNDEEGVTAIEYALIAALIAVAIITAVRQVGTDLNLVFGAISTALSGA 59


>gi|78186673|ref|YP_374716.1| pilus assembly protein PilA [Chlorobium luteolum DSM 273]
 gi|78166575|gb|ABB23673.1| pilus assembly protein PilA [Chlorobium luteolum DSM 273]
          Length = 60

 Score = 38.8 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 28/49 (57%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +  + G T IEY L+ +L+AVV+IT++  +G  L   F  I  A+   +
Sbjct: 8  ITSQKGVTMIEYALIAALVAVVVITALGLVGENLTTIFTTISDALSGAA 56


>gi|330938337|gb|EGH41969.1| hypothetical protein PSYPI_05933 [Pseudomonas syringae pv. pisi
          str. 1704B]
          Length = 68

 Score = 38.8 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 34/54 (62%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          +++FL+D+  A+AIEY ++V+++A+V+   VT +G  +K  F  I   +   + 
Sbjct: 14 IQSFLKDKEAASAIEYAVIVAMVALVLFAMVTPMGDAVKGQFNKIIGVLGGKAA 67


>gi|220913379|ref|YP_002488688.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6]
 gi|219860257|gb|ACL40599.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6]
          Length = 66

 Score = 38.8 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 28/51 (54%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          ++N +  E GATA EY LLV+ IA++II  VT  G  L   F  +   +  
Sbjct: 15 LRNRMDSEKGATATEYSLLVAFIALLIIAGVTLFGNALSAWFSTLGSTVGA 65


>gi|16125085|ref|NP_419649.1| hypothetical protein CC_0832 [Caulobacter crescentus CB15]
 gi|221233812|ref|YP_002516248.1| Flp/Fap pilin component protein [Caulobacter crescentus NA1000]
 gi|13422083|gb|AAK22817.1| hypothetical protein CC_0832 [Caulobacter crescentus CB15]
 gi|220962984|gb|ACL94340.1| Flp/Fap pilin component protein [Caulobacter crescentus NA1000]
          Length = 57

 Score = 38.8 bits (89), Expect = 0.27,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 33/53 (62%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
            +  F +D+SGATA+E G++V LI++ +I ++T L   +K AF     A+ +
Sbjct: 5  RPLSAFWRDQSGATAVEVGVIVVLISIALIGAITVLSDGIKTAFTKSADAMGS 57


>gi|326387837|ref|ZP_08209443.1| hypothetical protein Y88_0751 [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326207883|gb|EGD58694.1| hypothetical protein Y88_0751 [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 60

 Score = 38.8 bits (89), Expect = 0.27,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 34/58 (58%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          M  +K+  +DE+GATAIEYGL+ +LIAV  IT++  LG  L   F  +   + T    
Sbjct: 1  MQFIKSVFRDETGATAIEYGLIAALIAVAAITAMGALGNSLSNTFSLVSGDMATAQSG 58


>gi|260467147|ref|ZP_05813325.1| Flp/Fap pilin component [Mesorhizobium opportunistum WSM2075]
 gi|259029071|gb|EEW30369.1| Flp/Fap pilin component [Mesorhizobium opportunistum WSM2075]
          Length = 59

 Score = 38.8 bits (89), Expect = 0.29,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 29/53 (54%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          ++  FL DE+GATA+EY L+V ++++ II  ++ +   +   F      +   
Sbjct: 4  VLLRFLTDETGATAVEYALIVCVLSLTIIGGISQVFNSITWLFSDNGSRLANA 56


>gi|254780736|ref|YP_003065149.1| hypothetical protein CLIBASIA_03115 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040413|gb|ACT57209.1| hypothetical protein CLIBASIA_03115 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 60

 Score = 38.4 bits (88), Expect = 0.30,   Method: Composition-based stats.
 Identities = 30/58 (51%), Positives = 37/58 (63%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          ++ +   L+DESGA AIEYG+LV+LIAV II +VT LGG LK  FE     I     A
Sbjct: 2  INCMNKLLKDESGAAAIEYGMLVALIAVAIIAAVTMLGGSLKGTFEEAANRISNVKSA 59


>gi|116671466|ref|YP_832399.1| Flp/Fap pilin component [Arthrobacter sp. FB24]
 gi|116611575|gb|ABK04299.1| Flp/Fap pilin component [Arthrobacter sp. FB24]
          Length = 64

 Score = 38.4 bits (88), Expect = 0.32,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
              +E GATA+EYGL+V+LI +  I  +T +G  L+  F  I   +
Sbjct: 18 RLTGEEKGATAVEYGLMVALIVIAAILGITAVGTSLQTLFNDISLKL 64


>gi|326386385|ref|ZP_08208008.1| hypothetical protein Y88_2279 [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326209046|gb|EGD59840.1| hypothetical protein Y88_2279 [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 60

 Score = 38.4 bits (88), Expect = 0.32,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          M ++   L+DE+GATAIEYGL+ +LIAV  IT++  LG  L   F  +   +      
Sbjct: 1  MKLINRILKDEAGATAIEYGLIAALIAVAAITAMGALGNSLSNTFSLVSGDMTKAQSG 58


>gi|17545380|ref|NP_518782.1| pilin transmembrane protein [Ralstonia solanacearum GMI1000]
 gi|17427672|emb|CAD14191.1| putative pilin transmembrane protein [Ralstonia solanacearum
          GMI1000]
          Length = 53

 Score = 38.4 bits (88), Expect = 0.32,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 32/50 (64%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          + K F+++E GA  +EY LL++ +A+V+IT  +T+   +   + +I  A+
Sbjct: 4  MFKRFVREEDGAAGVEYALLLTFVALVMITYGSTVKTAVGNIWNSIATAL 53


>gi|163751740|ref|ZP_02158958.1| hypothetical protein KT99_12224 [Shewanella benthica KT99]
 gi|161328392|gb|EDP99551.1| hypothetical protein KT99_12224 [Shewanella benthica KT99]
          Length = 62

 Score = 38.4 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 27/55 (49%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
           I  +F++DESG TA+EY +   L+   +I +  TLG         +  A+   S
Sbjct: 5  QIFADFIEDESGLTAVEYAIAGGLVVGGMIAAFNTLGTNATAKINCLASAVNGVS 59


>gi|85708397|ref|ZP_01039463.1| hypothetical protein NAP1_04140 [Erythrobacter sp. NAP1]
 gi|85689931|gb|EAQ29934.1| hypothetical protein NAP1_04140 [Erythrobacter sp. NAP1]
          Length = 61

 Score = 38.4 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 30/50 (60%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKA 53
          + +K+   D SGATA+EYGL+VSLI V +I ++  +  +  K +  +   
Sbjct: 5  NFLKHIGNDNSGATAVEYGLIVSLIVVAMIAALNGVANETIKMWSDVSDT 54


>gi|73539227|ref|YP_299594.1| Flp/Fap pilin component [Ralstonia eutropha JMP134]
 gi|72122564|gb|AAZ64750.1| Flp/Fap pilin component [Ralstonia eutropha JMP134]
          Length = 66

 Score = 38.4 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 32/57 (56%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
           ++  F++D+ GA+AIEYGL+  LIA+ I  S  TLG  LK  F  +   +    P 
Sbjct: 3  KMLTRFIRDDRGASAIEYGLIAGLIALAIAASAGTLGDNLKNGFSNLATRVAAWLPG 59


>gi|167624209|ref|YP_001674503.1| hypothetical protein Shal_2285 [Shewanella halifaxensis HAW-EB4]
 gi|167354231|gb|ABZ76844.1| hypothetical protein Shal_2285 [Shewanella halifaxensis HAW-EB4]
          Length = 65

 Score = 38.4 bits (88), Expect = 0.35,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 29/54 (53%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          ++K F++DESG TA+EY +   L+   +I +  TLG       + +  A+   S
Sbjct: 6  LLKEFIEDESGLTAVEYAIAGGLVVGGMIAAFNTLGDNATAKIDCLASAVNGAS 59


>gi|269926141|ref|YP_003322764.1| Flp/Fap pilin component [Thermobaculum terrenum ATCC BAA-798]
 gi|269789801|gb|ACZ41942.1| Flp/Fap pilin component [Thermobaculum terrenum ATCC BAA-798]
          Length = 121

 Score = 38.4 bits (88), Expect = 0.35,   Method: Composition-based stats.
 Identities = 11/46 (23%), Positives = 25/46 (54%)

Query: 14  SGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
            G   +EY L++ L+++  I ++  LGG++   F+ I + +  +  
Sbjct: 76  EGQGMVEYALIIVLVSIAAIVALGLLGGQISNVFQRITQTLSGSGS 121


>gi|86748910|ref|YP_485406.1| Flp/Fap pilin component [Rhodopseudomonas palustris HaA2]
 gi|86571938|gb|ABD06495.1| Flp/Fap pilin component [Rhodopseudomonas palustris HaA2]
          Length = 54

 Score = 38.4 bits (88), Expect = 0.35,   Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 35/50 (70%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          I   F++DESGATAIEYGL+ + IA+ II  +  +G KL  AF +I+ A+
Sbjct: 4  IFARFVKDESGATAIEYGLIAAGIALAIIAVINGMGTKLNTAFTSINTAL 53


>gi|284991845|ref|YP_003410399.1| Flp/Fap pilin protein [Geodermatophilus obscurus DSM 43160]
 gi|284065090|gb|ADB76028.1| Flp/Fap pilin component [Geodermatophilus obscurus DSM 43160]
          Length = 79

 Score = 38.4 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 32/50 (64%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          +   ++E GATA+EYGL+V LIAVVII +V  LG KL   F+ I   +  
Sbjct: 21 ERLEREEKGATAVEYGLMVGLIAVVIIAAVALLGTKLDGLFDTIGAKLGG 70


>gi|319781140|ref|YP_004140616.1| Flp/Fap pilin component [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
 gi|317167028|gb|ADV10566.1| Flp/Fap pilin component [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
          Length = 58

 Score = 38.4 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 31/56 (55%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
           I   F  DESGATAIEYGL+ +LIA+ IIT    +G  L   F  +   + ++  
Sbjct: 3  KIACRFAWDESGATAIEYGLIAALIALAIITGAGAVGNSLNGIFTTVGTTVNSSGS 58


>gi|330816678|ref|YP_004360383.1| Putative fimbriae assembly related protein [Burkholderia gladioli
          BSR3]
 gi|327369071|gb|AEA60427.1| Putative fimbriae assembly related protein [Burkholderia gladioli
          BSR3]
          Length = 56

 Score = 38.4 bits (88), Expect = 0.37,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 22/46 (47%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDK 52
          K FL DE+G TA+EYGL+   +        T L   ++  F  +  
Sbjct: 6  KRFLADETGVTAVEYGLIGGFVVGAAALGATALSNSVESLFSFVTS 51


>gi|152994344|ref|YP_001339179.1| Flp/Fap pilin component [Marinomonas sp. MWYL1]
 gi|150835268|gb|ABR69244.1| Flp/Fap pilin component [Marinomonas sp. MWYL1]
          Length = 65

 Score = 38.4 bits (88), Expect = 0.37,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG---GKLKKAFEAIDKAIVTTS 58
          V+ FL DE G TAIEYG+L + +A  I     + G     LK+ F +I   I  TS
Sbjct: 5  VRRFLSDERGVTAIEYGILAAAMAAAIGVIFGSDGVFVTALKERFSSIADQITNTS 60


