RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780735|ref|YP_003065148.1| hypothetical protein CLIBASIA_03110 [Candidatus Liberibacter asiaticus str. psy62] (75 letters) >gnl|CDD|152989 pfam12555, TPPK_C, Thiamine pyrophosphokinase C terminal. This domain family is found in bacteria, and is approximately 50 amino acids in length. The proteins in this family catalyses the pyrophosphorylation of thiamine in yeast and synthesizes thiamine pyrophosphate (TPP), a thiamine coenzyme. Length = 53 Score = 27.5 bits (62), Expect = 0.84 Identities = 8/21 (38%), Positives = 14/21 (66%) Query: 9 MMAALIAVAIIAAVTKLGGSL 29 ++AAL+A+A+ V+ G S Sbjct: 20 VLAALVALAVALLVSPAGQSF 40 >gnl|CDD|182822 PRK10901, PRK10901, 16S rRNA methyltransferase B; Provisional. Length = 427 Score = 27.1 bits (61), Expect = 1.2 Identities = 10/36 (27%), Positives = 15/36 (41%) Query: 8 GMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMSHQ 43 M +A A I V G SL A + ++S + Sbjct: 1 SMNLRALAAAAILQVVDQGQSLSAALPALQQKVSDK 36 >gnl|CDD|132189 TIGR03145, cyt_nit_nrfE, cytochrome c nitrate reductase biogenesis protein NrfE. Members of this protein family closely resemble the CcmF protein of the CcmABCDEFGH system, or system I, for c-type cytochrome biogenesis (GenProp0678). Members are found, as a rule, next to closely related paralogs of CcmG and CcmH and always located near other genes associated with the cytochrome c nitrite reductase enzyme complex. As a rule, members are found in species that also encode bona fide members of the CcmF, CcmG, and CcmH families. Length = 628 Score = 25.8 bits (57), Expect = 2.5 Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 5/48 (10%) Query: 1 MQRLYEYGMMAALIAVAIIAAVTKLGGSLKGAF-EEVANQMSHQTTKP 47 +L + GM+ A + VAI A +G + F E+ +++ Q +P Sbjct: 478 TLKLRQLGMVLAHLGVAICA----IGAIMVSYFGSEIGVRLAPQQQQP 521 >gnl|CDD|185056 PRK15101, PRK15101, protease3; Provisional. Length = 961 Score = 25.3 bits (56), Expect = 3.2 Identities = 17/59 (28%), Positives = 23/59 (38%), Gaps = 19/59 (32%) Query: 2 QRLYEYGMMAALI-------AVAIIAAVTKLGGSLKGAFEEVANQMSHQTTKPPVTRPV 53 QR Y +M A+I +A +AA T F V N + P +T PV Sbjct: 223 QRYYSANLMKAVIYSNQPLPELAKLAADT---------FGRVPN---KNASVPEITVPV 269 >gnl|CDD|149519 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal. This domain is found to the N-terminus of bacterial signal peptidases of the S49 family (pfam01343). Length = 154 Score = 25.2 bits (56), Expect = 3.8 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Query: 1 MQRLYEYGMMAA---LIAVAIIAAV 22 M+ L EYG+ A + VAIIA V Sbjct: 1 MEFLAEYGLFLAKTVTVVVAIIAVV 25 >gnl|CDD|184899 PRK14906, PRK14906, DNA-directed RNA polymerase subunit beta'/alpha domain fusion protein; Provisional. Length = 1460 Score = 24.8 bits (54), Expect = 5.1 Identities = 8/22 (36%), Positives = 14/22 (63%) Query: 32 AFEEVANQMSHQTTKPPVTRPV 53 FE+ AN + + +PPV +P+ Sbjct: 1157 EFEDTANNLILEGKQPPVGQPL 1178 >gnl|CDD|130392 TIGR01325, O_suc_HS_sulf, O-succinylhomoserine sulfhydrylase. This model describes O-succinylhomoserine sulfhydrylase, one of several related pyridoxal phosphate-dependent enzymes of cysteine and methionine metabolism. This enzyme is part of an alternative pathway of homocysteine biosynthesis, a step in methionine biosynthesis. Length = 380 Score = 24.8 bits (54), Expect = 5.1 Identities = 12/29 (41%), Positives = 13/29 (44%) Query: 45 TKPPVTRPVTPTSTEMPPRSRYNTGIGYG 73 K +T P T T M P R GIG G Sbjct: 330 AKSTITHPATTTHGRMQPEERAAAGIGDG 358 >gnl|CDD|139352 PRK13029, PRK13029, 2-oxoacid ferredoxin oxidoreductase; Provisional. Length = 1186 Score = 24.4 bits (53), Expect = 7.1 Identities = 24/74 (32%), Positives = 27/74 (36%), Gaps = 14/74 (18%) Query: 12 ALIAVAIIAAVTKLGGSLK------------GAFEEVANQMSHQTTKPPVTRPVTP--TS 57 ALIA AI + LG A E A Q T + P P TS Sbjct: 406 ALIAKAIARRLAALGLPADVAARMDARVADIEAKERAAAQPRLLTERKPWFCSGCPHNTS 465 Query: 58 TEMPPRSRYNTGIG 71 T +P SR GIG Sbjct: 466 TRVPEGSRALAGIG 479 >gnl|CDD|178374 PLN02775, PLN02775, Probable dihydrodipicolinate reductase. Length = 286 Score = 24.2 bits (53), Expect = 8.1 Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Query: 15 AVAIIAAVTKLGGSLKGAFEEVANQM--SHQTTK 46 VA AA+ + GAF ++ SHQ TK Sbjct: 140 VVAFQAAMEIMAEQFPGAFSGYTLEVVESHQATK 173 >gnl|CDD|148367 pfam06724, DUF1206, Domain of Unknown Function (DUF1206). This region consists of two a pair of transmembrane helices and occurs three times in each of the family member proteins. Length = 73 Score = 24.0 bits (53), Expect = 8.7 Identities = 8/33 (24%), Positives = 13/33 (39%) Query: 7 YGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQ 39 Y ++ L A + G GA +A+Q Sbjct: 11 YLLIGVLALQAALGGGGGGAGGTSGALATLASQ 43 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.316 0.129 0.368 Gapped Lambda K H 0.267 0.0552 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,240,635 Number of extensions: 60015 Number of successful extensions: 234 Number of sequences better than 10.0: 1 Number of HSP's gapped: 234 Number of HSP's successfully gapped: 29 Length of query: 75 Length of database: 5,994,473 Length adjustment: 45 Effective length of query: 30 Effective length of database: 5,022,113 Effective search space: 150663390 Effective search space used: 150663390 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.4 bits)