BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780744|ref|YP_003065157.1| ABC transporter nucleotide
binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62]
         (262 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780744|ref|YP_003065157.1| ABC transporter nucleotide binding/ATPase protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040421|gb|ACT57217.1| ABC transporter nucleotide binding/ATPase protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 262

 Score =  534 bits (1376), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 262/262 (100%), Positives = 262/262 (100%)

Query: 1   MKSIRNYLGIEMPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPN 60
           MKSIRNYLGIEMPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPN
Sbjct: 1   MKSIRNYLGIEMPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPN 60

Query: 61  GAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEEN 120
           GAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEEN
Sbjct: 61  GAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEEN 120

Query: 121 ILAVLEVYEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYI 180
           ILAVLEVYEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYI
Sbjct: 121 ILAVLEVYEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYI 180

Query: 181 LLDEPFAGVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHG 240
           LLDEPFAGVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHG
Sbjct: 181 LLDEPFAGVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHG 240

Query: 241 TVQEIIDNQDVRRLYLGDRFAF 262
           TVQEIIDNQDVRRLYLGDRFAF
Sbjct: 241 TVQEIIDNQDVRRLYLGDRFAF 262


>gi|315121907|ref|YP_004062396.1| ABC transporter nucleotide binding/ATPase protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495309|gb|ADR51908.1| ABC transporter nucleotide binding/ATPase protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 251

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 210/251 (83%), Positives = 229/251 (91%)

Query: 12  MPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMM 71
           M + Q N   ++ LLSA SLTKKYNS YVVK VDL V PGEIVGLLGPNGAGKTTFFYM+
Sbjct: 1   MSDNQHNIIRRECLLSAHSLTKKYNSAYVVKDVDLDVYPGEIVGLLGPNGAGKTTFFYMI 60

Query: 72  TGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD 131
           TGLI ADSGSIKIDG+D+TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV+E+D
Sbjct: 61  TGLIPADSGSIKIDGSDVTKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVHEQD 120

Query: 132 KKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDP 191
           KKKR E+L+SLL EF ITK RHVLAPLLSGG+RRRLEIARSLVS PSYILLDEPFAGVDP
Sbjct: 121 KKKRRERLESLLSEFKITKLRHVLAPLLSGGERRRLEIARSLVSSPSYILLDEPFAGVDP 180

Query: 192 VAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDV 251
           VA+SDI +LIRDLA+RGIG+LITDHNVHE L LIDRAYIIHAGGVLAHGTV+EIIDN+DV
Sbjct: 181 VAVSDIQLLIRDLAARGIGVLITDHNVHETLNLIDRAYIIHAGGVLAHGTVKEIIDNKDV 240

Query: 252 RRLYLGDRFAF 262
           RRLYLG++F F
Sbjct: 241 RRLYLGNKFTF 251


>gi|325291768|ref|YP_004277632.1| ABC transporter nucleotide-binding protein/ATPase [Agrobacterium
           sp. H13-3]
 gi|325059621|gb|ADY63312.1| ABC transporter, nucleotide binding/ATPase protein [Agrobacterium
           sp. H13-3]
          Length = 269

 Score =  332 bits (851), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 163/247 (65%), Positives = 193/247 (78%)

Query: 16  QENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLI 75
           Q ++A  D  L A  LTK YN+  VV GV L V+ GE VGLLGPNGAGKTT FYM+TGL+
Sbjct: 23  QADKARYDGTLIAHGLTKTYNTRRVVNGVSLVVRRGEAVGLLGPNGAGKTTCFYMITGLV 82

Query: 76  CADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR 135
             DSG I I+GND+T MPMYRRARLG+ YLPQEASIFRGLTVEENI AVLEV+E D  KR
Sbjct: 83  PVDSGKIAINGNDVTTMPMYRRARLGVGYLPQEASIFRGLTVEENIRAVLEVHEPDSAKR 142

Query: 136 HEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAIS 195
             KLD LL+EF+I + R   A  LSGG+RRRLEIAR+L + P+++LLDEPFAGVDP+++S
Sbjct: 143 SRKLDELLEEFHIAQLRKSPAVALSGGERRRLEIARALATDPTFMLLDEPFAGVDPISVS 202

Query: 196 DIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLY 255
           DI  L+R L +RGIG+LITDHNV E L LIDRAYIIHAG VL HG   +I++N DVRRLY
Sbjct: 203 DIQNLVRHLTARGIGVLITDHNVRETLGLIDRAYIIHAGEVLTHGRADDIVNNPDVRRLY 262

Query: 256 LGDRFAF 262
           LG+ F+ 
Sbjct: 263 LGNNFSL 269


>gi|326537892|gb|ADZ86107.1| ABC transporter ATP-binding protein [Brucella melitensis M5-90]
          Length = 266

 Score =  329 bits (843), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 195/255 (76%), Gaps = 1/255 (0%)

Query: 9   GIEMPEFQENRASK-DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTF 67
           G++    Q N AS+  S L A  L K Y    VV GV   V+ GE+VG+LGPNGAGKTT 
Sbjct: 12  GVDAISGQPNMASRLKSTLVARGLCKSYRGRQVVNGVSFGVRAGEVVGILGPNGAGKTTC 71

Query: 68  FYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV 127
           FYM+TGL+ ADSGSI+IDG D+T MPMYRR+RLGI YLPQEASIFRGL+VE NI AVLEV
Sbjct: 72  FYMVTGLVPADSGSIEIDGFDVTSMPMYRRSRLGIGYLPQEASIFRGLSVENNIKAVLEV 131