>gi|33152390|ref|NP_873743.1| flp operon protein Flp2 [Haemophilus ducreyi 35000HP]
 gi|21326703|gb|AAL92463.1| Flp2 [Haemophilus ducreyi]
 gi|33148613|gb|AAP96132.1| flp operon protein Flp2 [Haemophilus ducreyi 35000HP]
          Length = 81

 Score = 38.4 bits (88), Expect = 0.38,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSV---TTLGGKLKKAFEAIDKAIVTTS 58
          ++ F +++ G TAIEYGL+   +A++II           KLK  F  +   I   S
Sbjct: 21 IQRFRKNQQGVTAIEYGLIAVAVAILIIAVFYNNQGFLMKLKTKFSDLATGISAQS 76


>gi|328953763|ref|YP_004371097.1| Flp/Fap pilin component [Desulfobacca acetoxidans DSM 11109]
 gi|328454087|gb|AEB09916.1| Flp/Fap pilin component [Desulfobacca acetoxidans DSM 11109]
          Length = 58

 Score = 38.4 bits (88), Expect = 0.38,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 31/54 (57%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          ++K F+++E GA+A+EY +LV  I  V+I  +    GKL  +  +    I T+ 
Sbjct: 4  MIKKFIREEDGASAVEYAVLVGAIGAVLIAGIYVFYGKLNTSVNSAATKIGTSG 57


>gi|323137854|ref|ZP_08072929.1| Flp/Fap pilin component [Methylocystis sp. ATCC 49242]
 gi|322396857|gb|EFX99383.1| Flp/Fap pilin component [Methylocystis sp. ATCC 49242]
          Length = 54

 Score = 38.4 bits (88), Expect = 0.38,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 29/45 (64%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
          +  ++NFL D  GATA+EY  +  +++++II   TT+G KL   +
Sbjct: 2  LRSLRNFLVDTRGATALEYVTIAFMVSIIIIAGSTTIGTKLSTLY 46


>gi|168703134|ref|ZP_02735411.1| hypothetical protein GobsU_26626 [Gemmata obscuriglobus UQM 2246]
          Length = 65

 Score = 38.4 bits (88), Expect = 0.38,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 28/43 (65%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAID 51
          FL+ E G TA+EY ++++LI VV++ +++ +GG     +  + 
Sbjct: 12 FLKGEDGPTAVEYAVMLALIIVVLVAAISNIGGTTSAMYNDLS 54


>gi|190149869|ref|YP_001968394.1| flp operon protein Flp1 [Actinobacillus pleuropneumoniae serovar
          7 str. AP76]
 gi|307263193|ref|ZP_07544814.1| Flp operon protein Flp1 [Actinobacillus pleuropneumoniae serovar
          13 str. N273]
 gi|189915000|gb|ACE61252.1| flp operon protein Flp1 [Actinobacillus pleuropneumoniae serovar
          7 str. AP76]
 gi|306871555|gb|EFN03278.1| Flp operon protein Flp1 [Actinobacillus pleuropneumoniae serovar
          13 str. N273]
          Length = 78

 Score = 38.0 bits (87), Expect = 0.39,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSV---TTLGGKLKKAFEAIDKAIVTTSPA 60
          ++ F +++ G TAIEYGL+   +A++I+           +LK  FEA+ K I      
Sbjct: 17 IRRFKENQQGVTAIEYGLIAVAVAILIVAVFYNDNGFIQQLKDKFEALTKTINDAKSG 74


>gi|17545379|ref|NP_518781.1| pilin transmembrane protein [Ralstonia solanacearum GMI1000]
 gi|17427671|emb|CAD14190.1| putative pilin transmembrane protein [Ralstonia solanacearum
          GMI1000]
          Length = 53

 Score = 38.0 bits (87), Expect = 0.39,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 33/50 (66%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++K F+++E GA  +EY LL++ +A+V++T  +T+   +   + +I  A+
Sbjct: 4  MIKRFVREEDGAAGVEYALLLTFVALVMVTYGSTVKTAVGSVWNSIANAL 53


>gi|84387250|ref|ZP_00990271.1| hypothetical protein V12B01_22511 [Vibrio splendidus 12B01]
 gi|84377897|gb|EAP94759.1| hypothetical protein V12B01_22511 [Vibrio splendidus 12B01]
          Length = 56

 Score = 38.0 bits (87), Expect = 0.40,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 26/52 (50%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++  K F++DE G T IEY +  +L+ + + T  + LG  L      I   +
Sbjct: 5  LNNCKEFMKDEEGLTVIEYVIGAALLVLGLTTVFSGLGTTLAAKLNTIVNGL 56


>gi|157375512|ref|YP_001474112.1| hypothetical protein Ssed_2375 [Shewanella sediminis HAW-EB3]
 gi|157317886|gb|ABV36984.1| hypothetical protein Ssed_2375 [Shewanella sediminis HAW-EB3]
          Length = 66

 Score = 38.0 bits (87), Expect = 0.41,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 27/56 (48%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
           I   F++DESG TA+EY +   L+   +I +   LG   +   E +  A+   S 
Sbjct: 5  QIFIEFIEDESGLTAVEYAIAGGLVVGGMIAAFNELGTNAQTKIECLASAVAGDSS 60


>gi|323495734|ref|ZP_08100804.1| hypothetical protein VISI1226_05039 [Vibrio sinaloensis DSM
          21326]
 gi|323319201|gb|EGA72142.1| hypothetical protein VISI1226_05039 [Vibrio sinaloensis DSM
          21326]
          Length = 85

 Score = 38.0 bits (87), Expect = 0.42,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          +  F  D+ G TAIEY ++  +I+  ++ +V      L+ AF     AI +   AA 
Sbjct: 27 LHAFFADQRGVTAIEYAIIGVIIS-AMVLAVFVTDNDLQTAFSGAMSAISSNIAAAQ 82


>gi|299067800|emb|CBJ39011.1| putative pilin transmembrane protein [Ralstonia solanacearum
          CMR15]
          Length = 53

 Score = 38.0 bits (87), Expect = 0.43,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 33/50 (66%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++K F+++E GA  +EY LL++ +A+V+IT  +T+   +   + +I  A+
Sbjct: 4  MIKRFVREEDGAAGVEYALLLTFVALVMITYGSTVKTAVGNIWNSIATAL 53


>gi|33152391|ref|NP_873744.1| flp operon protein Flp1 [Haemophilus ducreyi 35000HP]
 gi|21326702|gb|AAL92462.1| Flp1 [Haemophilus ducreyi]
 gi|33148614|gb|AAP96133.1| flp operon protein Flp1 [Haemophilus ducreyi 35000HP]
          Length = 85

 Score = 38.0 bits (87), Expect = 0.43,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSV---TTLGGKLKKAFEAIDKAIVTTSPAAS 62
          ++ F +++ G TAIEYGL+   +A++II           KLK  F  +   I + +   S
Sbjct: 21 IQRFRKNQQGVTAIEYGLIAVAVAILIIAVFYNNQGFLMKLKTKFSDLATGISSANGTTS 80


>gi|197106456|ref|YP_002131833.1| Flp pilus assembly protein, pilin Flp [Phenylobacterium zucineum
          HLK1]
 gi|196479876|gb|ACG79404.1| Flp pilus assembly protein, pilin Flp [Phenylobacterium zucineum
          HLK1]
          Length = 83

 Score = 38.0 bits (87), Expect = 0.43,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 29/56 (51%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
           ++K    D SGATAIEYGL+ + IAV +  ++  +   L + F  I   + T   
Sbjct: 27 KLIKKLAGDRSGATAIEYGLIAAFIAVALAAALPNVRTSLTETFGTIQGGLDTAQA 82


>gi|319951067|ref|ZP_08024920.1| hypothetical protein ES5_15571 [Dietzia cinnamea P4]
 gi|319435227|gb|EFV90494.1| hypothetical protein ES5_15571 [Dietzia cinnamea P4]
          Length = 81

 Score = 38.0 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 31/51 (60%)

Query: 11 QDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          + + GATA+EYGL+V LIAV II +V   G +L+  F+     + T +  A
Sbjct: 26 RKDRGATAVEYGLMVGLIAVAIIAAVIAFGDQLRGIFQGTSTQLNTETGLA 76


>gi|289675701|ref|ZP_06496591.1| hypothetical protein PsyrpsF_20686 [Pseudomonas syringae pv.
          syringae FF5]
          Length = 68

 Score = 38.0 bits (87), Expect = 0.46,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 36/55 (65%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          +++FL+D+  A+AIEY ++V+++A+V+   VT +G  +K  F  I  A+  T  +
Sbjct: 14 IQSFLKDKEAASAIEYAVIVAMVALVLFAMVTPMGDAVKAQFNKIILALGGTVAS 68


>gi|158421906|ref|YP_001523198.1| hypothetical protein AZC_0282 [Azorhizobium caulinodans ORS 571]
 gi|158328795|dbj|BAF86280.1| conserved hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 54

 Score = 38.0 bits (87), Expect = 0.47,   Method: Composition-based stats.
 Identities = 14/40 (35%), Positives = 30/40 (75%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLK 44
          +++ F+++E G+TA+EYGL+ + +++ I+T +T +G  L 
Sbjct: 4  LLQRFVKEEHGSTALEYGLIAAGLSIAIVTVLTQVGLTLS 43


>gi|332185116|ref|ZP_08386865.1| flp/Fap pilin component family protein [Sphingomonas sp. S17]
 gi|332014840|gb|EGI56896.1| flp/Fap pilin component family protein [Sphingomonas sp. S17]
          Length = 57

 Score = 38.0 bits (87), Expect = 0.47,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 33/55 (60%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          M  ++  + +  GATAIEYGL+ +LIAV  I  +++LGG L  AF  I   + T 
Sbjct: 1  MASIRKIIHNRKGATAIEYGLIAALIAVAAIAGMSSLGGSLGTAFNTIGGKLDTH 55


>gi|239814529|ref|YP_002943439.1| Flp/Fap pilin component [Variovorax paradoxus S110]
 gi|239801106|gb|ACS18173.1| Flp/Fap pilin component [Variovorax paradoxus S110]
          Length = 58

 Score = 38.0 bits (87), Expect = 0.48,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG--GKLKKAFEAIDKAIVTTS 58
          + + FL+DESGA  IEY L+++++++ ++ ++  L   G        +   + TT+
Sbjct: 1  MFELFLKDESGAQVIEYALIIAVVSIALVVALRGLTDNGSFTTFLTHVTNCLTTTT 56


>gi|149911629|ref|ZP_01900240.1| hypothetical protein PE36_02929 [Moritella sp. PE36]
 gi|149805299|gb|EDM65313.1| hypothetical protein PE36_02929 [Moritella sp. PE36]
          Length = 90

 Score = 37.6 bits (86), Expect = 0.51,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 29/58 (50%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          +  + NF+ DE G TA+EY L  +L+   + +    LG         +   IVT++PA
Sbjct: 5  VRFIDNFIHDEQGLTAVEYALAGALVVSSLASGFIALGSGASNNITELASLIVTSAPA 62


>gi|52425837|ref|YP_088974.1| hypothetical protein MS1782 [Mannheimia succiniciproducens
          MBEL55E]
 gi|52307889|gb|AAU38389.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 75

 Score = 37.6 bits (86), Expect = 0.52,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSV---TTLGGKLKKAFEAIDKAIVTTS 58
          ++ F QD  G TAIEYGL+  ++A  I+      T+    LK+ F  + K++   +
Sbjct: 17 IRRFKQDHKGVTAIEYGLIAVVMAAFIVYVFADDTSFVQSLKEKFSDVSKSVGNAT 72


