RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780742|ref|YP_003065155.1| hypothetical protein CLIBASIA_03145 [Candidatus Liberibacter asiaticus str. psy62] (419 letters) >gnl|CDD|31934 COG1748, LYS9, Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]. Length = 389 Score = 364 bits (937), Expect = e-101 Identities = 161/401 (40%), Positives = 223/401 (55%), Gaps = 33/401 (8%) Query: 2 KKNVLIIGAGGVAHVVAHKCAQNNDILGDINIASRTLQKCSKIIDSIYKKKSLKIDGKLA 61 +L+IGAGGV VVAHK AQN D G++ IA R+ +KC++I + I GK+ Sbjct: 1 MMKILVIGAGGVGSVVAHKLAQNGD--GEVTIADRSKEKCARIAELI--------GGKVE 50 Query: 62 IHQVDALNIKAVVELIKKTNSQIIINVGSSFLNMSVLRACIDSNVAYIDTAIHESPLKIC 121 QVDA ++ A+V LIK ++IN F+++++L+ACI + V Y+DT+ +E P Sbjct: 51 ALQVDAADVDALVALIKDF--DLVINAAPPFVDLTILKACIKTGVDYVDTSYYEEP---- 104 Query: 122 ESPPWYNNYEWSLLDECRTKSITAILGAGFDPGVVNAFARLAQDEYFDKITDIDIIDVNA 181 W L +E + ITA+LG GFDPG+ N A A E FD+I IDI Sbjct: 105 ---------PWKLDEEAKKAGITAVLGCGFDPGITNVLAAYAAKELFDEIESIDIYVGGL 155 Query: 182 GKH---DKYFATNFDAEINLREFTGVVYSWQKNQWCVNKMFEISRTYDLPTVGQHKVYLS 238 G+H +AT + EINLRE+T W+ +W E ++ P +G VY Sbjct: 156 GEHGDNPLGYATTWSPEINLREYTRPARYWENGKWVEVDPLEEREVFEFPVIGYGDVYAF 215 Query: 239 GHDEIHSLFKNIQG-ADIRFWMGFS-DHYINVFTVLKNIGLLSEQPIRTAENIEIAPLKI 296 HDE+ SL K I G RF M F ++ V L+++GLLS +P++ + EI PL+ Sbjct: 216 YHDELRSLVKTIPGVVRTRFEMTFRYPGHLEVIKALRDLGLLSREPVKVQQ--EIVPLEF 273 Query: 297 VKAVLPDPSSLAPNYQGKTCIGCLINGIYHGETREIFLYNICDHQNAYQEIASQGISYTA 356 +KAVLPDP SLAP+Y+ T IG + G G + +F YN+ DH AY E+ S ISYT Sbjct: 274 LKAVLPDPLSLAPDYKDVTVIGVEVKGTKDGRDKTVF-YNVKDHAEAYSEVGSSAISYTT 332 Query: 357 GTPPVATAILIAQGIWDIGKMVNIEELPPKPFLGTLQRMGL 397 G P A L+A+G W+ +VN EEL P PFL L GL Sbjct: 333 GVPAAIGAELLAEGEWETPGVVNPEELGPDPFLEKLLIRGL 373 >gnl|CDD|146194 pfam03435, Saccharop_dh, Saccharopine dehydrogenase. This family comprised of three structural domains that can not be separated in the linear sequence. In some organisms this enzyme is found as a bifunctional polypeptide with lysine ketoglutarate reductase. The saccharopine dehydrogenase can also function as a saccharopine reductase. Length = 384 Score = 280 bits (719), Expect = 5e-76 Identities = 119/405 (29%), Positives = 184/405 (45%), Gaps = 41/405 (10%) Query: 5 VLIIGAGGVAHVVAHKCAQNNDILGDINIASRTLQKCSKIIDSIYKKKSLKIDGKLAIHQ 64 VLIIGAGGV VA A++ D+ +I +A R+L+K + K L+ Sbjct: 1 VLIIGAGGVGQGVAPLLARHGDVD-EITVADRSLEKAQALAA---PKLGLRFI----AIA 52 Query: 65 VDALNIKAVVELIKKTNSQIIINVGSSFLNMSVLRACIDSNVAYIDTAIHESPLKICESP 124 VDA N +A+ L+K+ ++IN+ FL+++VL+ACI++ V Y+DT+ Sbjct: 53 VDADNYEALAALLKEG--DLVINLAPPFLSLTVLKACIETGVHYVDTSY----------- 99 Query: 125 PWYNNYEWSLLDECRTKSITAILGAGFDPGVVNAFARLAQDEYFDKITDIDIIDVNAGKH 184 + +L ++ + +TA+LG GFDPG+V+ FA+ A D+ D++ + + ++ G Sbjct: 100 --LREAQLALHEKAKEAGVTAVLGCGFDPGLVSVFAKYALDDLADELAKVLSVKIHCGGR 157 Query: 185 DKY------FATNFDAEINLREFTGVVYSWQKNQWCVNKMFEISRTYDLP-TVGQHKVYL 237 + FA + E L E T W+ +W RT P G Y Sbjct: 158 PEPKDNGLEFANTWSPEGLLEELTNPARYWENGKWVEVGWGSHERTIPFPYGHGPGYAYE 217 Query: 238 SGHDEIHSLFKNIQGA----DIRFWMGFSDHYINVFTVLKNIGLLSEQPIRTAENIEIAP 293 H+ +L + + F Y+ V +L ++GLL I P Sbjct: 218 IYHNRPGTLTRVRSWLPEAGGVLFGTIRIPGYLTVIKLLGDLGLLRPTVHYAY----IPP 