Query gi|254780737|ref|YP_003065150.1| hypothetical protein CLIBASIA_03120 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 60 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Sun May 29 20:41:35 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780737.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR02858 spore_III_AA stage I 16.7 48 0.0012 16.3 0.5 23 13-36 49-71 (282) 2 COG5328 Uncharacterized protei 14.9 75 0.0019 15.3 1.1 14 9-22 91-104 (160) 3 TIGR02152 D_ribokin_bact ribok 14.0 96 0.0025 14.8 1.4 39 20-58 115-153 (303) 4 pfam04083 Abhydro_lipase ab-hy 11.5 90 0.0023 15.0 0.7 18 30-47 35-52 (62) 5 cd04881 ACT_HSDH-Hom ACT_HSDH_ 10.2 1.6E+02 0.0041 13.7 1.6 37 18-58 27-63 (79) 6 PRK02853 hypothetical protein; 10.2 1.6E+02 0.0041 13.8 1.5 20 10-33 93-112 (161) 7 TIGR00006 TIGR00006 S-adenosyl 9.7 1.3E+02 0.0032 14.3 0.9 12 22-33 301-312 (323) 8 pfam04880 NUDE_C NUDE protein, 9.6 83 0.0021 15.1 -0.1 25 28-54 7-31 (166) 9 cd03036 ArsC_like Arsenate Red 9.1 1.6E+02 0.0042 13.7 1.3 26 20-45 73-101 (111) 10 pfam06793 UPF0262 Uncharacteri 8.5 2E+02 0.005 13.4 1.5 19 10-32 91-109 (159) No 1 >TIGR02858 spore_III_AA stage III sporulation protein AA; InterPro: IPR014217 Proteins in this entry include the stage III sporulation protein AA that is encoded by one of several genes in the spoIIIA locus. This protein is only found in species that are capable of endospore formation.. Probab=16.74 E-value=48 Score=16.26 Aligned_cols=23 Identities=35% Similarity=0.574 Sum_probs=17.4 Q ss_pred HHHHHHHHHHCHHHHHHCCCCCHH Q ss_conf 988655431147665312865000 Q gi|254780737|r 13 FMITHSYYAFSQDEIKKNNPTLEK 36 (60) Q Consensus 13 fmithsyyafsqdeikknnptlek 36 (60) -|-.-|+||| .||||+--=|++- T Consensus 49 ~~S~ySlYA~-EeElk~GYITi~G 71 (282) T TIGR02858 49 LISQYSLYAF-EEELKQGYITIEG 71 (282) T ss_pred HHHHHHHHHH-HHHHHCCEEEEEC T ss_conf 8763124565-5765076078546 No 2 >COG5328 Uncharacterized protein conserved in bacteria [Function unknown] Probab=14.88 E-value=75 Score=15.34 Aligned_cols=14 Identities=43% Similarity=0.811 Sum_probs=10.9 Q ss_pred HHHHHHHHHHHHHH Q ss_conf 89999886554311 Q gi|254780737|r 9 ALSFFMITHSYYAF 22 (60) Q Consensus 9 alsffmithsyyaf 22 (60) .-.+|||..|||.- T Consensus 91 vkDYfmICeSYY~A 104 (160) T COG5328 91 VKDYFMICESYYQA 104 (160) T ss_pred HHHHHHHHHHHHHH T ss_conf 87898879999999 No 3 >TIGR02152 D_ribokin_bact ribokinase; InterPro: IPR011877 This entry describes ribokinase, an enzyme catalyzing the first step in ribose catabolism. The rbsK gene encoding ribokinase typically is found with ribose transport genes. Ribokinase belongs to the carbohydrate kinase pfkB family. ; GO: 0004747 ribokinase activity, 0006014 D-ribose metabolic process. Probab=14.02 E-value=96 Score=14.82 Aligned_cols=39 Identities=21% Similarity=0.324 Sum_probs=34.4 Q ss_pred HHHCHHHHHHCCCCCHHCCEEEEHHHHHHHHHHHHHHHH Q ss_conf 311476653128650006550000555556668877651 Q gi|254780737|r 20 YAFSQDEIKKNNPTLEKKPIVLMKHEIQEKKTLAAFTSF 58 (60) Q Consensus 20 yafsqdeikknnptlekkpivlmkheiqekktlaaftsf 58 (60) ..