>gi|319781330|ref|YP_004140806.1| Flp/Fap pilin component [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
 gi|317167218|gb|ADV10756.1| Flp/Fap pilin component [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
          Length = 61

 Score = 37.6 bits (86), Expect = 0.58,   Method: Composition-based stats.
 Identities = 13/53 (24%), Positives = 31/53 (58%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          ++  FL DE+GATA+EYG++++++++ I+  +  +   +   F   +  +   
Sbjct: 4  VLLGFLNDETGATAVEYGVIIAVLSLAIVGGIGEVRDGIIWLFSDNNSKLANA 56


>gi|227819049|ref|YP_002823020.1| PilA3 pilus assembly protein [Sinorhizobium fredii NGR234]
 gi|227338048|gb|ACP22267.1| PilA3 pilus assembly protein [Sinorhizobium fredii NGR234]
          Length = 51

 Score = 37.6 bits (86), Expect = 0.58,   Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 2/38 (5%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGG 41
          +++  F++ ESGATAIEYGL+  LIAV  IT+V T+G 
Sbjct: 3  NLLLRFVRHESGATAIEYGLITGLIAV--ITAVQTVGT 38


>gi|83749641|ref|ZP_00946624.1| Putative Pilin Protein [Ralstonia solanacearum UW551]
 gi|207728109|ref|YP_002256503.1| pilin protein [Ralstonia solanacearum MolK2]
 gi|207744155|ref|YP_002260547.1| pilin protein [Ralstonia solanacearum IPO1609]
 gi|300704927|ref|YP_003746530.1| pilin transmembrane protein [Ralstonia solanacearum CFBP2957]
 gi|83723702|gb|EAP70897.1| Putative Pilin Protein [Ralstonia solanacearum UW551]
 gi|206591354|emb|CAQ56966.1| pilin protein [Ralstonia solanacearum MolK2]
 gi|206595559|emb|CAQ62486.1| pilin protein [Ralstonia solanacearum IPO1609]
 gi|299072591|emb|CBJ43941.1| putative pilin transmembrane protein [Ralstonia solanacearum
          CFBP2957]
          Length = 58

 Score = 37.6 bits (86), Expect = 0.58,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 34/54 (62%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          ++K F+++E GA  +EY LL++ +A+V++T  TT+   +   + ++   + T +
Sbjct: 4  MIKRFVREEDGAAGVEYALLLAFVALVMVTYGTTVKTAVGAIWNSVATQLSTAA 57


>gi|332185280|ref|ZP_08387029.1| flp/Fap pilin component family protein [Sphingomonas sp. S17]
 gi|332015004|gb|EGI57060.1| flp/Fap pilin component family protein [Sphingomonas sp. S17]
          Length = 64

 Score = 37.6 bits (86), Expect = 0.63,   Method: Composition-based stats.
 Identities = 13/55 (23%), Positives = 29/55 (52%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
           +V+    D  GATA+EY L+++ I +VI  +++ +G  +      +   + + +
Sbjct: 9  KLVRAIGTDRRGATAVEYALIIACIMLVIFATLSQVGVNVAGVLSHLGDQLKSAT 63


>gi|153006809|ref|YP_001381134.1| Flp/Fap pilin component [Anaeromyxobacter sp. Fw109-5]
 gi|152030382|gb|ABS28150.1| Flp/Fap pilin component [Anaeromyxobacter sp. Fw109-5]
          Length = 58

 Score = 37.3 bits (85), Expect = 0.67,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 33/55 (60%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
           ++    +DE G TA+EYG++V+LIAVVII +V  LG  L   F  +   I+  +
Sbjct: 3  QMLMKLWKDEEGPTAVEYGVMVALIAVVIIAAVILLGQNLSTTFNDVATQILPAA 57


>gi|317123661|ref|YP_004097773.1| Flp/Fap pilin component [Intrasporangium calvum DSM 43043]
 gi|315587749|gb|ADU47046.1| Flp/Fap pilin component [Intrasporangium calvum DSM 43043]
          Length = 59

 Score = 37.3 bits (85), Expect = 0.67,   Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 30/52 (57%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          ++     E GATA+EYGL+V+LIAV I+ +V  LG  L   F  +  A+   
Sbjct: 8  LQTLRSREEGATAVEYGLMVALIAVAIMVTVGLLGDALDGLFARVLAAVNAA 59


>gi|188581864|ref|YP_001925309.1| Flp/Fap pilin component [Methylobacterium populi BJ001]
 gi|179345362|gb|ACB80774.1| Flp/Fap pilin component [Methylobacterium populi BJ001]
          Length = 60

 Score = 37.3 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 25/43 (58%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
             Q + GATAIEYGL+ + +A+ I+  + + G  L + F  +
Sbjct: 11 RMSQHDGGATAIEYGLVCTFVALAILVGLQSFGSTLTEVFPKV 53


>gi|134291861|ref|YP_001115630.1| Flp/Fap pilin component [Burkholderia vietnamiensis G4]
 gi|134135050|gb|ABO59375.1| Flp/Fap pilin component [Burkholderia vietnamiensis G4]
          Length = 68

 Score = 37.3 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 32/56 (57%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          V  ++ DE G T+IEY LL ++ A V++ +V  L G ++ A++AI   +      A
Sbjct: 10 VSRWIDDERGVTSIEYALLAAVFATVVLGAVVALKGSVQGAYDAIASIVTAAVNTA 65


>gi|297568756|ref|YP_003690100.1| Flp/Fap pilin component [Desulfurivibrio alkaliphilus AHT2]
 gi|296924671|gb|ADH85481.1| Flp/Fap pilin component [Desulfurivibrio alkaliphilus AHT2]
          Length = 67

 Score = 37.3 bits (85), Expect = 0.72,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 31/56 (55%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +  +K   +++ GATAIEY ++V+++  V+I     LG ++    +++ + I    
Sbjct: 9  LQQLKRSSKNQEGATAIEYAMIVAVMTGVVIAGYQLLGEQILALLQSVAEQITGPG 64


>gi|46580521|ref|YP_011329.1| pilin [Desulfovibrio vulgaris str. Hildenborough]
 gi|120602162|ref|YP_966562.1| Flp/Fap pilin component [Desulfovibrio vulgaris DP4]
 gi|46449940|gb|AAS96589.1| pilin, putative [Desulfovibrio vulgaris str. Hildenborough]
 gi|120562391|gb|ABM28135.1| Flp/Fap pilin component [Desulfovibrio vulgaris DP4]
 gi|311234260|gb|ADP87114.1| Flp/Fap pilin component [Desulfovibrio vulgaris RCH1]
          Length = 57

 Score = 37.3 bits (85), Expect = 0.72,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 34/56 (60%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          M  +    ++E GATA+EYGL+ +LIA VI+ +VT LG K+   F  ID  + T  
Sbjct: 1  MKTIIRLFKEEEGATALEYGLIAALIAAVIVAAVTALGTKVSSTFSYIDSKMPTPG 56


>gi|325275760|ref|ZP_08141636.1| Flp/Fap pilin component [Pseudomonas sp. TJI-51]
 gi|324099101|gb|EGB97071.1| Flp/Fap pilin component [Pseudomonas sp. TJI-51]
          Length = 53

 Score = 37.3 bits (85), Expect = 0.78,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 26/47 (55%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          NFL  + GA+ IEY ++ +++AVV+   V  +   +   F  I  A+
Sbjct: 7  NFLHRKDGASGIEYAVIATMVAVVLAAFVGDISTAVNTTFTTIKNAL 53


>gi|325964110|ref|YP_004242016.1| Flp/Fap pilin component [Arthrobacter phenanthrenivorans Sphe3]
 gi|323470197|gb|ADX73882.1| Flp/Fap pilin component [Arthrobacter phenanthrenivorans Sphe3]
          Length = 60

 Score = 37.3 bits (85), Expect = 0.78,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 31/47 (65%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
             ++E GAT +EYG++V+ IAV+++ +V  LG K+   F ++  AI
Sbjct: 14 RLAREEKGATMVEYGIMVAFIAVLVMAAVIILGPKIAGLFTSVSTAI 60


>gi|302343423|ref|YP_003807952.1| Flp/Fap pilin component [Desulfarculus baarsii DSM 2075]
 gi|301640036|gb|ADK85358.1| Flp/Fap pilin component [Desulfarculus baarsii DSM 2075]
          Length = 57

 Score = 37.3 bits (85), Expect = 0.79,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 26/50 (52%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          +K   +DE G +A+EY LL++LI   I T+   LG +++         + 
Sbjct: 7  IKRLFKDEQGISAVEYALLLALIGGGIATAAFLLGDQVETNITTATGNLS 56


>gi|296132735|ref|YP_003639982.1| Flp/Fap pilin component [Thermincola sp. JR]
 gi|296031313|gb|ADG82081.1| Flp/Fap pilin component [Thermincola potens JR]
          Length = 54

 Score = 37.3 bits (85), Expect = 0.81,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 27/53 (50%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          M  V  FL +E+G +  EY L++SLI V ++  + + G ++   F      I 
Sbjct: 1  MLTVTRFLVEENGQSLTEYALVLSLIVVTVVGILLSFGFRISNLFSNASAQIN 53


>gi|294140770|ref|YP_003556748.1| Flp/Fap pilin component superfamily [Shewanella violacea DSS12]
 gi|293327239|dbj|BAJ01970.1| Flp/Fap pilin component superfamily [Shewanella violacea DSS12]
          Length = 64

 Score = 37.3 bits (85), Expect = 0.81,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 26/55 (47%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
           I  +F++DESG TA+EY +   L+   +I +   LG         +  A+   S
Sbjct: 5  QIFSDFIEDESGLTAVEYAIAGGLVVGGMIAAFNQLGTNATSKISCLASAVNGAS 59


>gi|218710410|ref|YP_002418031.1| hypothetical protein VS_2447 [Vibrio splendidus LGP32]
 gi|218323429|emb|CAV19606.1| hypothetical protein VS_2447 [Vibrio splendidus LGP32]
          Length = 56

 Score = 37.3 bits (85), Expect = 0.85,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 26/52 (50%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++  K F++DE G T IEY +  +L+ + + T  T  G  L      I  +I
Sbjct: 5  LNNCKEFMKDEEGLTVIEYVIGAALLVLGLTTIFTGFGAALSAKLNNIINSI 56


>gi|27381698|ref|NP_773227.1| components of type IV pilus pilin subunit [Bradyrhizobium
          japonicum USDA 110]
 gi|27354867|dbj|BAC51852.1| components of type IV pilus pilin subunit [Bradyrhizobium
          japonicum USDA 110]
          Length = 51

 Score = 36.9 bits (84), Expect = 0.86,   Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 33/50 (66%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++  F  +ESGATAIEYGL+ + IA+ IIT V  LG  + + F +I  ++
Sbjct: 1  MILKFWSNESGATAIEYGLIAAGIALAIITVVNGLGTTMNEKFTSISTSL 50


>gi|283852354|ref|ZP_06369625.1| Flp/Fap pilin component [Desulfovibrio sp. FW1012B]
 gi|283572311|gb|EFC20300.1| Flp/Fap pilin component [Desulfovibrio sp. FW1012B]
          Length = 56

 Score = 36.9 bits (84), Expect = 0.86,   Method: Composition-based stats.
 Identities = 28/52 (53%), Positives = 37/52 (71%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          + NF++DE GATA+EYGL+V+LIA VI+  VTTLG  L+  F  I  AI  +
Sbjct: 5  ITNFVRDEEGATAVEYGLMVALIAAVIVGVVTTLGTTLQGTFTNITTAISGS 56