Query: 128 YEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFA 187
            EKD+ +R  +LD+LL+EF+I   R   A  LSGG+RRRLEIAR+L S P+++LLDEPFA
Sbjct: 132 VEKDRARRASELDALLEEFHIAHLRKAPAISLSGGERRRLEIARALASRPNFMLLDEPFA 191

Query: 188 GVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIID 247
           GVDP+A+SDI  L+R L SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   EI+ 
Sbjct: 192 GVDPIAVSDIQQLVRHLTSRGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRPAEIVA 251

Query: 248 NQDVRRLYLGDRFAF 262
           N DVRRLYLGD+F  
Sbjct: 252 NPDVRRLYLGDQFTL 266


>gi|254718373|ref|ZP_05180184.1| ABC transporter ATP-binding protein [Brucella sp. 83/13]
 gi|265983334|ref|ZP_06096069.1| ABC transporter ATP-binding protein [Brucella sp. 83/13]
 gi|264661926|gb|EEZ32187.1| ABC transporter ATP-binding protein [Brucella sp. 83/13]
          Length = 277

 Score =  328 bits (841), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 194/255 (76%), Gaps = 1/255 (0%)

Query: 9   GIEMPEFQENRASK-DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTF 67
           G++    Q NRAS+    L A  L K Y    VV GV   V+ GE VG+LGPNGAGKTT 
Sbjct: 23  GVDAISGQPNRASRLKGTLVARGLCKSYRGRQVVNGVSFGVRAGEAVGILGPNGAGKTTC 82

Query: 68  FYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV 127
           FYM+TGL+ ADSGSI+IDG D+T MPMYRR+RLGI YLPQEASIFRGL+VE NI AVLEV
Sbjct: 83  FYMVTGLVPADSGSIEIDGFDVTSMPMYRRSRLGIGYLPQEASIFRGLSVENNIKAVLEV 142

Query: 128 YEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFA 187
            EKD+ +R  +LD+LL+EF+I   R   A  LSGG+RRRLEIAR+L S P+++LLDEPFA
Sbjct: 143 VEKDRARRASELDALLEEFHIAHLRKAPAISLSGGERRRLEIARALASRPNFMLLDEPFA 202

Query: 188 GVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIID 247
           GVDP+A+SDI  L+R L SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   EI+ 
Sbjct: 203 GVDPIAVSDIQQLVRHLTSRGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRPAEIVA 262

Query: 248 NQDVRRLYLGDRFAF 262
           N DVRRLYLGD+F  
Sbjct: 263 NPDVRRLYLGDQFTL 277


>gi|326408179|gb|ADZ65244.1| ABC transporter ATP-binding protein [Brucella melitensis M28]
          Length = 277

 Score =  328 bits (840), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 195/255 (76%), Gaps = 1/255 (0%)

Query: 9   GIEMPEFQENRASK-DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTF 67
           G++    Q N AS+  S L A  L K Y    VV GV   V+ GE+VG+LGPNGAGKTT 
Sbjct: 23  GVDAISGQPNMASRLKSTLVARGLCKSYRGRQVVNGVSFGVRAGEVVGILGPNGAGKTTC 82

Query: 68  FYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV 127
           FYM+TGL+ ADSGSI+IDG D+T MPMYRR+RLGI YLPQEASIFRGL+VE NI AVLEV
Sbjct: 83  FYMVTGLVPADSGSIEIDGFDVTSMPMYRRSRLGIGYLPQEASIFRGLSVENNIKAVLEV 142

Query: 128 YEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFA 187
            EKD+ +R  +LD+LL+EF+I   R   A  LSGG+RRRLEIAR+L S P+++LLDEPFA
Sbjct: 143 VEKDRARRASELDALLEEFHIAHLRKAPAISLSGGERRRLEIARALASRPNFMLLDEPFA 202

Query: 188 GVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIID 247
           GVDP+A+SDI  L+R L SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   EI+ 
Sbjct: 203 GVDPIAVSDIQQLVRHLTSRGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRPAEIVA 262

Query: 248 NQDVRRLYLGDRFAF 262
           N DVRRLYLGD+F  
Sbjct: 263 NPDVRRLYLGDQFTL 277


>gi|306842556|ref|ZP_07475207.1| ABC transporter ATP-binding protein [Brucella sp. BO2]
 gi|306287412|gb|EFM58892.1| ABC transporter ATP-binding protein [Brucella sp. BO2]
          Length = 254

 Score =  327 bits (837), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 165/248 (66%), Positives = 191/248 (77%), Gaps = 1/248 (0%)

Query: 16  QENRASK-DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGL 74
           Q NRAS+    L A  L K Y    VV GV   V+ GE VG+LGPNGAGKTT FYM+TGL
Sbjct: 7   QPNRASRLKGTLVARGLCKSYRGRQVVNGVSFGVRAGEAVGILGPNGAGKTTCFYMVTGL 66

Query: 75  ICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKK 134
           + ADSGSI+IDG D+T MPMYRR+RLGI YLPQEASIFRGL+VE NI AVLEV EKD+ +
Sbjct: 67  VPADSGSIEIDGFDVTSMPMYRRSRLGIGYLPQEASIFRGLSVENNIKAVLEVVEKDRAR 126

Query: 135 RHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAI 194
           R  +LD+LL+EF+I   R   A  LSGG+RRRLEIAR+L S P+++LLDEPFAGVDP+A+
Sbjct: 127 RASELDALLEEFHIAHLRKAPAISLSGGERRRLEIARALASRPNFMLLDEPFAGVDPIAV 186

Query: 195 SDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRL 254
           SDI  L+R L SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   EI+ N DVRRL
Sbjct: 187 SDIQQLVRHLTSRGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRPAEIVANPDVRRL 246

Query: 255 YLGDRFAF 262
           YLGD+F  
Sbjct: 247 YLGDQFTL 254


>gi|265999665|ref|ZP_05467329.2| ATP/GTP-binding site domain-containing protein A [Brucella
           melitensis bv. 2 str. 63/9]
 gi|263095208|gb|EEZ18877.1| ATP/GTP-binding site domain-containing protein A [Brucella
           melitensis bv. 2 str. 63/9]
          Length = 275

 Score =  327 bits (837), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 165/255 (64%), Positives = 194/255 (76%), Gaps = 1/255 (0%)

Query: 9   GIEMPEFQENRASK-DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTF 67
           G++    Q N AS+    L A  L K Y    VV GV   V+ GE+VG+LGPNGAGKTT 
Sbjct: 21  GVDAISGQPNMASRLKGTLVARGLCKSYRGRQVVNGVSFGVRAGEVVGILGPNGAGKTTC 80

Query: 68  FYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV 127
           FYM+TGL+ ADSGSI+IDG D+T MPMYRR+RLGI YLPQEASIFRGL+VE NI AVLEV
Sbjct: 81  FYMVTGLVPADSGSIEIDGFDVTSMPMYRRSRLGIGYLPQEASIFRGLSVENNIKAVLEV 140

Query: 128 YEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFA 187
            EKD+ +R  +LD+LL+EF+I   R   A  LSGG+RRRLEIAR+L S P+++LLDEPFA
Sbjct: 141 VEKDRARRASELDALLEEFHIAHLRKAPAISLSGGERRRLEIARALASRPNFMLLDEPFA 200

Query: 188 GVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIID 247
           GVDP+A+SDI  L+R L SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   EI+ 
Sbjct: 201 GVDPIAVSDIQQLVRHLTSRGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRPAEIVA 260

Query: 248 NQDVRRLYLGDRFAF 262
           N DVRRLYLGD+F  
Sbjct: 261 NPDVRRLYLGDQFTL 275


>gi|225851690|ref|YP_002731923.1| ABC transporter ATP-binding protein [Brucella melitensis ATCC
           23457]
 gi|225640055|gb|ACN99968.1| ABC transporter ATP-binding protein [Brucella melitensis ATCC
           23457]
          Length = 277

 Score =  326 bits (836), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 165/255 (64%), Positives = 194/255 (76%), Gaps = 1/255 (0%)

Query: 9   GIEMPEFQENRASK-DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTF 67
           G++    Q N AS+    L A  L K Y    VV GV   V+ GE+VG+LGPNGAGKTT 
Sbjct: 23  GVDAISGQPNMASRLKGTLVARGLCKSYRGRQVVNGVSFGVRAGEVVGILGPNGAGKTTC 82

Query: 68  FYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV 127
           FYM+TGL+ ADSGSI+IDG D+T MPMYRR+RLGI YLPQEASIFRGL+VE NI AVLEV
Sbjct: 83  FYMVTGLVPADSGSIEIDGFDVTSMPMYRRSRLGIGYLPQEASIFRGLSVENNIKAVLEV 142

Query: 128 YEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFA 187
            EKD+ +R  +LD+LL+EF+I   R   A  LSGG+RRRLEIAR+L S P+++LLDEPFA
Sbjct: 143 VEKDRARRASELDALLEEFHIAHLRKAPAISLSGGERRRLEIARALASRPNFMLLDEPFA 202

Query: 188 GVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIID 247
           GVDP+A+SDI  L+R L SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   EI+ 
Sbjct: 203 GVDPIAVSDIQQLVRHLTSRGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRPAEIVA 262

Query: 248 NQDVRRLYLGDRFAF 262
           N DVRRLYLGD+F  
Sbjct: 263 NPDVRRLYLGDQFTL 277


>gi|222147328|ref|YP_002548285.1| ABC transporter nucleotide binding/ATPase protein [Agrobacterium
           vitis S4]
 gi|221734318|gb|ACM35281.1| ABC transporter nucleotide binding/ATPase protein [Agrobacterium
           vitis S4]
          Length = 268

 Score =  325 bits (834), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 156/240 (65%), Positives = 190/240 (79%)

Query: 23  DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSI 82
           +  L A  LTK YN+  VV G  L V+ GE VGLLGPNGAGKTT FYM+TGL+  D G+I
Sbjct: 29  EGTLIAHGLTKTYNTRRVVNGASLVVRRGEAVGLLGPNGAGKTTCFYMITGLVPVDMGTI 88

Query: 83  KIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSL 142
            I+GND+T MPMYRR+RLG+ YLPQEASIFRGL+VE+NI AVLE++E DK KR +KL+ L
Sbjct: 89  AINGNDVTSMPMYRRSRLGVGYLPQEASIFRGLSVEDNIRAVLELHESDKTKREQKLNEL 148

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EFNI K R   A  LSGG+RRRLEIAR+L + P+++LLDEPFAGVDP+++SDI  L+R
Sbjct: 149 LAEFNIEKLRKAAAVSLSGGERRRLEIARALATDPTFMLLDEPFAGVDPISVSDIQNLVR 208

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L +RGIG+LITDHNV E L LIDRAYIIHAG VL HG   +I++N DVRRLYLG++F+ 
Sbjct: 209 HLTARGIGVLITDHNVRETLGLIDRAYIIHAGEVLTHGRADDIVNNPDVRRLYLGEKFSL 268


