RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780739|ref|YP_003065152.1| hypothetical protein CLIBASIA_03130 [Candidatus Liberibacter asiaticus str. psy62] (64 letters) >gnl|CDD|32663 COG2835, COG2835, Uncharacterized conserved protein [Function unknown]. Length = 60 Score = 70.2 bits (172), Expect = 1e-13 Identities = 26/55 (47%), Positives = 36/55 (65%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +D +LLEIL CP+ KG L E EL+ + LAYPIR G+P++L EAR + + Sbjct: 1 MDYRLLEILACPVCKGPLVYDEEKQELICPRCKLAYPIRDGIPVLLPDEARDLSE 55 >gnl|CDD|146547 pfam03966, Trm112p, Trm112p-like protein. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. Trm112p is required for tRNA methylation in S. cerevisiae and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices. Length = 47 Score = 43.1 bits (102), Expect = 1e-05 Identities = 23/47 (48%), Positives = 26/47 (55%), Gaps = 7/47 (14%) Query: 9 DPQLLEILVCPLTKGNLTLIS-------EGTELLSKKASLAYPIRSG 48 D LLEIL CPL KG L L+ E EL+ + LAYPIR G Sbjct: 1 DLLLLEILACPLCKGPLALVEVAGHYDIEEGELVCPECGLAYPIRDG 47 >gnl|CDD|38421 KOG3211, KOG3211, KOG3211, Predicted endoplasmic reticulum membrane protein Lec35/MPDU1 involved in monosaccharide-P-dolichol utilization [General function prediction only]. Length = 230 Score = 24.1 bits (52), Expect = 7.9 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Query: 10 PQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVP 50 PQ+++I +G L+++S EL+ +L+Y SG P Sbjct: 48 PQIMKIRAAKSARG-LSVVSLLLELVGYTVTLSYSYTSGYP 87 >gnl|CDD|36304 KOG1088, KOG1088, KOG1088, Uncharacterized conserved protein [Function unknown]. Length = 124 Score = 24.1 bits (52), Expect = 8.7 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 28 ISEGTELLSKKASLAYPIRSGVPIMLVSEA 57 + EG EL+ + +PI G+P ML+SE Sbjct: 94 VIEG-ELVCPETGRVFPISDGIPNMLLSED 122 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.318 0.137 0.375 Gapped Lambda K H 0.267 0.0731 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 666,306 Number of extensions: 23259 Number of successful extensions: 37 Number of sequences better than 10.0: 1 Number of HSP's gapped: 36 Number of HSP's successfully gapped: 6 Length of query: 64 Length of database: 6,263,737 Length adjustment: 36 Effective length of query: 28 Effective length of database: 5,485,813 Effective search space: 153602764 Effective search space used: 153602764 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.4 bits)