>gi|118581117|ref|YP_902367.1| hypothetical protein Ppro_2707 [Pelobacter propionicus DSM 2379]
 gi|118503827|gb|ABL00310.1| hypothetical protein Ppro_2707 [Pelobacter propionicus DSM 2379]
          Length = 106

 Score = 36.9 bits (84), Expect = 0.87,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 24/44 (54%)

Query: 13  ESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
           E     +EY L++ LIA+V++  +  +GGK    +  ++ A  +
Sbjct: 63  EKAQAIVEYALILLLIAIVVVAMLKGIGGKTNTMYSTVNSAFSS 106


>gi|319941905|ref|ZP_08016226.1| hypothetical protein HMPREF9464_01445 [Sutterella wadsworthensis
          3_1_45B]
 gi|319804558|gb|EFW01428.1| hypothetical protein HMPREF9464_01445 [Sutterella wadsworthensis
          3_1_45B]
          Length = 64

 Score = 36.9 bits (84), Expect = 0.89,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTT---LGGKLKKAFEAIDKAIVT 56
          ++ F++   G TAIEYG+L + +A+VI   V++   L   +   F+ I   + T
Sbjct: 7  IRLFIRSRRGVTAIEYGILAAGVAIVIGALVSSDGPLATAISDLFKGIVDHLPT 60


>gi|295700374|ref|YP_003608267.1| Flp/Fap pilin component [Burkholderia sp. CCGE1002]
 gi|295439587|gb|ADG18756.1| Flp/Fap pilin component [Burkholderia sp. CCGE1002]
          Length = 56

 Score = 36.9 bits (84), Expect = 0.91,   Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 31/50 (62%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
              F++DE G TAIEYGLL  LIA++II  VT LG  L+  F  +  ++
Sbjct: 7  TAARFVRDEDGVTAIEYGLLAGLIALLIIGGVTLLGQHLQTIFNNLADSV 56


>gi|322419947|ref|YP_004199170.1| Flp/Fap pilin component [Geobacter sp. M18]
 gi|320126334|gb|ADW13894.1| Flp/Fap pilin component [Geobacter sp. M18]
          Length = 65

 Score = 36.9 bits (84), Expect = 0.91,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 27/46 (58%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          L+ E G   +EY L++ LIA+V+I  VT +G    + F  ++ A+ 
Sbjct: 19 LKSEKGQGLVEYALILVLIAIVVIAMVTGIGQNANEVFCQVNGALN 64


>gi|328474266|gb|EGF45071.1| putative fimbrial protein [Vibrio parahaemolyticus 10329]
          Length = 57

 Score = 36.9 bits (84), Expect = 0.92,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          +++K+F++DE G T +EY L  +LI    +TS       L   F ++   I  +
Sbjct: 6  NLIKDFMEDEEGLTLLEYILGAALIVTAFLTS--GFWTTLSGKFTSVASQINNS 57


>gi|299067802|emb|CBJ39013.1| putative pilin transmembrane protein [Ralstonia solanacearum
          CMR15]
          Length = 53

 Score = 36.9 bits (84), Expect = 0.95,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 33/50 (66%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++K F+++E GA  +EY LL++ +A+V++T  +T+   +   + +I  A+
Sbjct: 4  MIKRFVREEDGAAGVEYALLLTFVALVMVTYGSTVKTAVGNVWNSIAAAL 53


>gi|222524612|ref|YP_002569083.1| hypothetical protein Chy400_1336 [Chloroflexus sp. Y-400-fl]
 gi|222448491|gb|ACM52757.1| hypothetical protein Chy400_1336 [Chloroflexus sp. Y-400-fl]
          Length = 60

 Score = 36.9 bits (84), Expect = 0.98,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 25/43 (58%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDK 52
          L  E G    EYGL+++LIA+V + +++ +GG L   +  +  
Sbjct: 15 LHRERGQGLAEYGLIITLIALVCVLAISAIGGSLSDMYNTVAA 57


>gi|148553540|ref|YP_001261122.1| Flp/Fap pilin component [Sphingomonas wittichii RW1]
 gi|148498730|gb|ABQ66984.1| Flp/Fap pilin component [Sphingomonas wittichii RW1]
          Length = 55

 Score = 36.9 bits (84), Expect = 1.0,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 36/55 (65%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          M  V   L++  GATAIEYGL+ +LIAV  IT++T+LG +L+K F  +   +  +
Sbjct: 1  MKFVAKLLKNNKGATAIEYGLIAALIAVAAITAMTSLGNQLQKTFNNVSNNMKAS 55


>gi|190574775|ref|YP_001972620.1| putative pilin subunit [Stenotrophomonas maltophilia K279a]
 gi|190012697|emb|CAQ46325.1| putative pilin subunit [Stenotrophomonas maltophilia K279a]
          Length = 68

 Score = 36.9 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          ++ FL++E G TA+EYGLL ++IA ++I        ++K  FE + K +   +  AS
Sbjct: 5  IRKFLKEEDGVTALEYGLLAAVIAGILIAVGN---KEIKGFFETLFKNLSDLATKAS 58


>gi|260892666|ref|YP_003238763.1| Flp/Fap pilin component [Ammonifex degensii KC4]
 gi|260864807|gb|ACX51913.1| Flp/Fap pilin component [Ammonifex degensii KC4]
          Length = 67

 Score = 36.9 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 30/50 (60%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          L+ E G    EYGL+++L+A+ +I ++T LG  +K  F+ + + I   + 
Sbjct: 16 LKSEEGQGLSEYGLILALVAIAVILALTALGIVIKNKFKHVAETINNANS 65


>gi|90411210|ref|ZP_01219223.1| hypothetical protein P3TCK_06577 [Photobacterium profundum 3TCK]
 gi|90328056|gb|EAS44377.1| hypothetical protein P3TCK_06577 [Photobacterium profundum 3TCK]
          Length = 57

 Score = 36.9 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          F +DE G T +EY +  SL+   ++ + T+LG K+  +  A+  AI 
Sbjct: 11 FWKDEEGLTTVEYAIAGSLVGAAVVGAFTSLGEKVTSSVNAMATAIS 57


>gi|239814528|ref|YP_002943438.1| hypothetical protein Vapar_1521 [Variovorax paradoxus S110]
 gi|239801105|gb|ACS18172.1| hypothetical protein Vapar_1521 [Variovorax paradoxus S110]
          Length = 69

 Score = 36.5 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG---GKLKKAFEAIDKAIVTTS 58
          ++FL+D+ GA  IEY L++++I++ ++ ++  L    G        +   + TT+
Sbjct: 13 RSFLRDDDGAQVIEYALIIAVISIALVVALKGLTANNGGFTTFITHVTNCLTTTT 67


>gi|269836841|ref|YP_003319069.1| hypothetical protein Sthe_0810 [Sphaerobacter thermophilus DSM
          20745]
 gi|269786104|gb|ACZ38247.1| hypothetical protein Sthe_0810 [Sphaerobacter thermophilus DSM
          20745]
          Length = 63

 Score = 36.5 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 14 SGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
           G   +EY L++ LI+VV I ++  LG K+ + F  +   + 
Sbjct: 19 EGQGLVEYALILVLISVVAIVAMQALGVKISEVFTDVTGTLS 60


>gi|170724967|ref|YP_001758993.1| Flp/Fap pilin component [Shewanella woodyi ATCC 51908]
 gi|169810314|gb|ACA84898.1| Flp/Fap pilin component [Shewanella woodyi ATCC 51908]
          Length = 69

 Score = 36.5 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 3/61 (4%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG---GKLKKAFEAIDKAIVTTSP 59
          M  +  + +DE G TAIEYGL+   +AV +  +  + G     L  AF  I  ++   + 
Sbjct: 9  MAFLATYKKDERGVTAIEYGLIGVAMAVALTAAFASDGNLMTALNTAFTKITDSLTKITA 68

Query: 60 A 60
           
Sbjct: 69 G 69


>gi|212635457|ref|YP_002311982.1| hypothetical protein swp_2661 [Shewanella piezotolerans WP3]
 gi|212556941|gb|ACJ29395.1| hypothetical protein swp_2661 [Shewanella piezotolerans WP3]
          Length = 64

 Score = 36.5 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 26/54 (48%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          ++  F++DESG TA+EY +   L+   +I +   LG         +  A+   S
Sbjct: 6  LLTEFIEDESGLTAVEYAIAGGLVVGGMIGAFNLLGDNATSKINCLASAVNGAS 59


>gi|85708396|ref|ZP_01039462.1| hypothetical protein NAP1_04135 [Erythrobacter sp. NAP1]
 gi|85689930|gb|EAQ29933.1| hypothetical protein NAP1_04135 [Erythrobacter sp. NAP1]
          Length = 54

 Score = 36.5 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 30/54 (55%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          M       +DE GATAIEYGL+ +LIAV  + ++ TLG  L   F  ++  +  
Sbjct: 1  MKFFNKLARDEQGATAIEYGLIAALIAVAAVAAMGTLGNTLADTFSQVESDMAG 54


>gi|317403502|gb|EFV84005.1| hypothetical protein HMPREF0005_03133 [Achromobacter xylosoxidans
          C54]
          Length = 58

 Score = 36.5 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 28/53 (52%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +  F  +E G TA+EYGL+   IAV ++ ++ T  G L   F ++   +   S
Sbjct: 5  LAQFWNEEEGITALEYGLIAGTIAVALVAALATFTGALGDLFTSLQAKLAAAS 57


>gi|238027722|ref|YP_002911953.1| putative fimbriae assembly-like protein [Burkholderia glumae
          BGR1]
 gi|237876916|gb|ACR29249.1| Putative fimbriae assembly related protein [Burkholderia glumae
          BGR1]
          Length = 56

 Score = 36.5 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 26/49 (53%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDK 52
           ++  FL++E+G TAIEYGL+  +IA       T L   + +AF     
Sbjct: 3  DLLGRFLEEEAGTTAIEYGLIAGVIAGAAGYMATNLSDDVTQAFSFAAS 51


>gi|218887831|ref|YP_002437152.1| Flp/Fap pilin component [Desulfovibrio vulgaris str. 'Miyazaki
          F']
 gi|218758785|gb|ACL09684.1| Flp/Fap pilin component [Desulfovibrio vulgaris str. 'Miyazaki
          F']
          Length = 58

 Score = 36.5 bits (83), Expect = 1.4,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 34/56 (60%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
           I+   + DE GATA+EYGL+ +LIA VI+ +VT LG K+   F  ID  + T   
Sbjct: 3  KIIARLINDEEGATALEYGLIAALIAAVIVAAVTALGTKVSSTFSYIDSKMPTPGS 58


>gi|241662168|ref|YP_002980528.1| Flp/Fap pilin component [Ralstonia pickettii 12D]
 gi|309780763|ref|ZP_07675504.1| pilin transmembrane protein [Ralstonia sp. 5_7_47FAA]
 gi|240864195|gb|ACS61856.1| Flp/Fap pilin component [Ralstonia pickettii 12D]
 gi|308920445|gb|EFP66101.1| pilin transmembrane protein [Ralstonia sp. 5_7_47FAA]
          Length = 58

 Score = 36.1 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 32/55 (58%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          ++K F+++E GA  +EY LL++ +A+V++ S  T+   +   +  I   + T + 
Sbjct: 4  MIKRFVREEDGAAGVEYALLLAFVALVMVASGPTVKAAVGSIWSTIATQLSTAAA 58


>gi|296444357|ref|ZP_06886322.1| Flp/Fap pilin component [Methylosinus trichosporium OB3b]
 gi|296258004|gb|EFH05066.1| Flp/Fap pilin component [Methylosinus trichosporium OB3b]
          Length = 55