>gi|260567205|ref|ZP_05837675.1| ATP/GTP-binding site-containing protein A [Brucella suis bv. 4 str.
           40]
 gi|261215289|ref|ZP_05929570.1| ABC transporter ATP-binding protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|261314629|ref|ZP_05953826.1| ABC transporter ATP-binding protein [Brucella pinnipedialis
           M163/99/10]
 gi|260156723|gb|EEW91803.1| ATP/GTP-binding site-containing protein A [Brucella suis bv. 4 str.
           40]
 gi|260916896|gb|EEX83757.1| ABC transporter ATP-binding protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|261303655|gb|EEY07152.1| ABC transporter ATP-binding protein [Brucella pinnipedialis
           M163/99/10]
          Length = 275

 Score =  325 bits (833), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 165/255 (64%), Positives = 193/255 (75%), Gaps = 1/255 (0%)

Query: 9   GIEMPEFQENRASK-DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTF 67
           G++    Q N AS+    L A  L K Y    VV GV   V+ GE VG+LGPNGAGKTT 
Sbjct: 21  GVDAISGQPNMASRLKGTLVARGLCKSYRGRQVVNGVSFGVRAGEAVGILGPNGAGKTTC 80

Query: 68  FYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV 127
           FYM+TGL+ ADSGSI+IDG D+T MPMYRR+RLGI YLPQEASIFRGL+VE NI AVLEV
Sbjct: 81  FYMVTGLVPADSGSIEIDGFDVTSMPMYRRSRLGIGYLPQEASIFRGLSVENNIKAVLEV 140

Query: 128 YEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFA 187
            EKD+ +R  +LD+LL+EF+I   R   A  LSGG+RRRLEIAR+L S P+++LLDEPFA
Sbjct: 141 VEKDRARRASELDALLEEFHIAHLRKAPAISLSGGERRRLEIARALASRPNFMLLDEPFA 200

Query: 188 GVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIID 247
           GVDP+A+SDI  L+R L SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   EI+ 
Sbjct: 201 GVDPIAVSDIQQLVRHLTSRGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRPAEIVA 260

Query: 248 NQDVRRLYLGDRFAF 262
           N DVRRLYLGD+F  
Sbjct: 261 NPDVRRLYLGDQFTL 275


>gi|222084664|ref|YP_002543193.1| amino acid ABC transporter [Agrobacterium radiobacter K84]
 gi|221722112|gb|ACM25268.1| amino acid ABC transporter [Agrobacterium radiobacter K84]
          Length = 270

 Score =  325 bits (833), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 158/245 (64%), Positives = 192/245 (78%)

Query: 18  NRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICA 77
           ++A     L A  LTK Y +  VV GV L V+ GE VGLLGPNGAGKTT FYM+TGL+  
Sbjct: 26  DKARYQGTLIARGLTKTYRTRRVVNGVSLVVRRGEAVGLLGPNGAGKTTCFYMITGLVPV 85

Query: 78  DSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHE 137
           D G+I+IDGN++T MPMYRRARLG+ YLPQEASIFRGLTVEENI AVLEV+EKDK+KR  
Sbjct: 86  DEGTIEIDGNNVTSMPMYRRARLGVGYLPQEASIFRGLTVEENIRAVLEVHEKDKQKREH 145

Query: 138 KLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDI 197
           K+D LL+EF+I   R V A  LSGG+RRRLEIAR+L + P+++LLDEPFAGVDP++++DI
Sbjct: 146 KIDELLEEFHIRNLRTVPAIALSGGERRRLEIARALATDPTFMLLDEPFAGVDPISVADI 205

Query: 198 HVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLG 257
             L+  L +RGIG+LITDHNV E L LIDRAYIIHAG VL HG   +I+ N +VR+LYLG
Sbjct: 206 QNLVHHLTARGIGVLITDHNVRETLGLIDRAYIIHAGEVLTHGRANDIVSNPEVRKLYLG 265

Query: 258 DRFAF 262
           D F+ 
Sbjct: 266 DNFSL 270


>gi|209547659|ref|YP_002279576.1| ABC transporter [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209533415|gb|ACI53350.1| ABC transporter related [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 258

 Score =  325 bits (832), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 162/254 (63%), Positives = 196/254 (77%), Gaps = 4/254 (1%)

Query: 13  PEFQENRASKDS----LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFF 68
           PE Q   A+  S     L A  LTK Y +  VV GV L V+ GE VGLLGPNGAGKTT F
Sbjct: 5   PEPQAAGAADKSRYQGTLIARGLTKTYATRRVVNGVSLVVRRGEAVGLLGPNGAGKTTCF 64

Query: 69  YMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY 128
           YM+TGL+  D G+I+IDGND+TKMPMYRR+RLG+ YLPQEASIFRGLTVEENI AVLEV+
Sbjct: 65  YMITGLVPVDEGTIEIDGNDVTKMPMYRRSRLGVGYLPQEASIFRGLTVEENIRAVLEVH 124

Query: 129 EKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAG 188
            KDK +R +KL+ LL+EF+I K R   A  LSGG+RRRLEIAR+L + P+++LLDEPFAG
Sbjct: 125 VKDKAEREQKLNELLEEFHIQKLRKSAAVALSGGERRRLEIARALATDPTFMLLDEPFAG 184

Query: 189 VDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDN 248
           VDP++++DI  L+  L +RGIG+LITDHNV E L LIDRAYIIHAG VL HG   +I++N
Sbjct: 185 VDPISVADIQNLVHHLTARGIGVLITDHNVRETLGLIDRAYIIHAGEVLTHGRANDIVNN 244