++.+.|+++...+++--+|||.-||-+.-++.||.-+ T Consensus 115 ~~l~~~~~~~~~~~i~~s~~~~~QlEiP~etv~~a~~~a 153 (303) T TIGR02152 115 AELTPEDIDAAEALIAESDIVLLQLEIPLETVLEALKIA 153 (303) T ss_pred CCCCHHHHHHHHHHHHHCCEEEEECCCCHHHHHHHHHHH T ss_conf 457988999999877468889972378889999999999 No 4 >pfam04083 Abhydro_lipase ab-hydrolase associated lipase region. Probab=11.52 E-value=90 Score=14.96 Aligned_cols=18 Identities=33% Similarity=0.569 Sum_probs=12.8 Q ss_pred CCCCCHHCCEEEEHHHHH Q ss_conf 286500065500005555 Q gi|254780737|r 30 NNPTLEKKPIVLMKHEIQ 47 (60) Q Consensus 30 nnptlekkpivlmkheiq 47 (60) +++.-.+||.|++.|-+- T Consensus 35 ~~~~~~~~p~Vll~HGL~ 52 (62) T pfam04083 35 NSNGKGGKPVVLLQHGLL 52 (62) T ss_pred CCCCCCCCCEEEEEEECC T ss_conf 887768898499983022 No 5 >cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains. The ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) encoded by the hom gene of Bacillus subtilis and other related sequences. HSDH reduces aspartate semi-aldehyde to the amino acid homoserine, one that is required for the biosynthesis of Met, Thr, and Ile from Asp. Neither the enzyme nor the aspartate pathway is found in the animal kingdom. This mostly bacterial HSDH group has a C-terminal ACT domain and is believed to be involved in enzyme regulation. A C-terminal deletion in the Corynebacterium glutamicum HSDH abolished allosteric inhibition by L-threonine. Members of this CD belong to the superfamily of ACT regulatory domains. Probab=10.17 E-value=1.6e+02 Score=13.75 Aligned_cols=37 Identities=30% Similarity=0.381 Sum_probs=23.7 Q ss_pred HHHHHCHHHHHHCCCCCHHCCEEEEHHHHHHHHHHHHHHHH Q ss_conf 54311476653128650006550000555556668877651 Q gi|254780737|r 18 SYYAFSQDEIKKNNPTLEKKPIVLMKHEIQEKKTLAAFTSF 58 (60) Q Consensus 18 syyafsqdeikknnptlekkpivlmkheiqekktlaaftsf 58 (60) |--..-|.+...+ +.-|+|++-|+.+|+.--+|.... T Consensus 27 SI~sv~Q~~~~~~----~~a~iviiTh~~~e~~i~~al~~i 63 (79) T cd04881 27 SIESVIQKEADGG----ETAPVVIVTHETSEAALNAALAEI 63 (79) T ss_pred CHHHEEECCCCCC----CCCCEEEEECCCCHHHHHHHHHHH T ss_conf 8765151576789----965589995325099999999999 No 6 >PRK02853 hypothetical protein; Provisional Probab=10.17 E-value=1.6e+02 Score=13.78 Aligned_cols=20 Identities=40% Similarity=0.891 Sum_probs=14.2 Q ss_pred HHHHHHHHHHHHHCHHHHHHCCCC Q ss_conf 999988655431147665312865 Q gi|254780737|r 10 LSFFMITHSYYAFSQDEIKKNNPT 33 (60) Q Consensus 10 lsffmithsyyafsqdeikknnpt 33 (60) -.+|||..||| +-||+..