RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780740|ref|YP_003065153.1| peptidase S16 lon domain protein [Candidatus Liberibacter asiaticus str. psy62] (221 letters) >gnl|CDD|182730 PRK10787, PRK10787, DNA-binding ATP-dependent protease La; Provisional. Length = 784 Score = 36.5 bits (84), Expect = 0.006 Identities = 44/197 (22%), Positives = 89/197 (45%), Gaps = 14/197 (7%) Query: 18 LPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLVQPAISGFLANSDNGLSQ 77 +P+ PL +++ P V + I ++ + D+ I LV + N L Sbjct: 11 IPVLPLRDVVVYPHMVIPLFVGREKSIRCLEAAMDHDKKIMLVAQKEASTDEPGVNDLFT 70 Query: 78 IGCIGRITSFVETDDGHYIMTVIGVCRFRL--LEEAYQLNSWRCFYI-APFISDLAGNDN 134 +G + I ++ DG + V G+ R R+ L + + S + Y+ +P I + + Sbjct: 71 VGTVASILQMLKLPDGTVKVLVEGLQRARISALSDNGEHFSAKAEYLESPTIDE---REQ 127 Query: 135 DGVDRVALLEVFRNYLTVNN-----LDADWESIEEASNEILVNSLAMLSPFSEEEKQALL 189 + + R A+ + F Y+ +N + SI++ + L +++A P +KQ++L Sbjct: 128 EVLVRTAISQ-FEGYIKLNKKIPPEVLTSLNSIDDPAR--LADTIAAHMPLKLADKQSVL 184 Query: 190 EAPDFRARAQTLIAIMK 206 E D R + L+A+M+ Sbjct: 185 EMSDVNERLEYLMAMME 201 >gnl|CDD|162028 TIGR00763, lon, ATP-dependent protease La. This protein is induced by heat shock and other stresses in E. coli, B. subtilis, and other species. The yeast member, designated PIM1, is located in the mitochondrial matrix, required for mitochondrial function, and also induced by heat shock. Length = 775 Score = 35.4 bits (82), Expect = 0.011 Identities = 40/210 (19%), Positives = 75/210 (35%), Gaps = 33/210 (15%) Query: 19 PIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLVQPAISGFLANSDNGLSQ- 77 P+ PL L PG V + I + L + + FL D+ Sbjct: 1 PLLPLRRRPLFPGMIKPIDVGREKSIKLIKEALRLKQPYLGL------FLQKDDDNEEPE 54 Query: 78 ------IGCIGRITSFVETDDGH---YIMTVIGVCRFRLLEEAYQLNSWRCFYIAPFISD 128 +G + +I + Y + V G+ R R+ E S + Y+ + + Sbjct: 55 EDDIYSVGVVAQILEMLPLPSSGTATYKVVVEGLRRIRIKEL-----SDKGGYLVVRVDN 109 Query: 129 LAGNDNDGVDRV------ALLEVFRNYLTVNNLDADWESIEEASNEI-----LVNSLAML 177 L D D + E FR ++++ L + ++ A +I L + +A Sbjct: 110 LKEEPFDKDDEEIKALTREIKETFRELISLSKLFREQPALLSALEDIDEPGRLADFVAAS 169 Query: 178 SPFSE-EEKQALLEAPDFRARAQTLIAIMK 206 E +E Q +LE + R + + ++K Sbjct: 170 LQLKEKDELQEVLETVNIEKRLKKALELLK 199 >gnl|CDD|162632 TIGR01972, NDH_I_M, proton-translocating NADH-quinone oxidoreductase, chain M. This model describes the 13th (based on E. coli) structural gene, M, of bacterial NADH dehydrogenase I, as well as chain 4 of the corresponding mitochondrial complex I and of the chloroplast NAD(P)H dehydrogenase complex. Length = 479 Score = 26.8 bits (60), Expect = 5.0 Identities = 19/84 (22%), Positives = 40/84 (47%), Gaps = 6/84 (7%) Query: 96 IMTVIGVCRFRLLEEAYQLNSWRCFYIAPFISDLAGNDNDGVDRVAL-LEVFRNYLTVNN 154 +++++ + +F +Q P+I L + + GVD ++L L + LT+ + Sbjct: 38 LLSLLLLFQFDPTGSGFQFTESI-----PWIPALGISYHLGVDGISLPLVLLTALLTLLS 92 Query: 155 LDADWESIEEASNEILVNSLAMLS 178 + A WESI++ E L + + Sbjct: 93 ILASWESIQKRVKEFYALFLLLEA 116 >gnl|CDD|130916 TIGR01857, FGAM-synthase, phosphoribosylformylglycinamidine synthase, clade II. This model represents a single-molecule form of phosphoribosylformylglycinamidine synthase, also called FGAM synthase, an enzyme of purine de novo biosynthesis. This model represents a second clade of these enzymes found in Clostridia, Bifidobacteria and Streptococcus species. This enzyme performs the fourth step in IMP