Query: 249 QDVRRLYLGDRFAF 262
            +VRRLYLGD F+ 
Sbjct: 245 PEVRRLYLGDNFSL 258


>gi|17988073|ref|NP_540707.1| ABC transporter ATP-binding protein [Brucella melitensis bv. 1 str.
           16M]
 gi|23501068|ref|NP_697195.1| ABC transporter ATP-binding protein [Brucella suis 1330]
 gi|62289133|ref|YP_220926.1| ABC transporter ATP-binding protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82699072|ref|YP_413646.1| ABC transporter ATPase [Brucella melitensis biovar Abortus 2308]
 gi|161618145|ref|YP_001592032.1| ABC transporter ATP-binding protein [Brucella canis ATCC 23365]
 gi|163842427|ref|YP_001626831.1| ABC transporter ATP-binding protein [Brucella suis ATCC 23445]
 gi|225626696|ref|ZP_03784735.1| ABC transporter related protein [Brucella ceti str. Cudo]
 gi|237814627|ref|ZP_04593625.1| Uncharacterized ABC transporter ATP-binding protein in ntrA/rpoN
           5'region [Brucella abortus str. 2308 A]
 gi|254690461|ref|ZP_05153715.1| ABC transporter ATP-binding protein [Brucella abortus bv. 6 str.
           870]
 gi|254694950|ref|ZP_05156778.1| ABC transporter ATP-binding protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696581|ref|ZP_05158409.1| ABC transporter ATP-binding protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700966|ref|ZP_05162794.1| ABC transporter ATP-binding protein [Brucella suis bv. 5 str. 513]
 gi|254705336|ref|ZP_05167164.1| ABC transporter ATP-binding protein [Brucella suis bv. 3 str. 686]
 gi|254707151|ref|ZP_05168979.1| ABC transporter ATP-binding protein [Brucella pinnipedialis
           M163/99/10]
 gi|254709306|ref|ZP_05171117.1| ABC transporter ATP-binding protein [Brucella pinnipedialis B2/94]
 gi|254731494|ref|ZP_05190072.1| ABC transporter ATP-binding protein [Brucella abortus bv. 4 str.
           292]
 gi|256030829|ref|ZP_05444443.1| ABC transporter ATP-binding protein [Brucella pinnipedialis
           M292/94/1]
 gi|256045949|ref|ZP_05448821.1| ABC transporter ATP-binding protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256112662|ref|ZP_05453583.1| ABC transporter ATP-binding protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158854|ref|ZP_05456711.1| ABC transporter ATP-binding protein [Brucella ceti M490/95/1]
 gi|256254235|ref|ZP_05459771.1| ABC transporter ATP-binding protein [Brucella ceti B1/94]
 gi|256258717|ref|ZP_05464253.1| ABC transporter ATP-binding protein [Brucella abortus bv. 9 str.
           C68]
 gi|256368621|ref|YP_003106127.1| ABC transporter, ATP-binding protein [Brucella microti CCM 4915]
 gi|260169733|ref|ZP_05756544.1| ABC transporter, ATP-binding protein [Brucella sp. F5/99]
 gi|260546431|ref|ZP_05822171.1| ATP/GTP-binding site-containing protein A [Brucella abortus NCTC
           8038]
 gi|260563230|ref|ZP_05833716.1| ATP/GTP-binding site-containing protein A [Brucella melitensis bv.
           1 str. 16M]
 gi|260756013|ref|ZP_05868361.1| ABC transporter ATP-binding protein [Brucella abortus bv. 6 str.
           870]
 gi|260759237|ref|ZP_05871585.1| ABC transporter ATP-binding protein [Brucella abortus bv. 4 str.
           292]
 gi|260760959|ref|ZP_05873302.1| ABC transporter ATP-binding protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260885033|ref|ZP_05896647.1| ABC transporter ATP-binding protein [Brucella abortus bv. 9 str.
           C68]
 gi|261221384|ref|ZP_05935665.1| ABC transporter ATP-binding protein [Brucella ceti B1/94]
 gi|261316815|ref|ZP_05956012.1| ABC transporter ATP-binding protein [Brucella pinnipedialis B2/94]
 gi|261751484|ref|ZP_05995193.1| ABC transporter ATP-binding protein [Brucella suis bv. 5 str. 513]
 gi|261756047|ref|ZP_05999756.1| ABC transporter ATP-binding protein [Brucella suis bv. 3 str. 686]
 gi|261759271|ref|ZP_06002980.1| ATP/GTP-binding site domain-containing protein A [Brucella sp.
           F5/99]
 gi|265987884|ref|ZP_06100441.1| ABC transporter ATP-binding protein [Brucella pinnipedialis
           M292/94/1]
 gi|265992359|ref|ZP_06104916.1| ABC transporter ATP-binding protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994102|ref|ZP_06106659.1| ABC transporter ATP-binding protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265997345|ref|ZP_06109902.1| ABC transporter ATP-binding protein [Brucella ceti M490/95/1]
 gi|294851557|ref|ZP_06792230.1| ABC transporter ATP-binding protein [Brucella sp. NVSL 07-0026]
 gi|297247549|ref|ZP_06931267.1| ABC transporter ATP-binding protein [Brucella abortus bv. 5 str.
           B3196]
 gi|17983823|gb|AAL52971.1| abc transporter ATP-binding protein [Brucella melitensis bv. 1 str.
           16M]
 gi|23346936|gb|AAN29110.1| ABC transporter, ATP-binding protein [Brucella suis 1330]
 gi|62195265|gb|AAX73565.1| ABC transporter, ATP-binding protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82615173|emb|CAJ10112.1| ATP/GTP-binding site motif A (P-loop):ABC transporter:AAA ATPase
           [Brucella melitensis biovar Abortus 2308]
 gi|161334956|gb|ABX61261.1| Probable ABC transporter ATP-binding protein in ntrA/rpoN 5'region
           [Brucella canis ATCC 23365]
 gi|163673150|gb|ABY37261.1| Probable ABC transporter ATP-binding protein in ntrA/rpoN 5'region
           [Brucella suis ATCC 23445]
 gi|225618353|gb|EEH15396.1| ABC transporter related protein [Brucella ceti str. Cudo]
 gi|237789464|gb|EEP63674.1| Uncharacterized ABC transporter ATP-binding protein in ntrA/rpoN
           5'region [Brucella abortus str. 2308 A]
 gi|255998779|gb|ACU47178.1| ABC transporter, ATP-binding protein [Brucella microti CCM 4915]
 gi|260096538|gb|EEW80414.1| ATP/GTP-binding site-containing protein A [Brucella abortus NCTC
           8038]
 gi|260153246|gb|EEW88338.1| ATP/GTP-binding site-containing protein A [Brucella melitensis bv.
           1 str. 16M]
 gi|260669555|gb|EEX56495.1| ABC transporter ATP-binding protein [Brucella abortus bv. 4 str.
           292]
 gi|260671391|gb|EEX58212.1| ABC transporter ATP-binding protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260676121|gb|EEX62942.1| ABC transporter ATP-binding protein [Brucella abortus bv. 6 str.
           870]
 gi|260874561|gb|EEX81630.1| ABC transporter ATP-binding protein [Brucella abortus bv. 9 str.
           C68]
 gi|260919968|gb|EEX86621.1| ABC transporter ATP-binding protein [Brucella ceti B1/94]
 gi|261296038|gb|EEX99534.1| ABC transporter ATP-binding protein [Brucella pinnipedialis B2/94]
 gi|261739255|gb|EEY27251.1| ATP/GTP-binding site domain-containing protein A [Brucella sp.
           F5/99]
 gi|261741237|gb|EEY29163.1| ABC transporter ATP-binding protein [Brucella suis bv. 5 str. 513]
 gi|261745800|gb|EEY33726.1| ABC transporter ATP-binding protein [Brucella suis bv. 3 str. 686]
 gi|262551813|gb|EEZ07803.1| ABC transporter ATP-binding protein [Brucella ceti M490/95/1]
 gi|262765083|gb|EEZ11004.1| ABC transporter ATP-binding protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263003425|gb|EEZ15718.1| ABC transporter ATP-binding protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|264660081|gb|EEZ30342.1| ABC transporter ATP-binding protein [Brucella pinnipedialis
           M292/94/1]
 gi|294820146|gb|EFG37145.1| ABC transporter ATP-binding protein [Brucella sp. NVSL 07-0026]
 gi|297174718|gb|EFH34065.1| ABC transporter ATP-binding protein [Brucella abortus bv. 5 str.
           B3196]
          Length = 277