 Score = 36.1 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 27/44 (61%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAF 47
            +  FL DE GAT+IEY  + + ++++I ++   +G KL  A+
Sbjct: 3  RSLCRFLADEIGATSIEYATIGAFVSILIYSATKVIGTKLSSAY 46


>gi|320160318|ref|YP_004173542.1| hypothetical protein ANT_09080 [Anaerolinea thermophila UNI-1]
 gi|319994171|dbj|BAJ62942.1| hypothetical protein ANT_09080 [Anaerolinea thermophila UNI-1]
          Length = 226

 Score = 36.1 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 24/47 (51%)

Query: 13 ESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          E G   IEY L V+L+ V +  S+  +G  L+ AF  +   I  ++ 
Sbjct: 8  EQGQGLIEYALFVALLLVAVYLSLQAMGLSLRDAFTLVYCGISRSNA 54


>gi|171920997|gb|ACB59180.1| Flp1 [Actinobacillus suis ATCC 33415]
          Length = 81

 Score = 36.1 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGG---KLKKAFEAIDKAIVTTS 58
          ++NF Q++ G TAIEYGL+   +A++IIT     GG    LK  F  + K+I + +
Sbjct: 17 IRNFKQNQQGVTAIEYGLIAVALAILIITVFYNDGGFIQSLKAKFADLTKSIDSVN 72


>gi|307294422|ref|ZP_07574266.1| Flp/Fap pilin component [Sphingobium chlorophenolicum L-1]
 gi|306880573|gb|EFN11790.1| Flp/Fap pilin component [Sphingobium chlorophenolicum L-1]
          Length = 59

 Score = 36.1 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          M  +KN   DE GA+A EY L+++++   I  +   LGG +  A       I T +
Sbjct: 1  MTFIKNLWADECGASAAEYALILAIVGTGIALAAFQLGGAISGAMNTAKNCINTAN 56


>gi|148976667|ref|ZP_01813354.1| hypothetical protein VSWAT3_19746 [Vibrionales bacterium SWAT-3]
 gi|145964018|gb|EDK29276.1| hypothetical protein VSWAT3_19746 [Vibrionales bacterium SWAT-3]
          Length = 62

 Score = 36.1 bits (82), Expect = 1.8,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 29/57 (50%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          +   K F+ DE G T IEY +  +++ + + T  + +G  L     AI  AI TT+ 
Sbjct: 5  LKSCKEFMNDEEGLTVIEYVIGAAMLVLGLTTIFSGIGNTLSNKLSAIVNAISTTTA 61


>gi|116626782|ref|YP_828938.1| Flp/Fap pilin component [Candidatus Solibacter usitatus
          Ellin6076]
 gi|116229944|gb|ABJ88653.1| Flp/Fap pilin component [Candidatus Solibacter usitatus
          Ellin6076]
          Length = 60

 Score = 36.1 bits (82), Expect = 1.9,   Method: Composition-based stats.
 Identities = 14/52 (26%), Positives = 31/52 (59%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          +V NF++DE G   +EY L+V+ + + +IT+V  L   +   ++++   + +
Sbjct: 4  LVLNFVRDEQGQDLVEYALIVAAVGLALITTVNQLSQGIVSLYQSMTGDLSS 55


>gi|170692569|ref|ZP_02883731.1| Flp/Fap pilin component [Burkholderia graminis C4D1M]
 gi|170142225|gb|EDT10391.1| Flp/Fap pilin component [Burkholderia graminis C4D1M]
          Length = 57

 Score = 35.7 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 31/53 (58%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          ++  K F++DE G TAIEYGL+ +LIA  I+   TTL   +   F AI   + 
Sbjct: 5  INSTKAFIRDEDGVTAIEYGLMAALIATAILAGYTTLANAVSAKFTAIAGKLA 57


>gi|221633433|ref|YP_002522658.1| hypothetical protein trd_1455 [Thermomicrobium roseum DSM 5159]
 gi|221155851|gb|ACM04978.1| hypothetical protein trd_1455 [Thermomicrobium roseum DSM 5159]
          Length = 71

 Score = 35.7 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 12/42 (28%), Positives = 24/42 (57%)

Query: 14 SGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
           G   +EY L+++L+++ +I ++T L G +   F  I  A+ 
Sbjct: 22 EGQGLVEYALIIALVSIALIFALTALAGGIGNVFSTIQGALS 63


>gi|149188867|ref|ZP_01867157.1| hypothetical protein VSAK1_05940 [Vibrio shilonii AK1]
 gi|148837287|gb|EDL54234.1| hypothetical protein VSAK1_05940 [Vibrio shilonii AK1]
          Length = 72

 Score = 35.7 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG--GKLKKAFEAIDKAIVTTS 58
           +  F  D+ G TAIEYGL+   +AV++  ++ + G  G+LK AF  I   I    
Sbjct: 12 FLSQFKNDQRGVTAIEYGLIGVAMAVLLSVALGSTGFIGELKTAFANIATTIKNAG 67


>gi|307245416|ref|ZP_07527504.1| Flp operon protein Flp1 [Actinobacillus pleuropneumoniae serovar
          1 str. 4074]
 gi|306853757|gb|EFM85974.1| Flp operon protein Flp1 [Actinobacillus pleuropneumoniae serovar
          1 str. 4074]
          Length = 77

 Score = 35.7 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSV---TTLGGKLKKAFEAIDKAIVTTS 58
          ++ F +++ G TAIEYGL+   +A++I+           +LK  F+ + K +   +
Sbjct: 17 IRRFKENQQGVTAIEYGLIAVAVAILIVAVFYNDKGFIQQLKLKFDQLTKTVQGAN 72


>gi|307261009|ref|ZP_07542691.1| hypothetical protein appser12_5760 [Actinobacillus
          pleuropneumoniae serovar 12 str. 1096]
 gi|306869311|gb|EFN01106.1| hypothetical protein appser12_5760 [Actinobacillus
          pleuropneumoniae serovar 12 str. 1096]
          Length = 78

 Score = 35.7 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSV---TTLGGKLKKAFEAIDKAIVTTS 58
          ++ F +++ G TAIEYGL+   +A++I+           +L+K F  + K I  T+
Sbjct: 17 IRRFKENQQGVTAIEYGLIAVAVAILIVAVFYKDNGFIQELQKKFGELTKTIAGTT 72


>gi|170692568|ref|ZP_02883730.1| Flp/Fap pilin component [Burkholderia graminis C4D1M]
 gi|170142224|gb|EDT10390.1| Flp/Fap pilin component [Burkholderia graminis C4D1M]
          Length = 60

 Score = 35.7 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 30/50 (60%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          F++DE G TAIEYGL+ +LIA  I+   +TL   +   F AI   + + +
Sbjct: 11 FIRDEDGVTAIEYGLMAALIATAILAGYSTLATAVSDKFTAIAGHVTSGT 60


>gi|148556408|ref|YP_001263990.1| Flp/Fap pilin component [Sphingomonas wittichii RW1]
 gi|148501598|gb|ABQ69852.1| Flp/Fap pilin component [Sphingomonas wittichii RW1]
          Length = 63

 Score = 35.7 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 23/51 (45%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
           +K   ++E GA+A+EY +LV  I + +    T  G  L      +   I 
Sbjct: 8  TMKRLSREEKGASAVEYAILVGAIGIALSAGATNFGNGLSNKLSGMLNVIT 58


>gi|94497283|ref|ZP_01303854.1| hypothetical protein SKA58_07013 [Sphingomonas sp. SKA58]
 gi|94423146|gb|EAT08176.1| hypothetical protein SKA58_07013 [Sphingomonas sp. SKA58]
          Length = 61

 Score = 35.7 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 31/51 (60%)

Query: 7  KNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          +  ++ E GATA+EYGL++++I + ++ +++ +  +    ++ +D  +   
Sbjct: 11 QGLIKCERGATAVEYGLILAMIVLAMLVALSNVAERTIHMWDDVDNKVTNA 61


>gi|299532594|ref|ZP_07045983.1| hypothetical protein CTS44_17418 [Comamonas testosteroni S44]
 gi|298719397|gb|EFI60365.1| hypothetical protein CTS44_17418 [Comamonas testosteroni S44]
          Length = 67

 Score = 35.7 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 30/58 (51%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          H +++F++DE GA  IEY L+V+++++ +I ++             +   + T    A
Sbjct: 10 HSLQSFVRDEEGAQIIEYALIVAVVSLTLILAMNVTDLGFAAWLGRVSACLTTAGACA 67


>gi|153834036|ref|ZP_01986703.1| putative fimbrial protein [Vibrio harveyi HY01]
 gi|148869591|gb|EDL68581.1| putative fimbrial protein [Vibrio harveyi HY01]
          Length = 57

 Score = 35.7 bits (81), Expect = 2.3,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          +++K+F++DE G T +EY L  +LI    +TS       L   F ++   I ++
Sbjct: 6  NLIKDFMEDEEGLTLLEYILGAALIVTAFLTS--GFWTTLSGKFSSVAGRISSS 57


>gi|218887832|ref|YP_002437153.1| Flp/Fap pilin component [Desulfovibrio vulgaris str. 'Miyazaki
          F']
 gi|218758786|gb|ACL09685.1| Flp/Fap pilin component [Desulfovibrio vulgaris str. 'Miyazaki
          F']
          Length = 58

 Score = 35.7 bits (81), Expect = 2.4,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 34/56 (60%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
           I+   + DE GATA+EYGL+ +LIA VI+ +VT LG K+   F  ID  + T   
Sbjct: 3  KIIARLINDEEGATALEYGLIAALIAAVIVAAVTALGTKVSATFSYIDSKMPTPGS 58


>gi|295700373|ref|YP_003608266.1| Flp/Fap pilin component [Burkholderia sp. CCGE1002]
 gi|295439586|gb|ADG18755.1| Flp/Fap pilin component [Burkholderia sp. CCGE1002]
          Length = 56

 Score = 35.7 bits (81), Expect = 2.5,   Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 30/46 (65%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          F+ DE G TAIEYGLL  LIA++II  VTTLG  L   F  +  ++
Sbjct: 11 FMHDEDGVTAIEYGLLAGLIALLIIGGVTTLGTNLSAIFNNLADSV 56


>gi|209546485|ref|YP_002278403.1| hypothetical protein Rleg2_4405 [Rhizobium leguminosarum bv.
          trifolii WSM2304]
 gi|209537729|gb|ACI57663.1| hypothetical protein Rleg2_4405 [Rhizobium leguminosarum bv.
          trifolii WSM2304]
          Length = 65

 Score = 35.3 bits (80), Expect = 2.6,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 27/58 (46%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          ++ V+ F ++E G    EY +L++L+   +I +VT  G  L   +        +   A
Sbjct: 5  VNCVRAFAREEDGVALTEYLILLALLVGGVIGAVTLAGTNLATVWNGWAGWFTSKLSA 62