273 Query: 294 LKIVKAVLPDPSSLAPNYQGKTCIGCLINGIYH-GETREIFLYNICDHQNAYQEIASQGI 352 L +KA+L P+SL P Q K IG + GI G +YN+ + +E + Sbjct: 274 LDALKALLESPASLGPEEQDKVRIGVEVEGIDKLGVLLTGHIYNVYGSGLSIEE-GRSAM 332 Query: 353 SYTAGTPPVATAILIAQGIWDIGKMVNIEE-LPPKPFLGTLQRMG 396 YT GTP A L+A G W +V EE L P PFL L +G Sbjct: 333 PYTTGTPAQVAAALLAGGEWAKPGVVEPEEDLDPDPFLPALPYLG 377 >gnl|CDD|37944 KOG2733, KOG2733, KOG2733, Uncharacterized membrane protein [Function unknown]. Length = 423 Score = 38.0 bits (88), Expect = 0.005 Identities = 33/155 (21%), Positives = 66/155 (42%), Gaps = 20/155 (12%) Query: 4 NVLIIGAGGVA--HVV--AHKCAQNNDILGDINIASRTLQKCSKIIDSIYKKKSLKIDGK 59 +V+I GA G ++V A + + +A R +K ++++ + +K + Sbjct: 7 DVVIYGASGFTGKYIVEEAVSSQVFEGL--SLAVAGRNEKKLQEVLEKVGEK-TGTDLSS 63 Query: 60 LAIHQVDALNIKAVVELIKKTNSQIIIN-VGS-SFLNMSVLRACIDSNVAYIDTAIHESP 117 I D+ N ++ E+ K+ +I+N VG F V++ACI++ ++D Sbjct: 64 SVILIADSANEASLDEMAKQAR--VIVNCVGPYRFHGEPVVKACIENGTHHVD------- 114 Query: 118 LKICESPPWYNNYEWSLLDECRTKSITAILGAGFD 152 I P + + D + K + + GFD Sbjct: 115 --ISGEPQFMERMQLKYHDLAKEKGVYIVSACGFD 147 >gnl|CDD|133443 cd01065, NAD_bind_Shikimate_DH, NAD(P) binding domain of Shikimate dehydrogenase. Shikimate dehydrogenase (DH) is an amino acid DH family member. Shikimate pathway links metabolism of carbohydrates to de novo biosynthesis of aromatic amino acids, quinones and folate. It is essential in plants, bacteria, and fungi but absent in mammals, thus making enzymes involved in this pathway ideal targets for broad spectrum antibiotics and herbicides. Shikimate DH catalyzes the reduction of 3-hydroshikimate to shikimate using the cofactor NADH. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily includes a wide variety of protein families including NAD(P)- binding domains of alcohol DHs, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate DH, lactate/malate DHs, formate/glycerate DHs, siroheme synthases, 6-phosphogluconate DHs, amino acid DHs, repressor rex, NAD-binding potassium channel domain, CoA-binding, and ornithine cyclodeaminase-like domains. These domains have an alpha-beta-alpha configuration. NAD binding involves numerous hydrogen and van der Waals contacts. Length = 155 Score = 36.1 bits (84), Expect = 0.017 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 4/69 (5%) Query: 2 KKNVLIIGAGGVAHVVAHKCAQNNDILGDINIASRTLQKCSKIIDSIYKKKSLK--IDGK 59 K VLI+GAGG A VA+ A+ I I +RTL+K + + + +D + Sbjct: 19 GKKVLILGAGGAARAVAYALAELG--AAKIVIVNRTLEKAKALAERFGELGIAIAYLDLE 76 Query: 60 LAIHQVDAL 68 + + D + Sbjct: 77 ELLAEADLI 85 >gnl|CDD|35393 KOG0172, KOG0172, KOG0172, Lysine-ketoglutarate reductase/saccharopine dehydrogenase [Amino acid transport and metabolism]. Length = 445 Score = 35.7 bits (82), Expect = 0.023 Identities = 16/48 (33%), Positives = 29/48 (60%), Gaps = 2/48 (4%) Query: 1 MKKNVLIIGAGGVAHVVAHKCAQNNDILGDINIASRTLQKCSKIIDSI 48 KK VL++G+G V+ VA ++ D+ ++ +ASRTL+ ++ I Sbjct: 1 TKKGVLLLGSGFVSRPVADFLSRKKDV--NVTVASRTLKDAEALVKGI 46 >gnl|CDD|30518 COG0169, AroE, Shikimate 5-dehydrogenase [Amino acid transport and metabolism]. Length = 283 Score = 34.1 bits (78), Expect = 