 Score =  325 bits (832), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 165/255 (64%), Positives = 193/255 (75%), Gaps = 1/255 (0%)

Query: 9   GIEMPEFQENRASK-DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTF 67
           G++    Q N AS+    L A  L K Y    VV GV   V+ GE VG+LGPNGAGKTT 
Sbjct: 23  GVDAISGQPNMASRLKGTLVARGLCKSYRGRQVVNGVSFGVRAGEAVGILGPNGAGKTTC 82

Query: 68  FYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV 127
           FYM+TGL+ ADSGSI+IDG D+T MPMYRR+RLGI YLPQEASIFRGL+VE NI AVLEV
Sbjct: 83  FYMVTGLVPADSGSIEIDGFDVTSMPMYRRSRLGIGYLPQEASIFRGLSVENNIKAVLEV 142

Query: 128 YEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFA 187
            EKD+ +R  +LD+LL+EF+I   R   A  LSGG+RRRLEIAR+L S P+++LLDEPFA
Sbjct: 143 VEKDRARRASELDALLEEFHIAHLRKAPAISLSGGERRRLEIARALASRPNFMLLDEPFA 202

Query: 188 GVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIID 247
           GVDP+A+SDI  L+R L SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   EI+ 
Sbjct: 203 GVDPIAVSDIQQLVRHLTSRGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRPAEIVA 262

Query: 248 NQDVRRLYLGDRFAF 262
           N DVRRLYLGD+F  
Sbjct: 263 NPDVRRLYLGDQFTL 277


>gi|148560151|ref|YP_001258190.1| ABC transporter ATP-binding protein [Brucella ovis ATCC 25840]
 gi|148371408|gb|ABQ61387.1| ABC transporter, ATP-binding protein [Brucella ovis ATCC 25840]
          Length = 254

 Score =  324 bits (831), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 164/248 (66%), Positives = 190/248 (76%), Gaps = 1/248 (0%)

Query: 16  QENRASK-DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGL 74
           Q N AS+    L A  L K Y    VV GV   V+ GE VG+LGPNGAGKTT FYM+TGL
Sbjct: 7   QPNMASRLKGTLVARGLCKSYRGRQVVNGVSFGVRAGEAVGILGPNGAGKTTCFYMVTGL 66

Query: 75  ICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKK 134
           + ADSGSI+IDG D+T MPMYRR+RLGI YLPQEASIFRGL+VE NI AVLEV EKD+ +
Sbjct: 67  VPADSGSIEIDGFDVTSMPMYRRSRLGIGYLPQEASIFRGLSVENNIKAVLEVVEKDRAR 126

Query: 135 RHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAI 194
           R  +LD+LL+EF+I   R   A  LSGG+RRRLEIAR+L S P+++LLDEPFAGVDP+A+
Sbjct: 127 RASELDALLEEFHIAHLRKAPAISLSGGERRRLEIARALASRPNFMLLDEPFAGVDPIAV 186

Query: 195 SDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRL 254
           SDI  L+R L SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   EI+ N DVRRL
Sbjct: 187 SDIQQLVRHLTSRGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGCPAEIVANPDVRRL 246

