BLAST/BLAST alignment of GI: 254780735 and GI: 254780732
>gi|254780732|ref|YP_003065145.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter asiaticus str. psy62] Length = 58
 Score = 45.4 bits (106), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 30/36 (83%)

Query: 6  EYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMS 41
          EYG++A+LIAVAIIA+VT LGG L   F +++++++
Sbjct: 20 EYGLLASLIAVAIIASVTTLGGKLTAVFADISSKLN 55