>gi|28899197|ref|NP_798802.1| putative fimbrial protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|153836832|ref|ZP_01989499.1| putative fimbrial protein [Vibrio parahaemolyticus AQ3810]
 gi|260361565|ref|ZP_05774592.1| putative fimbrial protein [Vibrio parahaemolyticus K5030]
 gi|260876722|ref|ZP_05889077.1| putative fimbrial protein [Vibrio parahaemolyticus AN-5034]
 gi|260898199|ref|ZP_05906695.1| putative fimbrial protein [Vibrio parahaemolyticus Peru-466]
 gi|260900393|ref|ZP_05908788.1| putative fimbrial protein [Vibrio parahaemolyticus AQ4037]
 gi|28807421|dbj|BAC60686.1| putative fimbrial protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|149749978|gb|EDM60723.1| putative fimbrial protein [Vibrio parahaemolyticus AQ3810]
 gi|308089071|gb|EFO38766.1| putative fimbrial protein [Vibrio parahaemolyticus Peru-466]
 gi|308091431|gb|EFO41126.1| putative fimbrial protein [Vibrio parahaemolyticus AN-5034]
 gi|308109139|gb|EFO46679.1| putative fimbrial protein [Vibrio parahaemolyticus AQ4037]
 gi|308113986|gb|EFO51526.1| putative fimbrial protein [Vibrio parahaemolyticus K5030]
          Length = 57

 Score = 35.3 bits (80), Expect = 2.6,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          +++K+F++DE G T +EY L  +LI    +TS       L   F ++   I  +
Sbjct: 6  NLIKDFMEDEEGLTLLEYILGAALIVTAFLTS--GFWTTLAGKFTSVASQINGS 57


>gi|21673276|ref|NP_661341.1| hypothetical protein CT0438 [Chlorobium tepidum TLS]
 gi|21646365|gb|AAM71683.1| hypothetical protein CT0438 [Chlorobium tepidum TLS]
          Length = 55

 Score = 35.3 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 26/50 (52%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          +  + G T IEY L+ +LI+ V I +++ +G  L     ++  A  +  P
Sbjct: 5  INSQKGVTMIEYALIAALISTVTILALSQVGQNLVTLLVSVVNAFSSAPP 54


>gi|221067363|ref|ZP_03543468.1| hypothetical protein CtesDRAFT_PD2700 [Comamonas testosteroni
          KF-1]
 gi|220712386|gb|EED67754.1| hypothetical protein CtesDRAFT_PD2700 [Comamonas testosteroni
          KF-1]
          Length = 65

 Score = 35.3 bits (80), Expect = 2.8,   Method: Composition-based stats.
 Identities = 12/53 (22%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTL-GGKLKKAFEAIDKAIVTT 57
          +K+ L+D+ GA  +EY L+++++++ ++ ++ +L GG+       +   +  T
Sbjct: 11 LKHLLRDDEGAQVVEYALIIAVVSIALVLAIQSLAGGQFADFITRVTNCLTGT 63


>gi|291437524|ref|ZP_06576914.1| predicted protein [Streptomyces ghanaensis ATCC 14672]
 gi|291340419|gb|EFE67375.1| predicted protein [Streptomyces ghanaensis ATCC 14672]
          Length = 793

 Score = 35.3 bits (80), Expect = 2.9,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 4   HIVKNFLQDESGATAIEY-GLLVSLIAVVIITSVTTLGGKLKKAFEA-IDKAIVTTSPA 60
            +++   + + G TA+EY GL+  + A++    V+ LG +L    ++ + +   T  PA
Sbjct: 157 RLIRR--RRDEGQTAVEYAGLIAVVAAIITALVVSGLGTQLLAGIQSQVCRVTGTACPA 213


>gi|239929190|ref|ZP_04686143.1| hypothetical protein SghaA1_13271 [Streptomyces ghanaensis ATCC
           14672]
          Length = 770

 Score = 35.3 bits (80), Expect = 2.9,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 4   HIVKNFLQDESGATAIEY-GLLVSLIAVVIITSVTTLGGKLKKAFEA-IDKAIVTTSPA 60
            +++   + + G TA+EY GL+  + A++    V+ LG +L    ++ + +   T  PA
Sbjct: 134 RLIRR--RRDEGQTAVEYAGLIAVVAAIITALVVSGLGTQLLAGIQSQVCRVTGTACPA 190


>gi|283852166|ref|ZP_06369439.1| Flp/Fap pilin component [Desulfovibrio sp. FW1012B]
 gi|283572392|gb|EFC20379.1| Flp/Fap pilin component [Desulfovibrio sp. FW1012B]
          Length = 58

 Score = 35.3 bits (80), Expect = 3.0,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 28/49 (57%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +  FL DESGAT+ EY +L SL+A V +  VT  G  ++  F+    A 
Sbjct: 5  ILRFLNDESGATSSEYAILASLVAGVAVAVVTGFGLSVRALFQKAQDAF 53


>gi|19702498|gb|AAL93269.1| flp-1 protein [Aggregatibacter actinomycetemcomitans]
 gi|19702508|gb|AAL93274.1| flp-1 protein [Aggregatibacter actinomycetemcomitans]
 gi|307133492|dbj|BAJ19004.1| Flp1 [Aggregatibacter actinomycetemcomitans]
          Length = 75

 Score = 34.9 bits (79), Expect = 3.3,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 32/55 (58%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          +++F ++E+G TAIEYGL+   +AV+I+    +  G +K      ++   T S A
Sbjct: 17 IRSFRKNEAGVTAIEYGLIAIAVAVLIVAVFYSNNGFIKGLQNKFNQLTSTVSSA 71


>gi|320160320|ref|YP_004173544.1| hypothetical protein ANT_09100 [Anaerolinea thermophila UNI-1]
 gi|319994173|dbj|BAJ62944.1| hypothetical protein ANT_09100 [Anaerolinea thermophila UNI-1]
          Length = 279

 Score = 34.9 bits (79), Expect = 3.3,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 11 QDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT-TSPAAS 62
          + E G   +EY L++ L+A V   ++   G  L+  +E +  A+   TSPA+ 
Sbjct: 6  RREKGQGLLEYALIILLVAAVTGLALAVSGVSLRDVYERMLNALSGKTSPASC 58


>gi|294102194|ref|YP_003554052.1| hypothetical protein Amico_1206 [Aminobacterium colombiense DSM
          12261]
 gi|293617174|gb|ADE57328.1| hypothetical protein Amico_1206 [Aminobacterium colombiense DSM
          12261]
          Length = 49

 Score = 34.9 bits (79), Expect = 3.3,   Method: Composition-based stats.
 Identities = 13/46 (28%), Positives = 26/46 (56%)

Query: 9  FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          F  DE G    EYG++++LI+V  +  ++ +G K+ + F   +  +
Sbjct: 3  FFTDEGGQGLAEYGVILALISVAAVVVLSLIGPKVLQLFTNANSVL 48


>gi|218887833|ref|YP_002437154.1| Flp/Fap pilin component [Desulfovibrio vulgaris str. 'Miyazaki
          F']
 gi|218758787|gb|ACL09686.1| Flp/Fap pilin component [Desulfovibrio vulgaris str. 'Miyazaki
          F']
          Length = 58

 Score = 34.9 bits (79), Expect = 3.8,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 33/54 (61%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          +    +DE GATA+EYGL+ +LIA VI+ +VT LG K+   F  ID  + T   
Sbjct: 5  ITTLFRDEEGATALEYGLIAALIAAVIVAAVTALGTKVSATFSYIDSKMPTPGS 58


>gi|120602163|ref|YP_966563.1| Flp/Fap pilin component [Desulfovibrio vulgaris DP4]
 gi|120562392|gb|ABM28136.1| Flp/Fap pilin component [Desulfovibrio vulgaris DP4]
 gi|311234259|gb|ADP87113.1| Flp/Fap pilin component [Desulfovibrio vulgaris RCH1]
          Length = 58

 Score = 34.9 bits (79), Expect = 3.9,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 36/54 (66%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          I++   ++E+GATA+EYGL+ +LIA VI+ +VT LG K+   F  ID  + T  
Sbjct: 4  IMQRLFKEETGATALEYGLIAALIAAVIVAAVTALGTKVSATFSYIDSKMPTPG 57


>gi|293391335|ref|ZP_06635669.1| fimbrial protein Flp precursor [Aggregatibacter
          actinomycetemcomitans D7S-1]
 gi|15487345|dbj|BAB64544.1| fimbrial protein Flp precursor [Actinobacillus
          actinomycetemcomitans]
 gi|19702512|gb|AAL93276.1| flp-1 protein [Aggregatibacter actinomycetemcomitans]
 gi|19702514|gb|AAL93277.1| flp-1 protein [Aggregatibacter actinomycetemcomitans]
 gi|19702518|gb|AAL93279.1| flp-1 protein [Aggregatibacter actinomycetemcomitans]
 gi|19702520|gb|AAL93280.1| flp-1 protein [Aggregatibacter actinomycetemcomitans]
 gi|32452619|gb|AAP43981.1| Flp1 [Aggregatibacter actinomycetemcomitans]
 gi|290951869|gb|EFE01988.1| fimbrial protein Flp precursor [Aggregatibacter
          actinomycetemcomitans D7S-1]
          Length = 75

 Score = 34.9 bits (79), Expect = 4.0,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 3/59 (5%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGG---KLKKAFEAIDKAIVTTS 58
          +  +++F ++++G TAIEYGL+   +AV+I+    + GG   KL+  F  +   I + S
Sbjct: 14 IEAIRSFKKNQAGVTAIEYGLIAIAVAVLIVAVFYSEGGFIAKLQSKFNDLTSTISSAS 72


>gi|219849039|ref|YP_002463472.1| hypothetical protein Cagg_2152 [Chloroflexus aggregans DSM 9485]
 gi|219543298|gb|ACL25036.1| hypothetical protein Cagg_2152 [Chloroflexus aggregans DSM 9485]
          Length = 60

 Score = 34.9 bits (79), Expect = 4.0,   Method: Composition-based stats.
 Identities = 13/40 (32%), Positives = 24/40 (60%)

Query: 13 ESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDK 52
          E G    EYGL+++LIA+V + ++ ++GG L   +  +  
Sbjct: 18 ERGQGMAEYGLIITLIALVCVLAMISIGGSLSDMYNTVAA 57


>gi|114321313|ref|YP_742996.1| Flp/Fap pilin component [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227707|gb|ABI57506.1| Flp/Fap pilin component [Alkalilimnicola ehrlichii MLHE-1]
          Length = 61

 Score = 34.9 bits (79), Expect = 4.2,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 28/55 (50%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
            +    +DE GA+AIEY L+ +++AV ++  V  +   +   F  I  A+   +
Sbjct: 3  KFLLKLWKDEEGASAIEYALIAAMVAVALVAFVGPVRDAITGIFNDILNALTGAN 57


>gi|302391024|ref|YP_003826844.1| Flp/Fap pilin component [Acetohalobium arabaticum DSM 5501]
 gi|302203101|gb|ADL11779.1| Flp/Fap pilin component [Acetohalobium arabaticum DSM 5501]
          Length = 62

 Score = 34.6 bits (78), Expect = 4.4,   Method: Composition-based stats.
 Identities = 20/48 (41%), Positives = 33/48 (68%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          ++I+K  L +E G   +EYGL+++LIAV ++ ++TT+G  L   FE I
Sbjct: 2  LNILKRLLTEEDGQGMVEYGLILALIAVAVVAALTTMGEDLTTLFENI 49


>gi|86147471|ref|ZP_01065783.1| hypothetical protein MED222_21494 [Vibrio sp. MED222]
 gi|85834764|gb|EAQ52910.1| hypothetical protein MED222_21494 [Vibrio sp. MED222]
          Length = 62

 Score = 34.6 bits (78), Expect = 4.4,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 30/57 (52%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          +  +K F+ DE G T IEY +  +++ + + T  + +G  L     AI  AI TT+ 
Sbjct: 5  LKNIKEFMNDEEGLTVIEYVIGAAMLVLGLTTIFSGIGNVLSAKLSAIVNAISTTTA 61