0.069 Identities = 22/85 (25%), Positives = 35/85 (41%), Gaps = 15/85 (17%) Query: 3 KNVLIIGAGGVAHVVAHKCAQNNDILGDINIASRTLQKCSKIIDSIYKKKSLKIDGKLAI 62 K VLI+GAGG A VA A+ I + +RT ++ ++ D A Sbjct: 127 KRVLILGAGGAARAVAFALAEAG--AKRITVVNRTRERAEELADL--------FGELGAA 176 Query: 63 HQVDALNIKAVVELIKKTNSQIIIN 87 + AL +L + ++IN Sbjct: 177 VEAAALA-----DLEGLEEADLLIN 196 >gnl|CDD|144908 pfam01488, Shikimate_DH, Shikimate / quinate 5-dehydrogenase. This family contains both shikimate and quinate dehydrogenases. Shikimate 5-dehydrogenase catalyses the conversion of shikimate to 5-dehydroshikimate. This reaction is part of the shikimate pathway which is involved in the biosynthesis of aromatic amino acids. Quinate 5-dehydrogenase catalyses the conversion of quinate to 5-dehydroquinate. This reaction is part of the quinate pathway where quinic acid is exploited as a source of carbon in prokaryotes and microbial eukaryotes. Both the shikimate and quinate pathways share two common pathway metabolites 3-dehydroquinate and dehydroshikimate. Length = 134 Score = 32.3 bits (74), Expect = 0.28 Identities = 24/94 (25%), Positives = 44/94 (46%), Gaps = 26/94 (27%) Query: 3 KNVLIIGAGGVA-----HVVAHKCAQNNDILGDINIASRTLQKCSKIIDSIYKKKSLKID 57 K VL+IGAG +A H+++ I IA+RTL+K ++ + Sbjct: 13 KKVLLIGAGEMARLAAKHLLSKGAK-------KITIANRTLEKAKELAE----------- 54 Query: 58 GKLAIHQVDALNIKAVVELIKKTNSQIIINVGSS 91 + +V+AL + + EL+ + I+I+ S+ Sbjct: 55 -EFGGEEVEALPLDELEELLA--EADIVISATSA 85 >gnl|CDD|145810 pfam02844, GARS_N, Phosphoribosylglycinamide synthetase, N domain. Phosphoribosylglycinamide synthetase catalyses the second step in the de novo biosynthesis of purine. The reaction catalysed by Phosphoribosylglycinamide synthetase is the ATP- dependent addition of 5-phosphoribosylamine to glycine to form 5'phosphoribosylglycinamide. This domain is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (see pfam00289). Length = 99 Score = 32.0 bits (74), Expect = 0.34 Identities = 10/24 (41%), Positives = 16/24 (66%) Query: 4 NVLIIGAGGVAHVVAHKCAQNNDI 27 VL++G+GG H +A K AQ+ + Sbjct: 1 KVLVVGSGGREHALAWKLAQSPRV 24 >gnl|CDD|35458 KOG0237, KOG0237, KOG0237, Glycinamide ribonucleotide synthetase (GARS)/Aminoimidazole ribonucleotide synthetase (AIRS) [Nucleotide transport and metabolism]. Length = 788 Score = 31.8 bits (72), Expect = 0.35 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 1 MKKNVLIIGAGGVAHVVAHKCAQN 24 + NVL+IG+GG H +A K Q+ Sbjct: 1 ERVNVLVIGSGGREHALAWKLKQS 24 >gnl|CDD|30500 COG0151, PurD, Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism]. Length = 428 Score = 31.7 bits (72), Expect = 0.36 Identities = 12/25 (48%), Positives = 17/25 (68%) Query: 4 NVLIIGAGGVAHVVAHKCAQNNDIL 28 VL+IG+GG H +A K AQ+ +L Sbjct: 2 KVLVIGSGGREHALAWKLAQSPLVL 26 >gnl|CDD|30722 COG0373, HemA, Glutamyl-tRNA reductase [Coenzyme metabolism]. Length = 414 Score = 31.4 bits (71), Expect = 0.52 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 4/46 (8%) Query: 2 KKNVLIIGAGGVAHVVA-HKCAQNNDILGDINIASRTLQKCSKIID 46 K VL+IGAG + +VA H + + I IA+RTL++ ++ Sbjct: 178 DKKVLVIGAGEMGELVAKHLAEKG---VKKITIANRTLERAEELAK 220 >gnl|CDD|29457 