RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780734|ref|YP_003065147.1| Flp/Fap pilin component [Candidatus Liberibacter asiaticus str. psy62] (62 letters) >gnl|CDD|113726 pfam04964, Flp_Fap, Flp/Fap pilin component. Length = 47 Score = 53.4 bits (129), Expect = 1e-08 Identities = 31/46 (67%), Positives = 36/46 (78%) Query: 9 FLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54 FL+DESGATAIEYGL+ +LIAVVII VTTLG LK F +I A+ Sbjct: 1 FLKDESGATAIEYGLIAALIAVVIIAYVTTLGTALKTKFTSIGTAL 46 >gnl|CDD|33638 COG3847, Flp, Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion]. Length = 58 Score = 52.6 bits (126), Expect = 3e-08 Identities = 30/57 (52%), Positives = 39/57 (68%) Query: 3 MHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSP 59 +++ FL+DE GATAIEYGL+ +LIAVVII +TLG LK AF AI A+ + Sbjct: 2 KKLLRRFLRDEDGATAIEYGLIAALIAVVIIAGGSTLGTALKGAFTAIGAALTGAAA 58 >gnl|CDD|34568 COG4961, TadG, Flp pilus assembly protein TadG [Intracellular trafficking and secretion]. Length = 185 Score = 25.9 bits (56), Expect = 2.7 Identities = 8/33 (24%), Positives = 19/33 (57%) Query: 4 HIVKNFLQDESGATAIEYGLLVSLIAVVIITSV 36 +++ F +D GA A+E+ L+ + +++ V Sbjct: 10 GLLRRFRRDRRGAAAVEFALVAPPLLLLVFGIV 42 >gnl|CDD|110935 pfam01983, CofC, Guanylyl transferase CofC like. Coenzyme F420 is a hydride carrier cofactor that functions during methanogenesis. This family of proteins represents CofC, a nucleotidyl transferase that is involved in coenzyme F420 biosynthesis. CofC has been shown to catalyse the formation of lactyl-2-diphospho-5'-guanosine from 2-phospho-L-lactate and GTP. Length = 217 Score = 24.5 bits (53), Expect = 6.3 Identities = 15/68 (22%), Positives = 28/68 (41%), Gaps = 12/68 (17%) Query: 5 IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLG------------GKLKKAFEAIDK 52 +++ L D A L+ S VV+ +++ LG + +AF A ++ Sbjct: 29 LLRLMLLDVIDALKPVDVLVFSEDEVVLPSALDVLGVEVVVETESDLNTAVNQAFMAPEE 88 Query: 53 AIVTTSPA 60 A V P+ Sbjct: 89 APVIIIPS 96 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.131 0.336 Gapped Lambda K H 0.267 0.0779 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 611,773 Number of extensions: 22556 Number of successful extensions: 80 Number of sequences better than 10.0: 1 Number of HSP's gapped: 80 Number of HSP's successfully gapped: 9 Length of query: 62 Length of database: 6,263,737 Length adjustment: 34 Effective length of query: 28 Effective length of database: 5,529,031 Effective search space: 154812868 Effective search space used: 154812868 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.3 bits)