Query: 255 YLGDRFAF 262
           YLGD+F  
Sbjct: 247 YLGDQFTL 254


>gi|227820605|ref|YP_002824575.1| predicted ABC transporter, ATP-binding protein [Sinorhizobium
           fredii NGR234]
 gi|227339604|gb|ACP23822.1| predicted ABC transporter, ATP-binding protein [Sinorhizobium
           fredii NGR234]
          Length = 275

 Score =  324 bits (830), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 159/245 (64%), Positives = 190/245 (77%)

Query: 18  NRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICA 77
           ++A  D  L A  LTK Y S  VV GV L V+ GE VGLLGPNGAGKTT FYM+TGL+  
Sbjct: 31  DKARYDGTLIARGLTKSYRSRRVVNGVSLVVRRGEAVGLLGPNGAGKTTCFYMITGLVPV 90

Query: 78  DSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHE 137
           D GSI+I+GND+T MPMYRRARLG+ YLPQEASI RGLTVEENI AVLE+++K+  +R  
Sbjct: 91  DEGSIEINGNDVTTMPMYRRARLGVGYLPQEASILRGLTVEENIRAVLEIHDKNVDRRES 150

Query: 138 KLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDI 197
           KL+ LL EF+IT  R   A  LSGG+RRRLEIAR+L + P+++LLDEPFAGVDP++++DI
Sbjct: 151 KLNDLLGEFSITHLRKSPAIALSGGERRRLEIARALATDPTFMLLDEPFAGVDPISVADI 210

Query: 198 HVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLG 257
             L+R L SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   +I+ N DVRRLYLG
Sbjct: 211 QALVRHLTSRGIGVLITDHNVRETLGLIDRAYIIHAGEVLTHGRANDIVTNPDVRRLYLG 270

Query: 258 DRFAF 262
           D F+ 
Sbjct: 271 DNFSL 275


>gi|238466|gb|AAB20257.1| orf 5' of rpoN [Sinorhizobium fredii NGR234]
 gi|228369|prf||1803249A rpoN upstream ORF 1
          Length = 270

 Score =  323 bits (828), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 159/245 (64%), Positives = 190/245 (77%)

Query: 18  NRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICA 77
           ++A  D  L A  LTK Y S  VV GV L V+ GE VGLLGPNGAGKTT FYM+TGL+  
Sbjct: 26  DKARYDGTLIARGLTKSYRSRRVVNGVSLVVRRGEAVGLLGPNGAGKTTCFYMITGLVPV 85

Query: 78  DSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHE 137
           D GSI+I+GND+T MPMYRRARLG+ YLPQEASI RGLTVEENI AVLE+++K+  +R  
Sbjct: 86  DEGSIEINGNDVTTMPMYRRARLGVGYLPQEASILRGLTVEENIRAVLEIHDKNVDRRES 145

Query: 138 KLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDI 197
           KL+ LL EF+IT  R   A  LSGG+RRRLEIAR+L + P+++LLDEPFAGVDP++++DI
Sbjct: 146 KLNDLLGEFSITHLRKSPAIALSGGERRRLEIARALATDPTFMLLDEPFAGVDPISVADI 205

Query: 198 HVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLG 257
             L+R L SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   +I+ N DVRRLYLG
Sbjct: 206 QALVRHLTSRGIGVLITDHNVRETLGLIDRAYIIHAGEVLTHGRANDIVTNPDVRRLYLG 265

Query: 258 DRFAF 262
           D F+ 
Sbjct: 266 DNFSL 270


>gi|15887684|ref|NP_353365.1| ABC transporter, nucleotide binding/ATPase protein [Agrobacterium
           tumefaciens str. C58]
 gi|15155239|gb|AAK86150.1| ABC transporter, nucleotide binding/ATPase protein [Agrobacterium
           tumefaciens str. C58]
          Length = 269

 Score =  323 bits (828), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 158/237 (66%), Positives = 189/237 (79%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  LTK Y++  VV GV L V+ GE VGLLGPNGAGKTT FYM+TGL+  DSG I I+
Sbjct: 33  LIAHGLTKTYDTRRVVNGVSLVVRRGEAVGLLGPNGAGKTTCFYMITGLVPVDSGKIAIN 92

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           GND+T MPMYRRARLG+ YLPQEASIFRGLTVEENI AVLEV+E D  KR+ KLD LL+E
Sbjct: 93  GNDVTGMPMYRRARLGVGYLPQEASIFRGLTVEENIRAVLEVHEPDAAKRNRKLDELLEE 152

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F+I + R   A  LSGG+RRRLEIAR+L + P+++LLDEPFAGVDP+++SDI  L+R L 
Sbjct: 153 FHIAQLRKSPAVALSGGERRRLEIARALATDPTFMLLDEPFAGVDPISVSDIQNLVRHLT 212

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           +RGIG+L+TDHNV E L LIDRAYIIHAG VL HG   +I++N DVRRLYLG+ F+ 
Sbjct: 213 ARGIGVLVTDHNVRETLGLIDRAYIIHAGEVLTHGRPDDIVNNPDVRRLYLGNNFSL 269


>gi|190890075|ref|YP_001976617.1| amino acid ABC transporter ATP-binding protein [Rhizobium etli CIAT
           652]
 gi|190695354|gb|ACE89439.1| probable amino acid ABC transporter, ATP-binding protein [Rhizobium
           etli CIAT 652]
 gi|327193441|gb|EGE60339.1| putative amino acid ABC transporter, ATP-binding protein [Rhizobium
           etli CNPAF512]
          Length = 258

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 161/254 (63%), Positives = 195/254 (76%), Gaps = 4/254 (1%)

