BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780735|ref|YP_003065148.1| hypothetical protein CLIBASIA_03110 [Candidatus Liberibacter asiaticus str. psy62] (75 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780735|ref|YP_003065148.1| hypothetical protein CLIBASIA_03110 [Candidatus Liberibacter asiaticus str. psy62] Length = 75 Score = 153 bits (386), Expect = 5e-40, Method: Compositional matrix adjust. Identities = 75/75 (100%), Positives = 75/75 (100%) Query: 1 MQRLYEYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMSHQTTKPPVTRPVTPTSTEM 60 MQRLYEYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMSHQTTKPPVTRPVTPTSTEM Sbjct: 1 MQRLYEYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMSHQTTKPPVTRPVTPTSTEM 60 Query: 61 PPRSRYNTGIGYGRT 75 PPRSRYNTGIGYGRT Sbjct: 61 PPRSRYNTGIGYGRT 75 >gi|254780732|ref|YP_003065145.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter asiaticus str. psy62] Length = 58 Score = 45.4 bits (106), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 19/36 (52%), Positives = 30/36 (83%) Query: 6 EYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMS 41 EYG++A+LIAVAIIA+VT LGG L F +++++++ Sbjct: 20 EYGLLASLIAVAIIASVTTLGGKLTAVFADISSKLN 55 >gi|254780733|ref|YP_003065146.1| hypothetical protein CLIBASIA_03100 [Candidatus Liberibacter asiaticus str. psy62] Length = 56 Score = 45.1 bits (105), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 20/31 (64%), Positives = 26/31 (83%) Query: 6 EYGMMAALIAVAIIAAVTKLGGSLKGAFEEV 36 EYG++A+LIAVAIIA+VT LGG L FE++ Sbjct: 20 EYGLLASLIAVAIIASVTTLGGKLSKVFEDI 50 >gi|254780730|ref|YP_003065143.1| hypothetical protein CLIBASIA_03085 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Score = 44.3 bits (103), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Query: 6 EYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMSHQTTKP--PVTRPVTPTSTE 59 EYG++A+L++VAII+AV+ LG +KG ++ ++ ++ P P + P+ P S+ Sbjct: 20 EYGLLASLVSVAIISAVSTLGDRMKGVYQTISTELDKGDVPPTKPGSVPMQPESSN 75 >gi|254780734|ref|YP_003065147.1| Flp/Fap pilin component [Candidatus Liberibacter asiaticus str. psy62] Length = 62 Score = 42.7 bits (99), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 19/31 (61%), Positives = 24/31 (77%) Query: 6 EYGMMAALIAVAIIAAVTKLGGSLKGAFEEV 36 EYG++ +LIAV II +VT LGG LK AFE + Sbjct: 20 EYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50 >gi|254780736|ref|YP_003065149.1| hypothetical protein CLIBASIA_03115 [Candidatus Liberibacter asiaticus str. psy62] Length = 60 Score = 36.6 bits (83), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 29/37 (78%), Positives = 33/37 (89%) Query: 6 EYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMSH 42 EYGM+ ALIAVAIIAAVT LGGSLKG FEE AN++S+ Sbjct: 19 EYGMLVALIAVAIIAAVTMLGGSLKGTFEEAANRISN 55 >gi|254780170|ref|YP_003064583.1| cationic amino acid ABC transporter, periplasmic binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 342 Score = 20.8 bits (42), Expect = 4.6, Method: Composition-based stats. Identities = 9/21 (42%), Positives = 12/21 (57%) Query: 31 GAFEEVANQMSHQTTKPPVTR 51 G ++ NQ+S TT P V R Sbjct: 255 GITQKNINQVSKDTTNPDVQR 275 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.316 0.129 0.368 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,223 Number of Sequences: 1233 Number of extensions: 1050 Number of successful extensions: 7 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 75 length of database: 328,796 effective HSP length: 45 effective length of query: 30 effective length of database: 273,311 effective search space: 8199330 effective search space used: 8199330 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.2 bits) S2: 31 (16.5 bits)