RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780739|ref|YP_003065152.1| hypothetical protein CLIBASIA_03130 [Candidatus Liberibacter asiaticus str. psy62] (64 letters) >2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4KFT4, structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens pf-5} (A:) Length = 69 Score = 79.4 bits (196), Expect = 2e-16 Identities = 30/54 (55%), Positives = 39/54 (72%) Query: 9 DPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D +LL+IL CP+ KG L L ++ TEL+SK A LAYPIR G+P+ L SEAR + Sbjct: 2 DTKLLDILACPICKGPLKLSADKTELISKGAGLAYPIRDGIPVXLESEARTLTT 55 >2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} (A:) Length = 70 Score = 79.0 bits (195), Expect = 2e-16 Identities = 26/56 (46%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ +LL+ILVCP+ KG L EL+ LA+P+R GVPIML +EAR +D + Sbjct: 1 MESRLLDILVCPVCKGRLEFQRAQAELVCNADRLAFPVRDGVPIMLEAEARSLDAE 56 >2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthesis, NESG, structural genomics, PSI-2; 1.90A {Chromobacterium violaceum atcc 12472} (A:) Length = 68 Score = 78.9 bits (195), Expect = 2e-16 Identities = 26/54 (48%), Positives = 33/54 (61%) Query: 9 DPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D + LEILVCPL KG L EL+ K LA+PI+ G+P L SEAR++ Sbjct: 2 DAKFLEILVCPLCKGPLVFDKSKDELICKGDRLAFPIKDGIPXXLESEARELAP 55 >2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium; NMR {Neisseria meningitidis Z2491} (A:) Length = 68 Score = 78.2 bits (193), Expect = 3e-16 Identities = 26/56 (46%), Positives = 40/56 (71%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ + L+ILVCP+TKG L + EL S++A LAYPI+ G+P ML +EAR + ++ Sbjct: 1 MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYMLENEARPLSEE 56 >2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} (A:) Length = 67 Score = 77.8 bits (192), Expect = 4e-16 Identities = 22/57 (38%), Positives = 36/57 (63%) Query: 7 NIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++DPQLLE+L CP KG L + L++++ +LAY I G+P++L+ EA + Sbjct: 2 SLDPQLLEVLACPKDKGPLRYLESEQLLVNERLNLAYRIDDGIPVLLIDEATEWTPN 58 >2kpi_A Uncharacterized protein SCO3027; zinc finger, PSI-2, NESG, all beta, structural genomics, protein structure initiative; NMR {Streptomyces coelicolor} (A:) Length = 56 Score = 76.2 bits (188), Expect = 1e-15 Identities = 20/54 (37%), Positives = 29/54 (53%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++ LLEIL CP L + LAYP+R G+P++LV EAR+ + Sbjct: 3 LEAGLLEILACPACHAPLEERDAELICTGQDCGLAYPVRDGIPVLLVDEARRPE 56 >2k5r_A Uncharacterized protein XF2673; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Xylella fastidiosa TEMECULA1} (A:) Length = 97 Score = 64.3 bits (156), Expect = 5e-12 Identities = 14/82 (17%), Positives = 27/82 (32%), Gaps = 27/82 (32%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGT---------------------------ELLSKKAS 40 +D +LL +L P T+ L+L+ L+++ Sbjct: 1 MDRKLLHLLCSPDTRQPLSLLESKGLEALNKAIVSGTVQRADGSIQNQSLHEALITRDRK 60 Query: 41 LAYPIRSGVPIMLVSEARQVDD 62 + I +P++L EA Sbjct: 61 QVFRIEDSIPVLLPEEAIATIQ 82 >2j6a_A Protein TRM112; translation termination, methyltransferase, transferase, ERF1, nuclear protein, protein methylation; 1.7A {Saccharomyces cerevisiae} (A:) Length = 141 Score = 27.5 bits (61), Expect = 0.56 Identities = 9/31 (29%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 26 TLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 T I+EG + + Y I++G+P +L+ Sbjct: 103 TSIAEGE-MKCRNCGHIYYIKNGIPNLLLPP 132 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.318 0.137 0.375 Gapped Lambda K H 0.267 0.0690 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 397,916 Number of extensions: 11473 Number of successful extensions: 23 Number of sequences better than 10.0: 1 Number of HSP's gapped: 23 Number of HSP's successfully gapped: 8 Length of query: 64 Length of database: 4,956,049 Length adjustment: 32 Effective length of query: 32 Effective length of database: 3,874,289 Effective search space: 123977248 Effective search space used: 123977248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.1 bits)