RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780737|ref|YP_003065150.1| hypothetical protein CLIBASIA_03120 [Candidatus Liberibacter asiaticus str. psy62] (60 letters) >gnl|CDD|183415 PRK12297, obgE, GTPase CgtA; Reviewed. Length = 424 Score = 24.3 bits (54), Expect = 7.3 Identities = 11/35 (31%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Query: 24 QDEIKKNNPTLEKKP--IVLMKHEIQE-KKTLAAF 55 E+K NP L ++P +V K ++ E ++ L F Sbjct: 262 NKELKLYNPRLLERPQIVVANKMDLPEAEENLEEF 296 >gnl|CDD|162734 TIGR02152, D_ribokin_bact, ribokinase. This model describes ribokinase, an enzyme catalyzing the first step in ribose catabolism. The rbsK gene encoding ribokinase typically is found with ribose transport genes. Ribokinase belongs to the carbohydrate kinase pfkB family (pfam00294). In the wide gulf between the current trusted (360 bit) and noise (100 bit) cutoffs are a number of sequences, few of which are clustered with predicted ribose transport genes but many of which are currently annotated as if having ribokinase activity. Most likely some have this function and others do not. Length = 293 Score = 24.1 bits (53), Expect = 8.9 Identities = 8/35 (22%), Positives = 16/35 (45%) Query: 22 FSQDEIKKNNPTLEKKPIVLMKHEIQEKKTLAAFT 56 + ++I + + IVL++ EI + L A Sbjct: 110 LTPEDIDAAEALIAESDIVLLQLEIPLETVLEAAK 144 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.321 0.128 0.345 Gapped Lambda K H 0.267 0.0740 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 930,780 Number of extensions: 41548 Number of successful extensions: 97 Number of sequences better than 10.0: 1 Number of HSP's gapped: 97 Number of HSP's successfully gapped: 11 Length of query: 60 Length of database: 5,994,473 Length adjustment: 32 Effective length of query: 28 Effective length of database: 5,303,017 Effective search space: 148484476 Effective search space used: 148484476 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.0 bits)