RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780739|ref|YP_003065152.1| hypothetical protein CLIBASIA_03130 [Candidatus Liberibacter asiaticus str. psy62] (64 letters) >2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthesis, NESG, structural genomics, PSI-2; 1.90A {Chromobacterium violaceum atcc 12472} SCOP: b.171.1.1 Length = 68 Score = 83.5 bits (207), Expect = 1e-17 Identities = 27/56 (48%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +D + LEILVCPL KG L EL+ K LA+PI+ G+P+ML SEAR++ + Sbjct: 1 MDAKFLEILVCPLCKGPLVFDKSKDELICKGDRLAFPIKDGIPMMLESEARELAPE 56 >2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} Length = 70 Score = 82.0 bits (203), Expect = 2e-17 Identities = 26/56 (46%), Positives = 37/56 (66%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ +LL+ILVCP+ KG L EL+ LA+P+R GVPIML +EAR +D + Sbjct: 1 MESRLLDILVCPVCKGRLEFQRAQAELVCNADRLAFPVRDGVPIMLEAEARSLDAE 56 >2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4KFT4, structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens pf-5} SCOP: b.171.1.1 Length = 69 Score = 81.6 bits (202), Expect = 4e-17 Identities = 31/55 (56%), Positives = 41/55 (74%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 +D +LL+IL CP+ KG L L ++ TEL+SK A LAYPIR G+P+ML SEAR + Sbjct: 1 MDTKLLDILACPICKGPLKLSADKTELISKGAGLAYPIRDGIPVMLESEARTLTT 55 >2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 Length = 67 Score = 80.8 bits (200), Expect = 6e-17 Identities = 22/56 (39%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +DPQLLE+L CP KG L + L++++ +LAY I G+P++L+ EA + Sbjct: 3 LDPQLLEVLACPKDKGPLRYLESEQLLVNERLNLAYRIDDGIPVLLIDEATEWTPN 58 >2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium; NMR {Neisseria meningitidis Z2491} Length = 68 Score = 80.8 bits (200), Expect = 6e-17 Identities = 26/56 (46%), Positives = 40/56 (71%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 ++ + L+ILVCP+TKG L + EL S++A LAYPI+ G+P ML +EAR + ++ Sbjct: 1 MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYMLENEARPLSEE 56 >2kpi_A Uncharacterized protein SCO3027; zinc finger, PSI-2, NESG, all beta, structural genomics, protein structure initiative; NMR {Streptomyces coelicolor} Length = 56 Score = 76.9 bits (190), Expect = 9e-16 Identities = 20/54 (37%), Positives = 29/54 (53%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVD 61 ++ LLEIL CP L + LAYP+R G+P++LV EAR+ + Sbjct: 3 LEAGLLEILACPACHAPLEERDAELICTGQDCGLAYPVRDGIPVLLVDEARRPE 56 >2k5r_A Uncharacterized protein XF2673; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Xylella fastidiosa TEMECULA1} Length = 97 Score = 64.7 bits (157), Expect = 4e-12 Identities = 14/82 (17%), Positives = 27/82 (32%), Gaps = 27/82 (32%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGT---------------------------ELLSKKAS 40 +D +LL +L P T+ L+L+ L+++ Sbjct: 1 MDRKLLHLLCSPDTRQPLSLLESKGLEALNKAIVSGTVQRADGSIQNQSLHEALITRDRK 60 Query: 41 LAYPIRSGVPIMLVSEARQVDD 62 + I +P++L EA Sbjct: 61 QVFRIEDSIPVLLPEEAIATIQ 82 >2j6a_A Protein TRM112; translation termination, methyltransferase, transferase, ERF1, nuclear protein, protein methylation; 1.7A {Saccharomyces cerevisiae} Length = 141 Score = 26.7 bits (59), Expect = 1.3 Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 26 TLISEGTELLSKKASLAYPIRSGVPIMLVSE 56 T I+EG E+ + Y I++G+P +L+ Sbjct: 103 TSIAEG-EMKCRNCGHIYYIKNGIPNLLLPP 132 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 25.7 bits (56), Expect = 2.7 Identities = 13/88 (14%), Positives = 23/88 (26%), Gaps = 40/88 (45%) Query: 1 MRETIFNIDPQLLE-I----------LVCPLTK------------GNLTL-ISEGTELLS 36 +R +I ++++ I T G LT +GT Sbjct: 468 LRVLSGSISERIVDCIIRLPVKWETTTQFKATHILDFGPGGASGLGVLTHRNKDGT---- 523 Query: 37 KKASLAYPIRSGVPIMLVSE-ARQVDDQ 63 GV +++ DD Sbjct: 524 -----------GVRVIVAGTLDINPDDD 540 >3fde_A E3 ubiquitin-protein ligase UHRF1; SRA domain, base flipping, DNA CPG methylation, cell cycle, developmental protein, DNA damage; HET: 5CM; 1.41A {Mus musculus} PDB: 2zo0_B* 2zo2_B* 3f8i_A* 2zo1_B* 3f8j_B* 2zkd_A* 2zke_A* 2zkf_A* 2zkg_A 3dwh_A 3bi7_A 3clz_A* Length = 212 Score = 24.9 bits (54), Expect = 4.1 Identities = 10/35 (28%), Positives = 16/35 (45%) Query: 20 LTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLV 54 LT N L +++K + A R G P+ +V Sbjct: 90 LTNNNRALALNCHSPINEKGAEAEDWRQGKPVRVV 124 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.318 0.137 0.375 Gapped Lambda K H 0.267 0.0578 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 461,333 Number of extensions: 13871 Number of successful extensions: 37 Number of sequences better than 10.0: 1 Number of HSP's gapped: 36 Number of HSP's successfully gapped: 11 Length of query: 64 Length of database: 5,693,230 Length adjustment: 35 Effective length of query: 29 Effective length of database: 4,844,690 Effective search space: 140496010 Effective search space used: 140496010 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.4 bits)