RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780739|ref|YP_003065152.1| hypothetical protein CLIBASIA_03130 [Candidatus Liberibacter asiaticus str. psy62] (64 letters) >d2hf1a1 b.171.1.1 (A:2-60) Hypothetical protein CV3345 {Chromobacterium violaceum [TaxId: 536]} Length = 59 Score = 80.4 bits (199), Expect = 4e-17 Identities = 27/54 (50%), Positives = 35/54 (64%) Query: 9 DPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 D + LEILVCPL KG L EL+ K LA+PI+ G+P+ML SEAR++ Sbjct: 1 DAKFLEILVCPLCKGPLVFDKSKDELICKGDRLAFPIKDGIPMMLESEARELAP 54 >d2jnya1 b.171.1.1 (A:1-59) Uncharacterized protein Cgl1405/cg1592 {Corynebacterium glutamicum [TaxId: 1718]} Length = 59 Score = 79.3 bits (196), Expect = 8e-17 Identities = 22/56 (39%), Positives = 35/56 (62%) Query: 8 IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63 +DPQLLE+L CP KG L + L++++ +LAY I G+P++L+ EA + Sbjct: 3 LDPQLLEVLACPKDKGPLRYLESEQLLVNERLNLAYRIDDGIPVLLIDEATEWTPN 58 >d2pk7a1 b.171.1.1 (A:3-61) Uncharacterized protein PFL1779 {Pseudomonas fluorescens [TaxId: 294]} Length = 59 Score = 75.4 bits (186), Expect = 1e-15 Identities = 30/51 (58%), Positives = 38/51 (74%) Query: 12 LLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62 LL+IL CP+ KG L L ++ TEL+SK A LAYPIR G+P+ML SEAR + Sbjct: 3 LLDILACPICKGPLKLSADKTELISKGAGLAYPIRDGIPVMLESEARTLTT 53 >d2f7fa1 c.1.17.1 (A:141-485) Putative nicotinate phosphoribosyltransferase EF2626 {Enterococcus faecalis [TaxId: 1351]} Length = 345 Score = 24.5 bits (53), Expect = 2.5 Identities = 12/51 (23%), Positives = 16/51 (31%) Query: 9 DPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQ 59 D L L G + I E+ K L I SG + R+ Sbjct: 87 DCVFLVDTYDTLKAGVPSAIRVAREMGDKINFLGVRIDSGDMAYISKRVRE 137 >d2fiqa1 c.1.10.7 (A:1-420) Putative tagatose 6-phosphate kinase 1 GatZ {Escherichia coli [TaxId: 562]} Length = 420 Score = 24.0 bits (52), Expect = 3.4 Identities = 7/27 (25%), Positives = 16/27 (59%) Query: 38 KASLAYPIRSGVPIMLVSEARQVDDQG 64 +A+LA+ S +++ + + QV+ G Sbjct: 28 EAALAFDRNSTRKVLIEATSNQVNQFG 54 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.318 0.137 0.375 Gapped Lambda K H 0.267 0.0728 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 200,283 Number of extensions: 6140 Number of successful extensions: 11 Number of sequences better than 10.0: 1 Number of HSP's gapped: 11 Number of HSP's successfully gapped: 5 Length of query: 64 Length of database: 2,407,596 Length adjustment: 33 Effective length of query: 31 Effective length of database: 1,954,506 Effective search space: 60589686 Effective search space used: 60589686 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (21.9 bits)