|. T Consensus 93 kDYf~iCeSYy----~AIk~~~p~ 112 (161) T PRK02853 93 KDYFMICESYY----QAIRTATPS 112 (161) T ss_pred HHHHHHHHHHH----HHHHHCCHH T ss_conf 99999999999----999609987 No 7 >TIGR00006 TIGR00006 S-adenosyl-methyltransferase MraW; InterPro: IPR002903 This is a family of methyltransferases. Methyltransferases are responsible for the transfer of methyl groups between two molecules.; GO: 0008168 methyltransferase activity. Probab=9.69 E-value=1.3e+02 Score=14.27 Aligned_cols=12 Identities=42% Similarity=0.509 Sum_probs=5.6 Q ss_pred HCHHHHHHCCCC Q ss_conf 147665312865 Q gi|254780737|r 22 FSQDEIKKNNPT 33 (60) Q Consensus 22 fsqdeikknnpt 33 (60) =|++||+.|++. T Consensus 301 Ps~~Ei~~NpRs 312 (323) T TIGR00006 301 PSEEEIKENPRS 312 (323) T ss_pred CCHHHHHHCCCC T ss_conf 878999629885 No 8 >pfam04880 NUDE_C NUDE protein, C-terminal conserved region. This family represents the C-terminal conserved region of the NUDE proteins. NUDE proteins are involved in nuclear migration. Probab=9.61 E-value=83 Score=15.14 Aligned_cols=25 Identities=36% Similarity=0.511 Sum_probs=17.0 Q ss_pred HHCCCCCHHCCEEEEHHHHHHHHHHHH Q ss_conf 312865000655000055555666887 Q gi|254780737|r 28 KKNNPTLEKKPIVLMKHEIQEKKTLAA 54 (60) Q Consensus 28 kknnptlekkpivlmkheiqekktlaa 54 (60) .|-|-.+|+. +|+..|++||..|-. T Consensus 7 ~k~N~aiEr~--alLe~El~Eke~L~i 31 (166) T pfam04880 7 SKLNQALERN--ALLEMEYDEKESLRI 31 (166) T ss_pred HHHHHHHHHH--HHHHHHHHHHHHHHH T ss_conf 9999999998--888888768999999 No 9 >cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC. Proteins containing a redox active CXXC motif like TRX and glutaredoxin (GRX) function as protein disulfide oxidoreductases, altering the redox state of target proteins via the reversible oxidation of the active site dithiol. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from glutathione via GRX, through a single catalytic cysteine. Probab=9.14 E-value=1.6e+02 Score=13.74 Aligned_cols=26 Identities=23% Similarity=0.379 Sum_probs=18.9 Q ss_pred HHHCHHHHHH---CCCCCHHCCEEEEHHH Q ss_conf 3114766531---2865000655000055 Q gi|254780737|r 20 YAFSQDEIKK---NNPTLEKKPIVLMKHE 45 (60) Q Consensus 20 yafsqdeikk---nnptlekkpivlmkhe 45 (60) .++|.+|+.. .||+|-|.||+..... T Consensus 73 ~~ls~~e~~~ll~~~P~LikRPIi~~~~~ 101 (111) T cd03036 73 PSLSEEEALELLSSDGMLIKRPFVVDDDK 101 (111) T ss_pred CCCCHHHHHHHHHHCCCEEECCEEEECCE T ss_conf 13899999999985944475578988999 No 10 >pfam06793 UPF0262 Uncharacterized protein family (UPF0262). Probab=8.52 E-value=2e+02 Score=13.36 Aligned_cols=19 Identities=42% Similarity=0.896 Sum_probs=13.5 Q ss_pred HHHHHHHHHHHHHCHHHHHHCCC Q ss_conf 99998865543114766531286 Q gi|254780737|r 10 LSFFMITHSYYAFSQDEIKKNNP 32 (60) Q Consensus 10 lsffmithsyyafsqdeikknnp 32 (60) -.+|||..|||. -||+-.| T Consensus 91 kDYf~iCeSYy~----AIk~~~p 109 (159) T pfam06793 91 KDYFMICESYYE----AIRTATP 109 (159) T ss_pred HHHHHHHHHHHH----HHHHCCH T ss_conf 999999999999----9960999 Done!