RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780735|ref|YP_003065148.1| hypothetical protein
CLIBASIA_03110 [Candidatus Liberibacter asiaticus str. psy62]
         (75 letters)



>3l0z_A Putative nicotinate-nucleotide- dimethylbenzimidazole
          phosphoribosyltransferase; COBT, MCSG, PSI, structural
          genomics; 2.65A {Methanocaldococcus jannaschii} (A:)
          Length = 350

 Score = 30.2 bits (68), Expect = 0.096
 Identities = 9/45 (20%), Positives = 16/45 (35%), Gaps = 3/45 (6%)

Query: 12 ALIAVAIIAAVTKLGGSLKGAFEEVANQMS--HQTTKPPVTRPVT 54
          ++IA+     + K+ G     F  V + +          V R V 
Sbjct: 2  SIIAINENGFLDKIKGRN-PLFTCVISSIETTLSIPISGVHRDVI 45


>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl-
          carrier-protein] reductase; RHLG-NADP complex,
          oxidoreductase; HET: NAP; 2.30A {Pseudomonas
          aeruginosa} (A:)
          Length = 276

 Score = 27.5 bits (58), Expect = 0.66
 Identities = 4/26 (15%), Positives = 7/26 (26%)

Query: 40 MSHQTTKPPVTRPVTPTSTEMPPRSR 65
          M         +  + P  + M P   
Sbjct: 1  MGSSHHHHHHSSGLVPRGSHMHPYFS 26


>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1;
          hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES;
          1.55A {Homo sapiens} (A:1-264)
          Length = 264

 Score = 25.9 bits (54), Expect = 1.8
 Identities = 6/25 (24%), Positives = 8/25 (32%)

Query: 40 MSHQTTKPPVTRPVTPTSTEMPPRS 64
          M HQ       +   P + E  P  
Sbjct: 1  MKHQHQHQHQHQHQQPLNEEFRPEM 25


>2pft_A Exocytosis protein; helix-turn-helix, endocytosis/exocytosis
           complex; 2.25A {Mus musculus} (A:238-402)
          Length = 165

 Score = 25.7 bits (56), Expect = 2.4
 Identities = 6/49 (12%), Positives = 15/49 (30%), Gaps = 4/49 (8%)

Query: 18  IIAAVTKLGGSLKGAFEEVANQMSHQTTKPPVTRPVTPTSTEMPPRSRY 66
           +   +T +      A E+ A+ + +   K        P    +   +  
Sbjct: 60  LPGLITSMETIGAKALEDFADNIKNDPDK----EYNMPKDGTVHELTSN 104


>3cxt_A Dehydrogenase with different specificities; rossman fold,
          oxidoreductase; HET: NAP GKR; 1.90A {Streptococcus
          suis} PDB: 3cxr_A* (A:)
          Length = 291

 Score = 25.0 bits (52), Expect = 3.4
 Identities = 3/26 (11%), Positives = 7/26 (26%)

Query: 40 MSHQTTKPPVTRPVTPTSTEMPPRSR 65
          M         +  + P  + M  +  
Sbjct: 1  MGSSHHHHHHSSGLVPRGSHMNQQFS 26


>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET:
          SUC; 1.25A {Bacillus halodurans c-125} PDB: 1ynq_A*
          (A:)
          Length = 317

 Score = 24.4 bits (51), Expect = 5.4
 Identities = 6/39 (15%), Positives = 12/39 (30%), Gaps = 5/39 (12%)

Query: 40 MSHQTTKPPVTRPVTPTSTEMPPRSRYNTG-----IGYG 73
          M         +  + P  + M  R    +      +G+G
Sbjct: 1  MGSSHHHHHHSSGLVPRGSHMKKRQLGTSDLHVSELGFG 39


>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity
           clamp, DNA sliding clamp, AAA+ ATPase, DNA polymerase;
           HET: ATG ADP; 2.85A {Saccharomyces cerevisiae}
           (A:395-516)
          Length = 122

 Score = 24.3 bits (53), Expect = 6.4
 Identities = 7/25 (28%), Positives = 12/25 (48%)

Query: 20  AAVTKLGGSLKGAFEEVANQMSHQT 44
           A + K+  ++K  F    N M+H  
Sbjct: 94  AIIKKIPATVKSGFTRKYNSMTHPV 118


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.316    0.129    0.368 

Gapped
Lambda     K      H
   0.267   0.0611    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 552,019
Number of extensions: 19011
Number of successful extensions: 82
Number of sequences better than 10.0: 1
Number of HSP's gapped: 82
Number of HSP's successfully gapped: 15
Length of query: 75
Length of database: 4,956,049
Length adjustment: 41
Effective length of query: 34
Effective length of database: 3,570,044
Effective search space: 121381496
Effective search space used: 121381496
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.3 bits)