BLAST/BLAST alignment of GI: 254780734 and GI: 254780733
>gi|254780733|ref|YP_003065146.1| hypothetical protein CLIBASIA_03100 [Candidatus Liberibacter asiaticus str. psy62] Length = 56
 Score = 85.1 bits (209), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/54 (79%), Positives = 47/54 (87%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          MKM+IVK+FL+DESGATAIEYGLL SLIAV II SVTTLGGKL K FE I+K I
Sbjct: 1  MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIEKGI 54