BLAST/PSIBLAST alignment of GI: 254780744 and GI: 254718373 at iteration 1
>gi|254718373|ref|ZP_05180184.1| ABC transporter ATP-binding protein [Brucella sp. 83/13] Length = 277
>gi|265983334|ref|ZP_06096069.1| ABC transporter ATP-binding protein [Brucella sp. 83/13] Length = 277
>gi|264661926|gb|EEZ32187.1| ABC transporter ATP-binding protein [Brucella sp. 83/13] Length = 277
 Score =  328 bits (841), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 194/255 (76%), Gaps = 1/255 (0%)

Query: 9   GIEMPEFQENRASK-DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTF 67
           G++    Q NRAS+    L A  L K Y    VV GV   V+ GE VG+LGPNGAGKTT 
Sbjct: 23  GVDAISGQPNRASRLKGTLVARGLCKSYRGRQVVNGVSFGVRAGEAVGILGPNGAGKTTC 82

Query: 68  FYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV 127
           FYM+TGL+ ADSGSI+IDG D+T MPMYRR+RLGI YLPQEASIFRGL+VE NI AVLEV
Sbjct: 83  FYMVTGLVPADSGSIEIDGFDVTSMPMYRRSRLGIGYLPQEASIFRGLSVENNIKAVLEV 142

Query: 128 YEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFA 187
            EKD+ +R  +LD+LL+EF+I   R   A  LSGG+RRRLEIAR+L S P+++LLDEPFA
Sbjct: 143 VEKDRARRASELDALLEEFHIAHLRKAPAISLSGGERRRLEIARALASRPNFMLLDEPFA 202

Query: 188 GVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIID 247
           GVDP+A+SDI  L+R L SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   EI+ 
Sbjct: 203 GVDPIAVSDIQQLVRHLTSRGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRPAEIVA 262

Query: 248 NQDVRRLYLGDRFAF 262
           N DVRRLYLGD+F  
Sbjct: 263 NPDVRRLYLGDQFTL 277