cd02761, MopB_FmdB-FwdB, The MopB_FmdB-FwdB CD contains the molybdenum/tungsten formylmethanofuran dehydrogenases, subunit B (FmdB/FwdB), and other related proteins. Formylmethanofuran dehydrogenase catalyzes the first step in methane formation from CO2 in methanogenic archaea and some eubacteria. Members of this CD belong to the molybdopterin_binding (MopB) superfamily of proteins.. Length = 415 Score = 29.5 bits (66), Expect = 1.7 Identities = 23/112 (20%), Positives = 42/112 (37%), Gaps = 11/112 (9%) Query: 67 ALNIKAVVELIKKTNSQIIINVGSSFLNMSVLRACIDSNVAYIDTAIHESPLKI--CESP 124 NI+A + L+K +N + F + + + T + P ++ Sbjct: 253 HRNIEAAIRLVKA------LNEYTKFALLPLRGHYNVRGFNQVLTWLTGYPFRVDFSRGY 306 Query: 125 PWYNNYEWSLLDECRTKSITAILGAGFDPGVVNAFARLAQDEYFDKITDIDI 176 P YN E++ +D A+L DP F + A ++ +I I I Sbjct: 307 PRYNPGEFTAVDLLAEGEADALLIIASDPP--AHFPQSAV-KHLAEIPVIVI 355 >gnl|CDD|133452 cd05213, NAD_bind_Glutamyl_tRNA_reduct, NADP-binding domain of glutamyl-tRNA reductase. Glutamyl-tRNA reductase catalyzes the conversion of glutamyl-tRNA to glutamate-1-semialdehyde, initiating the synthesis of tetrapyrrole. Whereas tRNAs are generally associated with peptide bond formation in protein translation, here the tRNA activates glutamate in the initiation of tetrapyrrole biosynthesis in archaea, plants and many bacteria. In the first step, activated glutamate is reduced to glutamate-1-semi-aldehyde via the NADPH dependent glutamyl-tRNA reductase. Glutamyl-tRNA reductase forms a V-shaped dimer. Each monomer has 3 domains: an N-terminal catalytic domain, a classic nucleotide binding domain, and a C-terminal dimerization domain. Although the representative structure 1GPJ lacks a bound NADPH, a theoretical binding pocket has been described. (PMID 11172694). Amino acid dehydrogenase (DH)-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily includes a wide variety of protein families including NAD(P)- binding domains of alcohol DHs, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate DH, lactate/malate DHs, formate/glycerate DHs, siroheme synthases, 6-phosphogluconate DH, amino acid DHs, repressor rex, NAD-binding potassium channel domain, CoA-binding, and ornithine cyclodeaminase-like domains. These domains have an alpha-beta-alpha configuration. NAD binding involves numerous hydrogen and van der Waals contacts. Length = 311 Score = 28.4 bits (64), Expect = 3.4 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Query: 3 KNVLIIGAGGVAHVVAHKCAQNNDILGDINIASRTLQKCSKIID 46 K VL+IGAG + + A A + +I IA+RT ++ ++ Sbjct: 179 KKVLVIGAGEMGELAAKHLAAKG--VAEITIANRTYERAEELAK 220 >gnl|CDD|133424 cd01339, LDH-like_MDH, L-lactate dehydrogenase-like malate dehydrogenase proteins. Members of this subfamily have an LDH-like structure and an MDH enzymatic activity. Some members, like MJ0490 from Methanococcus jannaschii, exhibit both MDH and LDH activities. Tetrameric MDHs, including those from phototrophic bacteria, are more similar to LDHs than to other MDHs. LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH-like MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others. Length = 300 Score = 28.6 