RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780743|ref|YP_003065156.1| putative uracil-DNA glycosylase [Candidatus Liberibacter asiaticus str. psy62] (261 letters) >gnl|CDD|129841 TIGR00758, UDG_fam4, uracil-DNA glycosylase, family 4. This well-conserved family of proteins is about 200 residues in length and homologous to the N-terminus of the DNA polymerase of phage SPO1 of Bacillus subtilis. The member from Thermus thermophilus HB8 is known to act as uracil-DNA glycosylase, an enzyme of DNA base excision repair. Its appearance as a domain of phage DNA polymerases could be consistent with uracil-DNA glycosylase activity. Length = 173 Score = 102 bits (255), Expect = 1e-22 Identities = 43/156 (27%), Positives = 76/156 (48%), Gaps = 9/156 (5%) Query: 109 DLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQIHISMISPWHPPGNRNLSN 168 ++M +G P ++ G+PF G+ G +LD+ML +I + R ++I+ + PP NR+ + Sbjct: 23 NIMFVGEAPGREEDRKGRPFVGRAGKLLDEMLAAIGLSRENVYITNVVKCRPPNNRDPTP 82 Query: 169 IEMEICRPIIMRQIELISPKILLFIGNKTKNFFFNNDAQKTYQNLGKWSNLCTPHSI--- 225 E+E C P +++QIELI PK+++ +G + K + Sbjct: 83 EEVEACAPYLVKQIELIRPKVIICLGRTAAQSILG-----KNDGITKIRGRVFEYRYIGT 137 Query: 226 -IPTLATVHPQELIQYPLIKKNTWHALITLKKALKN 260 I AT HP L++ P +++ LK+ L N Sbjct: 138 KIKITATYHPAALLRNPQLRRELEEDFKKLKELLSN 173 >gnl|CDD|161940 TIGR00584, mug, mismatch-specific thymine-DNA glycosylate (mug). All proteins in this family for whcih functions are known are G-T or G-U mismatch glycosylases that function in base excision repair. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). Used 2pf model. Length = 328 Score = 29.6 bits (66), Expect = 0.88 Identities = 28/125 (22%), Positives = 46/125 (36%), Gaps = 28/125 (22%) Query: 105 TEGQDLMIIGYTPSDSDNISGKPFSGKTGNMLDKMLQSIEIMRTQ--------------I 150 T D++IIG P G + G GN K L + Q I Sbjct: 128 TFNLDIVIIGINPGLMAAYKGHHYPGP-GNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGI 186 Query: 151 HISMISPWHPPGNRNLSNIEMEICRPIIMRQIELISPKILLFIGN-------------KT 197 + + PG+++LS+ E I++++++ P+I +F G K Sbjct: 187 GFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKV 246 Query: 198 KNFFF 202 KN F Sbjct: 247 KNLEF 251 >gnl|CDD|162269 TIGR01246, dapE_proteo, succinyl-diaminopimelate desuccinylase, proteobacterial clade. This model describes a proteobacterial subset of succinyl-diaminopimelate desuccinylases. An experimentally confirmed Gram-positive lineage succinyl-diaminopimelate desuccinylase has been described for Corynebacterium glutamicum, and a neighbor-joining tree shows the seed members, SP:Q59284, and putative archaeal members such as TrEMBL:O58003 in a single clade. However, the archaeal members differ substantially, share a number of motifs with acetylornithine deacetylases rather than succinyl-diaminopimelate desuccinylases, and are not taken as trusted examples of succinyl-diaminopimelate desuccinylases. This model is limited to proteobacterial members for this reason. Length = 370 Score = 27.8 bits (62), Expect = 3.1 Identities = 9/23 (39%), Positives = 16/23 (69%) Query: 122 NISGKPFSGKTGNMLDKMLQSIE 144 ++SG+PF G ++DK ++IE Sbjct: 284 SLSGEPFLTNDGKLIDKAREAIE 306 >gnl|CDD|183403 PRK12285, PRK12285, tryptophanyl-tRNA synthetase; Reviewed. Length = 368 Score = 26.4 bits (59), Expect = 8.5 Identities = 9/15 (60%), Positives = 9/15 (60%) Query: 54 TNIRHIHSPLVQQAD 68 TNI HI P Q AD Sbjct: 178 TNIGHIFYPATQAAD 192 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.133 0.397 Gapped Lambda K H 0.267 0.0715 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 4,042,944 Number of extensions: 238630 Number of successful extensions: 367 Number of sequences better than 10.0: 1 Number of HSP's gapped: 366 Number of HSP's successfully gapped: 9 Length of query: 261 Length of database: 5,994,473 Length adjustment: 91 Effective length of query: 170 Effective length of database: 4,028,145 Effective search space: 684784650 Effective search space used: 684784650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 56 (25.4 bits)