>gi|239814530|ref|YP_002943440.1| hypothetical protein Vapar_1523 [Variovorax paradoxus S110]
 gi|239801107|gb|ACS18174.1| hypothetical protein Vapar_1523 [Variovorax paradoxus S110]
          Length = 58

 Score = 34.6 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 28/38 (73%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGK 42
          + K+FL DESGA  +EY L++++I++++ITS+  L   
Sbjct: 1  MFKSFLADESGAQMVEYALVIAVISILLITSLRPLVTD 38


>gi|315121894|ref|YP_004062383.1| hypothetical protein CKC_00720 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
 gi|313495296|gb|ADR51895.1| hypothetical protein CKC_00720 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
          Length = 44

 Score = 34.6 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 1/31 (3%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVV 31
          MK  I++NFLQD+S AT + YGL V+LIAV 
Sbjct: 1  MKFDIIRNFLQDKSSAT-VRYGLFVALIAVA 30


>gi|254522212|ref|ZP_05134267.1| Flp/Fap pilin component superfamily protein [Stenotrophomonas sp.
          SKA14]
 gi|219719803|gb|EED38328.1| Flp/Fap pilin component superfamily protein [Stenotrophomonas sp.
          SKA14]
          Length = 62

 Score = 34.6 bits (78), Expect = 4.9,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          ++ FL++E G TA+EYGLL ++IA V+I        ++   F  +   +   +  A+
Sbjct: 5  IRTFLKEEDGVTALEYGLLAAVIAGVLIAVGR---TQITSFFTTLFTHLTDIAKDAT 58


>gi|330811042|ref|YP_004355504.1| hypothetical protein PSEBR_a4096 [Pseudomonas brassicacearum
          subsp. brassicacearum NFM421]
 gi|327379150|gb|AEA70500.1| Hypothetical protein PSEBR_a4096 [Pseudomonas brassicacearum
          subsp. brassicacearum NFM421]
          Length = 73

 Score = 34.6 bits (78), Expect = 4.9,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 23/51 (45%)

Query: 8  NFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
           F +DE G T +EY +   LI V +      LG  +     A+  A+  ++
Sbjct: 22 KFAKDEDGLTIVEYAVAGGLITVAVAAMFVLLGSAVNTRITALCAAVKGSA 72


>gi|221067362|ref|ZP_03543467.1| pilus subunit protein PilA [Comamonas testosteroni KF-1]
 gi|220712385|gb|EED67753.1| pilus subunit protein PilA [Comamonas testosteroni KF-1]
          Length = 69

 Score = 34.6 bits (78), Expect = 5.0,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTL---GGKLKKAFEAIDKAIVTTS 58
          H + +F +D+ GA  +EY L+++++++ ++ ++  L   GG        +   + T +
Sbjct: 10 HSLLSFARDDEGAQVVEYALIIAVVSIALVVALKALTSSGGGFSSFITRVTNCLTTAT 67


>gi|299067804|emb|CBJ39015.1| putative pilin transmembrane protein [Ralstonia solanacearum
          CMR15]
          Length = 53

 Score = 34.6 bits (78), Expect = 5.0,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 31/50 (62%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          +++ F+++E GA + EY LLV+ +A+V+I     L G +K A+  I  A 
Sbjct: 4  VIQRFIREEDGAASTEYALLVTFVALVMIAYGDALQGTVKSAWSQIAAAF 53


>gi|41352064|gb|AAS00698.1| Flp1 [Aggregatibacter actinomycetemcomitans]
          Length = 75

 Score = 34.6 bits (78), Expect = 5.1,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 32/56 (57%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          +++F ++++G TAIEYGL+   +AV+I+    +  G +K      +    T S A+
Sbjct: 17 IRSFKKNQAGVTAIEYGLIAIAVAVLIVAVFYSDNGFIKGLQNKFNDLTKTVSSAS 72


>gi|257790308|ref|YP_003180914.1| hypothetical protein Elen_0540 [Eggerthella lenta DSM 2243]
 gi|325830443|ref|ZP_08163900.1| hypothetical protein HMPREF9404_3112 [Eggerthella sp. HGA1]
 gi|257474205|gb|ACV54525.1| hypothetical protein Elen_0540 [Eggerthella lenta DSM 2243]
 gi|325487910|gb|EGC90348.1| hypothetical protein HMPREF9404_3112 [Eggerthella sp. HGA1]
          Length = 66

 Score = 34.6 bits (78), Expect = 5.5,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 27/51 (52%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          V+  L  E G    EY +LV ++ V+ I ++T    KL++ +++I   I  
Sbjct: 15 VRRVLAREDGQGTTEYAILVGVLVVIAIIAITVFRPKLQELWDSIADGINA 65


>gi|301167748|emb|CBW27332.1| putative membrane protein [Bacteriovorax marinus SJ]
          Length = 59

 Score = 34.2 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 28/59 (47%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAA 61
          M   K  L+++ G   +EY ++ SL+ +  + ++   G  +    E + K IV   PA 
Sbjct: 1  MKASKKILKNQKGQGLMEYIIISSLVGIFCLVAMKQFGESVHTRVEKMRKDIVKHIPAR 59


>gi|28900574|ref|NP_800229.1| hypothetical protein VPA0719 [Vibrio parahaemolyticus RIMD
          2210633]
 gi|28808954|dbj|BAC62062.1| hypothetical protein [Vibrio parahaemolyticus RIMD 2210633]
          Length = 94

 Score = 34.2 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 27/57 (47%), Gaps = 2/57 (3%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSV--TTLGGKLKKAFEAIDKAIVTTS 58
          +I   F  D+ G TA+EY ++   ++ +I+      TL   L  A   I  ++ + +
Sbjct: 21 NIRNKFKSDKRGVTAVEYAIIAVAMSSIILFVFKDGTLKTTLNDAMGKISTSMDSAN 77


>gi|327537176|gb|EGF23925.1| Flp/Fap pilin component [Rhodopirellula baltica WH47]
          Length = 54

 Score = 34.2 bits (77), Expect = 5.9,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 28/54 (51%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
          M  ++ FL +E G TA+EY +++SLI V     ++ L  +   + +    AI  
Sbjct: 1  MRSIQRFLLEEDGPTAVEYAVMLSLIIVTASVGISILVTETSNSLQNSSDAIAN 54


>gi|294012242|ref|YP_003545702.1| Flp pilus assembly protein pilin Flp [Sphingobium japonicum
          UT26S]
 gi|292675572|dbj|BAI97090.1| Flp pilus assembly protein pilin Flp [Sphingobium japonicum
          UT26S]
          Length = 62

 Score = 34.2 bits (77), Expect = 5.9,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 29/57 (50%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          +K+   D+SGA+A EY L+++++   I  +   LG  +  A       I +   +++
Sbjct: 1  MKSLWADQSGASAAEYALILAIVGTGIALAAVGLGQSISTAMNEAGNCIKSPPTSST 57


>gi|269105130|ref|ZP_06157824.1| fimbrial protein precursor [Photobacterium damselae subsp.
          damselae CIP 102761]
 gi|312621077|ref|YP_003993805.1| flp pilus assembly protein, pilin flp [Photobacterium damselae
          subsp. damselae]
 gi|268160580|gb|EEZ39079.1| fimbrial protein precursor [Photobacterium damselae subsp.
          damselae CIP 102761]
 gi|311872798|emb|CBX86889.1| Flp pilus assembly protein, pilin Flp [Photobacterium damselae
          subsp. damselae]
          Length = 69

 Score = 34.2 bits (77), Expect = 6.0,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 27/57 (47%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS 62
          ++NF +DE G TAIEY ++   ++ +++         LK A       I     +A+
Sbjct: 9  LQNFFKDERGVTAIEYAIIGVAVSAIVLAVFAGDANSLKTALSGAVTTITDNITSAN 65


>gi|323341952|ref|ZP_08082185.1| hypothetical protein HMPREF0357_10365 [Erysipelothrix
          rhusiopathiae ATCC 19414]
 gi|322464377|gb|EFY09570.1| hypothetical protein HMPREF0357_10365 [Erysipelothrix
          rhusiopathiae ATCC 19414]
          Length = 56

 Score = 34.2 bits (77), Expect = 6.2,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 6  VKNFL-QDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60
          +KNFL  +ESG   +EYGL++ L++VV+I  + TLG  LK  FE + K +     A
Sbjct: 1  MKNFLFNEESGQGMVEYGLILVLVSVVVIVVMKTLGTNLKGIFENVGKELQAGKGA 56


>gi|87199923|ref|YP_497180.1| hypothetical protein Saro_1906 [Novosphingobium aromaticivorans
          DSM 12444]
 gi|87135604|gb|ABD26346.1| hypothetical protein Saro_1906 [Novosphingobium aromaticivorans
          DSM 12444]
          Length = 62

 Score = 34.2 bits (77), Expect = 6.3,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 29/48 (60%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDK 52
          +++  +++ESGATAIEYGLL++ I +     + +    +   +  +D+
Sbjct: 6  VLRKIIRNESGATAIEYGLLIASIGLAATFGMKSFSEAVYNLYVTVDE 53


>gi|33152389|ref|NP_873742.1| flp operon protein Flp3 [Haemophilus ducreyi 35000HP]
 gi|21326704|gb|AAL92464.1| Flp3 [Haemophilus ducreyi]
 gi|33148612|gb|AAP96131.1| flp operon protein Flp3 [Haemophilus ducreyi 35000HP]
          Length = 89

 Score = 34.2 bits (77), Expect = 6.5,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 1  MKMHIVKNF---LQDESGATAIEYGLLVSLIAVVIITSVTTLGG---KLKKAFEAIDKAI 54
          MK  ++  F     ++ G TAIEYGL+   +A++II    +  G    LK+ F  ++  +
Sbjct: 13 MKETLISWFNCFKINQKGVTAIEYGLIAVAVAILIIAVFYSESGFLFALKEKFFQLEGGV 72

Query: 55 VTTSPAA 61
             +P +
Sbjct: 73 GKAAPDS 79


>gi|239905966|ref|YP_002952705.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
 gi|239795830|dbj|BAH74819.1| Flp/Fap pilin component family protein [Desulfovibrio magneticus
          RS-1]
          Length = 53

 Score = 34.2 bits (77), Expect = 6.6,   Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 23/45 (51%)

Query: 11 QDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIV 55
          + E GAT++EY L+ SLIA V   +V   G  +   F+ +     
Sbjct: 9  RHEDGATSVEYALMASLIAAVAAAAVGQFGLAVLNLFQIVAGLFS 53


>gi|163857696|ref|YP_001631994.1| Flp pilin [Bordetella petrii DSM 12804]
 gi|163261424|emb|CAP43726.1| Flp pilin [Bordetella petrii]
          Length = 60

 Score = 34.2 bits (77), Expect = 6.7,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 1/58 (1%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          MK   +  F  DE G T +EY +L +L+   + T V +L   L+  F  I   +    
Sbjct: 1  MKEQFL-RFWNDEEGVTTLEYAILAALLVAGLATVVVSLTDGLQDFFTTIVTNLKAVG 57


>gi|320156050|ref|YP_004188429.1| hypothetical protein VVM_02383 [Vibrio vulnificus MO6-24/O]
 gi|319931362|gb|ADV86226.1| hypothetical protein VVMO6_01204 [Vibrio vulnificus MO6-24/O]
          Length = 58

 Score = 34.2 bits (77), Expect = 6.9,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG---GKLKKAFEAIDKAIVTTS 58
          ++K F+ DESGATAIEYG+L + +A  ++    + G     LK+ F  I  ++    
Sbjct: 1  MLKQFINDESGATAIEYGILAAGLAAGVLAIFGSDGVFISALKEKFLGIVNSLNPAG 57