biosynthesis (the precursor of all purines) from PRPP. Length = 1239 Score = 26.3 bits (58), Expect = 7.0 Identities = 18/74 (24%), Positives = 28/74 (37%), Gaps = 10/74 (13%) Query: 150 LTVNNLDADWESIEEASNEILVNSLAMLSPFSEEEKQALLEAPDFRARAQTLIAIMKIVL 209 L VN D E +E A L + P E+K+ +E P + + + A K+ Sbjct: 922 LKVNGEKLDLEELESA----WEGKLEEVFPSKFEDKKETVEVPAVASEKKVIKAKEKVEK 977 Query: 210 ARAY------THCE 217 R T+ E Sbjct: 978 PRVVIPVFPGTNSE 991 >gnl|CDD|181461 PRK08535, PRK08535, translation initiation factor IF-2B subunit delta; Provisional. Length = 310 Score = 26.0 bits (58), Expect = 7.3 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 8/34 (23%) Query: 67 FLANSDNGLSQIGCIG--RITSFVETDDGHYIMT 98 F+ +S+N + +IG IG RI DG IMT Sbjct: 99 FIESSENAVEKIGEIGAKRI------RDGDVIMT 126 >gnl|CDD|183140 PRK11447, PRK11447, cellulose synthase subunit BcsC; Provisional. Length = 1157 Score = 26.2 bits (58), Expect = 7.8 Identities = 12/22 (54%), Positives = 14/22 (63%) Query: 183 EEKQALLEAPDFRARAQTLIAI 204 E+Q L P FRARAQ L A+ Sbjct: 259 AEQQKQLADPAFRARAQGLAAV 280 >gnl|CDD|163115 TIGR03032, TIGR03032, conserved hypothetical protein TIGR03032. This protein family is uncharacterized. A number of motifs are conserved perfectly among all member sequences. The function of this protein is unknown. Length = 335 Score = 26.2 bits (58), Expect = 7.9 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 11/64 (17%) Query: 124 PFISDLAGNDNDGVDRVALLEVFRNYLTV---NNLDADWES--------IEEASNEILVN 172 PFIS LA D ++ +AL + Y+T +++ W I+ S E++ + Sbjct: 141 PFISKLAPEDRCHLNGMALDDGEPRYVTALSQSDVADGWREGRRDGGCVIDIPSGEVVAS 200 Query: 173 SLAM 176 L+M Sbjct: 201 GLSM 204 >gnl|CDD|149155 pfam07920, DUF1684, Protein of unknown function (DUF1684). The sequences featured in this family are found in hypothetical archaeal and bacterial proteins of unknown function. The region in question is approximately 200 amino acids long. Length = 142 Score = 25.6 bits (57), Expect = 9.1 Identities = 8/37 (21%), Positives = 10/37 (27%) Query: 82 GRITSFVETDDGHYIMTVIGVCRFRLLEEAYQLNSWR 118 R T G F L + Y L +R Sbjct: 28 PRPVEVETTTGRTVEYVRYGEVEFELDGKEYTLRVYR 64 >gnl|CDD|128994 smart00755, Grip, golgin-97, RanBP2alpha,Imh1p and p230/golgin-245. Length = 46 Score = 25.6 bits (57), Expect = 9.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Query: 163 EEASNEILVNSLAMLSPFSEEEKQALLEA 191 E+ E L+ ++ + S EE Q LLE Sbjct: 18 RESERETLLKVISTVLQLSPEEMQKLLEV 46 >gnl|CDD|181395 PRK08341, PRK08341, amidophosphoribosyltransferase; Provisional. Length = 442 Score = 25.6 bits (56), Expect = 9.5 Identities = 13/28 (46%), Positives = 17/28 (60%) Query: 151 TVNNLDADWESIEEASNEILVNSLAMLS 178 T + L A W S+E+ EI +SLA LS Sbjct: 386 TRHELIAAWGSVEDIRKEIGADSLAYLS 413 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.325 0.141 0.417 Gapped Lambda K H 0.267 0.0713 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,725,830 Number of extensions: 239295 Number of successful extensions: 613 Number of sequences better than 10.0: 1 Number of HSP's gapped: 612 Number of HSP's successfully gapped: 17 Length of query: 221 Length of database: 5,994,473 Length adjustment: 90 Effective length of query: 131 Effective length of database: 4,049,753 Effective search space: 530517643 Effective search space used: 530517643 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 55 (25.0 bits)