BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780734|ref|YP_003065147.1| Flp/Fap pilin component [Candidatus Liberibacter asiaticus str. psy62] (62 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780734|ref|YP_003065147.1| Flp/Fap pilin component [Candidatus Liberibacter asiaticus str. psy62] Length = 62 Score = 122 bits (305), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 62/62 (100%), Positives = 62/62 (100%) Query: 1 MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60 MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA Sbjct: 1 MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPA 60 Query: 61 AS 62 AS Sbjct: 61 AS 62 >gi|254780733|ref|YP_003065146.1| hypothetical protein CLIBASIA_03100 [Candidatus Liberibacter asiaticus str. psy62] Length = 56 Score = 85.1 bits (209), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 43/54 (79%), Positives = 47/54 (87%) Query: 1 MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54 MKM+IVK+FL+DESGATAIEYGLL SLIAV II SVTTLGGKL K FE I+K I Sbjct: 1 MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIEKGI 54 >gi|254780732|ref|YP_003065145.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter asiaticus str. psy62] Length = 58 Score = 83.2 bits (204), Expect = 8e-19, Method: Compositional matrix adjust. Identities = 42/50 (84%), Positives = 42/50 (84%) Query: 1 MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50 MKMHIVKNFLQDESGATAIEYGLL SLIAV II SVTTLGGKL F I Sbjct: 1 MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADI 50 >gi|254780730|ref|YP_003065143.1| hypothetical protein CLIBASIA_03085 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Score = 63.9 bits (154), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 28/50 (56%), Positives = 41/50 (82%) Query: 1 MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50 MKM+I+K L++ SGATAIEYGLL SL++V II++V+TLG ++K ++ I Sbjct: 1 MKMNIIKKILKNGSGATAIEYGLLASLVSVAIISAVSTLGDRMKGVYQTI 50 >gi|254780736|ref|YP_003065149.1| hypothetical protein CLIBASIA_03115 [Candidatus Liberibacter asiaticus str. psy62] Length = 60 Score = 40.0 bits (92), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 28/45 (62%), Positives = 34/45 (75%) Query: 4 HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFE 48 + + L+DESGA AIEYG+LV+LIAV II +VT LGG LK FE Sbjct: 3 NCMNKLLKDESGAAAIEYGMLVALIAVAIIAAVTMLGGSLKGTFE 47 >gi|254780735|ref|YP_003065148.1| hypothetical protein CLIBASIA_03110 [Candidatus Liberibacter asiaticus str. psy62] Length = 75 Score = 28.5 bits (62), Expect = 0.020, Method: Compositional matrix adjust. Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 2/43 (4%) Query: 20 EYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI--VTTSPA 60 EYG++ +LIAV II +VT LGG LK AFE + + TT P Sbjct: 6 EYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMSHQTTKPP 48 >gi|254780571|ref|YP_003064984.1| hypothetical protein CLIBASIA_02290 [Candidatus Liberibacter asiaticus str. psy62] Length = 182 Score = 21.2 bits (43), Expect = 3.4, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 9/52 (17%) Query: 3 MHIVKN----FLQDESGATAIEYG-----LLVSLIAVVIITSVTTLGGKLKK 45 M +KN FL E+G A+E LL+ +AV IT + TL +L + Sbjct: 1 MKCIKNYILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTR 52 >gi|254781225|ref|YP_003065638.1| P4 family phage/plasmid primase [Candidatus Liberibacter asiaticus str. psy62] Length = 789 Score = 20.8 bits (42), Expect = 5.0, Method: Composition-based stats. Identities = 8/12 (66%), Positives = 10/12 (83%) Query: 40 GGKLKKAFEAID 51 G KLK AFE++D Sbjct: 768 GLKLKPAFESVD 779 >gi|254780877|ref|YP_003065290.1| ATP-dependent Clp protease, ATP-binding subunit protein [Candidatus Liberibacter asiaticus str. psy62] Length = 853 Score = 20.4 bits (41), Expect = 5.5, Method: Composition-based stats. Identities = 7/13 (53%), Positives = 10/13 (76%) Query: 4 HIVKNFLQDESGA 16 H++ FL+DE GA Sbjct: 33 HVLHIFLEDEQGA 45 >gi|254780638|ref|YP_003065051.1| molecular chaperone protein DnaJ [Candidatus Liberibacter asiaticus str. psy62] Length = 384 Score = 20.4 bits (41), Expect = 6.5, Method: Composition-based stats. Identities = 8/16 (50%), Positives = 10/16 (62%) Query: 7 KNFLQDESGATAIEYG 22 K L D+ G A+EYG Sbjct: 62 KRALYDQGGHEALEYG 77 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.131 0.336 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,652 Number of Sequences: 1233 Number of extensions: 828 Number of successful extensions: 12 Number of sequences better than 100.0: 12 Number of HSP's better than 100.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of query: 62 length of database: 328,796 effective HSP length: 34 effective length of query: 28 effective length of database: 286,874 effective search space: 8032472 effective search space used: 8032472 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.8 bits) S2: 31 (16.5 bits)