>gi|146340336|ref|YP_001205384.1| hypothetical protein BRADO3363 [Bradyrhizobium sp. ORS278]
 gi|146193142|emb|CAL77154.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 183

 Score = 34.2 bits (77), Expect = 7.0,   Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 21/36 (58%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTL 39
             ++FL D  GATA+E+GL+ +    ++I  + T 
Sbjct: 13 RFCRDFLGDRRGATAVEFGLVAAPFLALVIALIQTF 48


>gi|295690801|ref|YP_003594494.1| hypothetical protein Cseg_3444 [Caulobacter segnis ATCC 21756]
 gi|295432704|gb|ADG11876.1| hypothetical protein Cseg_3444 [Caulobacter segnis ATCC 21756]
          Length = 56

 Score = 34.2 bits (77), Expect = 7.0,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 26/37 (70%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG 40
          H++K F +DESG   I+YGL V++IAV+    VT LG
Sbjct: 3  HLIKAFAKDESGVAGIQYGLFVAVIAVITTVCVTGLG 39


>gi|37680197|ref|NP_934806.1| hypothetical protein VV2013 [Vibrio vulnificus YJ016]
 gi|326423985|ref|YP_004300167.1| hypothetical protein VV1_3224 [Vibrio vulnificus CMCP6]
 gi|37198944|dbj|BAC94777.1| hypothetical protein [Vibrio vulnificus YJ016]
 gi|319999364|gb|ADV91938.1| hypothetical protein VV1_3224 [Vibrio vulnificus CMCP6]
          Length = 77

 Score = 33.8 bits (76), Expect = 7.5,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 2  KMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG---GKLKKAFEAIDKAIVTTS 58
           + ++K F+ DESGATAIEYG+L + +A  ++    + G     LK+ F  I  ++    
Sbjct: 17 GVMMLKQFINDESGATAIEYGILAAGLAAGVLAIFGSDGVFISALKEKFLGIVNSLNPAG 76


>gi|307294421|ref|ZP_07574265.1| Flp pilus assembly protein pilin Flp [Sphingobium
          chlorophenolicum L-1]
 gi|306880572|gb|EFN11789.1| Flp pilus assembly protein pilin Flp [Sphingobium
          chlorophenolicum L-1]
          Length = 59

 Score = 33.8 bits (76), Expect = 7.9,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 28/56 (50%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          M  +K+   D+SGA+A EY L+++++   I  +   LGG +  +       I   +
Sbjct: 1  MTFLKSLWADDSGASAAEYALILAIVGTGIALAAFQLGGAISGSMNKAKNCIANAN 56


>gi|83312837|ref|YP_423101.1| Flp pilus assembly protein, pilin Flp [Magnetospirillum
          magneticum AMB-1]
 gi|82947678|dbj|BAE52542.1| Flp pilus assembly protein, pilin Flp [Magnetospirillum
          magneticum AMB-1]
          Length = 64

 Score = 33.8 bits (76), Expect = 8.1,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 32/50 (64%)

Query: 5  IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          ++    +DE GATAIEYGL+ +LI+++ I  +  +G ++  AF  I  ++
Sbjct: 15 LIIKLSRDEQGATAIEYGLIAALISIIAIPGMLMVGPRILAAFTNIAGSM 64


>gi|229816456|ref|ZP_04446757.1| hypothetical protein COLINT_03510 [Collinsella intestinalis DSM
          13280]
 gi|229807998|gb|EEP43799.1| hypothetical protein COLINT_03510 [Collinsella intestinalis DSM
          13280]
          Length = 99

 Score = 33.8 bits (76), Expect = 8.4,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 29/53 (54%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
            V+  L++ESG    EY +LV ++ V+ I ++     K+   +EAI + I +
Sbjct: 46 RPVRQILREESGQGTTEYAILVGVLVVIAILAIVAFRDKVSSLWEAISQGINS 98


>gi|315181064|gb|ADT87978.1| hypothetical fimbrial protein [Vibrio furnissii NCTC 11218]
          Length = 55

 Score = 33.8 bits (76), Expect = 8.6,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 22/48 (45%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAID 51
           +VK F QDE G T +EY +   L+   + T     G  L+    +I 
Sbjct: 6  KVVKEFWQDEEGLTVVEYVVGAGLLVAGLATIFDQWGATLQSELTSIS 53


>gi|260365454|ref|ZP_05777991.1| Flp/Fap pilin component protein [Vibrio parahaemolyticus K5030]
 gi|260877519|ref|ZP_05889874.1| Flp/Fap pilin component protein [Vibrio parahaemolyticus AN-5034]
 gi|260897540|ref|ZP_05906036.1| Flp/Fap pilin component protein [Vibrio parahaemolyticus
          Peru-466]
 gi|260901742|ref|ZP_05910137.1| Flp/Fap pilin component protein [Vibrio parahaemolyticus AQ4037]
 gi|308087109|gb|EFO36804.1| Flp/Fap pilin component protein [Vibrio parahaemolyticus
          Peru-466]
 gi|308090614|gb|EFO40309.1| Flp/Fap pilin component protein [Vibrio parahaemolyticus AN-5034]
 gi|308108863|gb|EFO46403.1| Flp/Fap pilin component protein [Vibrio parahaemolyticus AQ4037]
 gi|308114354|gb|EFO51894.1| Flp/Fap pilin component protein [Vibrio parahaemolyticus K5030]
          Length = 84

 Score = 33.8 bits (76), Expect = 8.6,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 27/57 (47%), Gaps = 2/57 (3%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSV--TTLGGKLKKAFEAIDKAIVTTS 58
          +I   F  D+ G TA+EY ++   ++ +I+      TL   L  A   I  ++ + +
Sbjct: 11 NIRNKFKSDKRGVTAVEYAIIAVAMSSIILFVFKDGTLKTTLNDAMGKISTSMDSAN 67


>gi|218887830|ref|YP_002437151.1| Flp/Fap pilin component [Desulfovibrio vulgaris str. 'Miyazaki
          F']
 gi|218758784|gb|ACL09683.1| Flp/Fap pilin component [Desulfovibrio vulgaris str. 'Miyazaki
          F']
          Length = 58

 Score = 33.8 bits (76), Expect = 9.0,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 35/57 (61%)

Query: 3  MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59
          +  +   +++E GATA+EYGL+ +LIA VI+ +VT LG K+   F  ID  + T   
Sbjct: 2  LKSITALIREEEGATALEYGLIAALIAAVIVAAVTALGTKVSSTFSYIDSKMPTPGS 58


>gi|114704315|ref|ZP_01437223.1| hypothetical protein FP2506_05261 [Fulvimarina pelagi HTCC2506]
 gi|114539100|gb|EAU42220.1| hypothetical protein FP2506_05261 [Fulvimarina pelagi HTCC2506]
          Length = 66

 Score = 33.8 bits (76), Expect = 9.1,   Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 2  KMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTL 39
           +  +   L D+SGATAIEY L+  +IA  I+T +  L
Sbjct: 10 GLRRLATALNDDSGATAIEYCLIAGIIATAIVTGLEAL 47


>gi|255599435|ref|XP_002537230.1| conserved hypothetical protein [Ricinus communis]
 gi|223517051|gb|EEF25153.1| conserved hypothetical protein [Ricinus communis]
          Length = 96

 Score = 33.8 bits (76), Expect = 9.2,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 28/52 (53%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          VK FL+DE G T +EY +   L+    +T+ TTLGG +      +  A+  T
Sbjct: 42 VKAFLKDEEGLTMVEYAVAGGLVTAAAVTAFTTLGGAIVTRINTLITAMGGT 93


>gi|116748927|ref|YP_845614.1| hypothetical protein Sfum_1490 [Syntrophobacter fumaroxidans
          MPOB]
 gi|116697991|gb|ABK17179.1| hypothetical protein Sfum_1490 [Syntrophobacter fumaroxidans
          MPOB]
          Length = 71

 Score = 33.8 bits (76), Expect = 9.4,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 26/52 (50%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          ++  L +E G TAIEY L+ SLI +   +++      +   F     A+V+ 
Sbjct: 16 LRILLCEERGTTAIEYALIASLIVLAAASAMVATSDSVINIFNYWTNAVVSA 67


>gi|217978824|ref|YP_002362971.1| Flp/Fap pilin component [Methylocella silvestris BL2]
 gi|217504200|gb|ACK51609.1| Flp/Fap pilin component [Methylocella silvestris BL2]
          Length = 61

 Score = 33.4 bits (75), Expect = 9.5,   Method: Composition-based stats.
 Identities = 21/48 (43%), Positives = 28/48 (58%)

Query: 10 LQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTT 57
          +  E G TAIEYGL+ SLIA+ II +VT +G  L   F  +   +V  
Sbjct: 14 IDSEQGVTAIEYGLIASLIAIAIIVAVTLVGTNLSGLFTYVAGKVVAP 61


>gi|328470516|gb|EGF41427.1| hypothetical protein VP10329_06947 [Vibrio parahaemolyticus
          10329]
          Length = 84

 Score = 33.4 bits (75), Expect = 9.7,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 26/57 (45%), Gaps = 2/57 (3%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSV--TTLGGKLKKAFEAIDKAIVTTS 58
          +I   F  D+ G TA+EY ++   ++ +I+      TL   L  A   I  ++   +
Sbjct: 11 NIRNKFKSDKRGVTAVEYAIIAVAMSSIILFVFKDGTLKTTLNDAMGKISTSMDNAN 67


>gi|139439661|ref|ZP_01773074.1| Hypothetical protein COLAER_02101 [Collinsella aerofaciens ATCC
          25986]
 gi|133775002|gb|EBA38822.1| Hypothetical protein COLAER_02101 [Collinsella aerofaciens ATCC
          25986]
          Length = 317

 Score = 33.4 bits (75), Expect = 9.8,   Method: Composition-based stats.
 Identities = 10/43 (23%), Positives = 23/43 (53%)

Query: 14 SGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVT 56
           G + IEY L++++I +VI+ +   + G ++  F  +   +  
Sbjct: 19 RGQSIIEYVLIIAIIGLVIVFAGPGVAGAIRNQFNLVGNTVNN 61


>gi|330811041|ref|YP_004355503.1| hypothetical protein PSEBR_a4095 [Pseudomonas brassicacearum
          subsp. brassicacearum NFM421]
 gi|327379149|gb|AEA70499.1| Hypothetical protein PSEBR_a4095 [Pseudomonas brassicacearum
          subsp. brassicacearum NFM421]
          Length = 63

 Score = 33.4 bits (75), Expect = 9.9,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 25/53 (47%)

Query: 6  VKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTS 58
          +  F+ DE G T +EY +   LI V +      LGG +     A+  A+  ++
Sbjct: 10 IVKFIDDEDGLTIVEYAVAGGLITVAVAAMFVLLGGAVNDRITALCAAVKGSA 62


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.319    0.143    0.373 

Lambda     K      H
   0.267   0.0438    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 961,465,539
Number of Sequences: 14124377
Number of extensions: 24912002
Number of successful extensions: 112507
Number of sequences better than 10.0: 824
Number of HSP's better than 10.0 without gapping: 1288
Number of HSP's successfully gapped in prelim test: 89
Number of HSP's that attempted gapping in prelim test: 111163
Number of HSP's gapped (non-prelim): 1396
length of query: 62
length of database: 4,842,793,630
effective HSP length: 34
effective length of query: 28
effective length of database: 4,362,564,812
effective search space: 122151814736
effective search space used: 122151814736
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 76 (33.8 bits)