bits (65), Expect = 3.7 Identities = 11/25 (44%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Query: 7 IIGAGGVAHVVAHKCAQNNDILGDI 31 IIGAG V +A A LGD+ Sbjct: 3 IIGAGNVGATLAQLLALKE--LGDV 25 >gnl|CDD|34111 COG4408, COG4408, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 431 Score = 28.4 bits (63), Expect = 4.1 Identities = 12/62 (19%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Query: 3 KNVLIIGAGGVAHVVAHKCAQNNDILGDINIASRTLQKCSKIIDSIYKKKSLKIDGKLAI 62 VL++G G VA +A + + D + + +R + ++ ++ L + G+ Sbjct: 5 LPVLLLGTGPVAIQLAVDLSAHGD--ARLGLYNRPSTRSERLKQALALTPQLYLQGQGEA 62 Query: 63 HQ 64 H+ Sbjct: 63 HR 64 >gnl|CDD|35894 KOG0675, KOG0675, KOG0675, Calnexin [Posttranslational modification, protein turnover, chaperones]. Length = 558 Score = 28.1 bits (62), Expect = 4.7 Identities = 21/102 (20%), Positives = 35/102 (34%), Gaps = 16/102 (15%) Query: 309 PNYQGKTCIGCLINGIYHGE--TREIF--LYNICDHQNAYQEIASQGISYTAGTPP---- 360 PNY+GK + + N Y G R+I Y D I++ G+ + + Sbjct: 351 PNYKGKWILPMIDNPNYQGIWKPRKIPNPDYFEDDKPFTLTPISAVGLELWSMSSNILFD 410 Query: 361 ---VATAILIAQGI----WDIGKMVNIEELPPKPFLGTLQRM 395 + I +A+ I W + K E P + Sbjct: 411 NIIITKDIEVAEDIANFTWLL-KAAAEREKPFVQQVMEAAEG 451 >gnl|CDD|31442 COG1250, FadB, 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism]. Length = 307 Score = 27.5 bits (61), Expect = 6.5 Identities = 27/92 (29%), Positives = 39/92 (42%), Gaps = 22/92 (23%) Query: 3 KNVLIIGAG----GVAHVVAHKCAQNNDILGDIN--IASRTLQKCSKIIDSIYKKKSLKI 56 K V +IGAG G+A V A A + +L DI+ R L K ++ + +K L Sbjct: 4 KKVAVIGAGVMGAGIAAVFA--LAGYDVVLKDISPEALERALAYIEKNLEKLVEKGKLTE 61 Query: 57 DGK-------------LAIHQVDALNIKAVVE 75 + A+ D L I+AVVE Sbjct: 62 EEADAALARITPTTDLAALKDAD-LVIEAVVE 92 >gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family. The medium chain reductase/dehydrogenases (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH) , quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Other MDR members have only a catalytic zinc, and some contain no coordinated zinc. Length = 271 Score = 27.7 bits (62), Expect = 7.0 Identities = 8/16 (50%), Positives = 11/16 (68%) Query: 3 KNVLIIGAGGVAHVVA 18 VL++GAGGV + A Sbjct: 136 DTVLVLGAGGVGLLAA 151 >gnl|CDD|111045 pfam02106, Fanconi_C, Fanconi anaemia group C protein. Length = 559 Score = 27.5 bits (61), Expect = 7.6 Identities = 11/41 (26%), Positives = 22/41 (53%) Query: 43 KIIDSIYKKKSLKIDGKLAIHQVDALNIKAVVELIKKTNSQ 83 +I+D I++ L+ DG + + + + VE ++K N Q Sbjct: 293 RIVDEIFRNALLETDGAPEVLALIQVFTQCFVEALEKENKQ 333 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.320 0.137 0.412 Gapped Lambda K H 0.267 0.0791 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 5,103,059 Number of extensions: 272690 Number of successful extensions: 691 Number of sequences better than 10.0: 1 Number of HSP's gapped: 673 Number of HSP's successfully gapped: 23 Length of query: 419 Length of database: 6,263,737 Length adjustment: 96 Effective length of query: 323 Effective length of database: 4,189,273 Effective search space: 1353135179 Effective search space used: 1353135179 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 59 (26.4 bits)