Query: 13  PEFQENRASKDS----LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFF 68
           PE Q   A+  S     L A  LTK Y +  VV GV L V+ GE VGLLGPNGAGKTT F
Sbjct: 5   PEPQAAGAADKSRYQGTLIARGLTKTYATRRVVNGVSLVVRRGEAVGLLGPNGAGKTTCF 64

Query: 69  YMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY 128
           YM+TGL+  D G+I+IDGND+T MPMYRR+RLG+ YLPQEASIFRGLTVEENI AVLEV+
Sbjct: 65  YMITGLVPVDEGTIEIDGNDVTTMPMYRRSRLGVGYLPQEASIFRGLTVEENIRAVLEVH 124

Query: 129 EKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAG 188
            KDK +R +KL+ LL+EF+I K R   A  LSGG+RRRLEIAR+L + P+++LLDEPFAG
Sbjct: 125 VKDKAEREQKLNELLEEFHIQKLRKSAAVALSGGERRRLEIARALATDPTFMLLDEPFAG 184

Query: 189 VDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDN 248
           VDP++++DI  L+  L +RGIG+LITDHNV E L LIDRAYIIHAG VL HG   +I++N
Sbjct: 185 VDPISVADIQNLVHHLTARGIGVLITDHNVRETLGLIDRAYIIHAGEVLTHGRANDIVNN 244

Query: 249 QDVRRLYLGDRFAF 262
            +VRRLYLGD F+ 
Sbjct: 245 PEVRRLYLGDNFSL 258


>gi|239831006|ref|ZP_04679335.1| ABC transporter related [Ochrobactrum intermedium LMG 3301]
 gi|239823273|gb|EEQ94841.1| ABC transporter related [Ochrobactrum intermedium LMG 3301]
          Length = 279

 Score =  323 bits (827), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 163/251 (64%), Positives = 188/251 (74%)

Query: 12  MPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMM 71
           MP      A     L A  L K Y    VV GV   V+ GE VG+LGPNGAGKTT FYM+
Sbjct: 29  MPGQPGKSARLKGTLVARGLCKSYRGRQVVNGVSFGVRAGEAVGILGPNGAGKTTCFYMV 88

Query: 72  TGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD 131
           TGL+ AD+GSI+IDG D+T MPMYRR+RLGI YLPQEASIFRGL+VE NI AVLEV EKD
Sbjct: 89  TGLVPADAGSIEIDGFDVTSMPMYRRSRLGIGYLPQEASIFRGLSVENNIKAVLEVVEKD 148

Query: 132 KKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDP 191
           + KR  +LD+LL+EF+I   R   A  LSGG+RRRLEIAR+L S P+++LLDEPFAGVDP
Sbjct: 149 RSKRASELDALLEEFHIAHLRKAPAISLSGGERRRLEIARALASRPNFMLLDEPFAGVDP 208

Query: 192 VAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDV 251
           +A+SDI  L+R L SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   EI+ N DV
Sbjct: 209 IAVSDIQQLVRHLTSRGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRPAEIVANPDV 268

Query: 252 RRLYLGDRFAF 262
           RRLYLGD+F  
Sbjct: 269 RRLYLGDQFTL 279


>gi|150395244|ref|YP_001325711.1| ABC transporter-like protein [Sinorhizobium medicae WSM419]
 gi|150026759|gb|ABR58876.1| ABC transporter related [Sinorhizobium medicae WSM419]
          Length = 270

 Score =  323 bits (827), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 159/240 (66%), Positives = 188/240 (78%)

Query: 23  DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSI 82
           D  L A  LTK Y S  VV GV L V+ GE VGLLGPNGAGKTT FYM+TGL+  D GSI
Sbjct: 31  DGTLIARGLTKSYRSRRVVNGVSLVVRRGEAVGLLGPNGAGKTTCFYMITGLVPVDEGSI 90

Query: 83  KIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSL 142
           +I+GND+T MPMYRRARLG+ YLPQEASIFRGLTVEENI AVLEV++ + ++R  KL+ L
Sbjct: 91  EINGNDVTTMPMYRRARLGVGYLPQEASIFRGLTVEENIRAVLEVHDNNVERRESKLNDL 150

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EF+IT  R   A  LSGG+RRRLEIAR+L + P+++LLDEPFAGVDP++++DI  L+R
Sbjct: 151 LGEFSITHLRTSPAIALSGGERRRLEIARALATDPTFMLLDEPFAGVDPISVADIQALVR 210

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   +I+ N DVRRLYLGD F+ 
Sbjct: 211 HLTSRGIGVLITDHNVRETLGLIDRAYIIHAGEVLTHGRANDIVTNPDVRRLYLGDNFSL 270


>gi|15964135|ref|NP_384488.1| ABC transporter ATP-binding protein [Sinorhizobium meliloti 1021]
 gi|307301280|ref|ZP_07581042.1| ABC transporter related protein [Sinorhizobium meliloti BL225C]
 gi|307317951|ref|ZP_07597388.1| ABC transporter related protein [Sinorhizobium meliloti AK83]
 gi|141100|sp|P25885|Y382_RHIME RecName: Full=Uncharacterized ABC transporter ATP-binding protein
           R00382
 gi|511887|gb|AAA26348.1| ATP-binding protein [Sinorhizobium meliloti]
 gi|15073311|emb|CAC41819.1| Probable ABC transporter ATP-binding protein [Sinorhizobium
           meliloti 1021]
 gi|306896353|gb|EFN27102.1| ABC transporter related protein [Sinorhizobium meliloti AK83]
 gi|306903736|gb|EFN34323.1| ABC transporter related protein [Sinorhizobium meliloti BL225C]
          Length = 270

 Score =  323 bits (827), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 159/245 (64%), Positives = 191/245 (77%)

Query: 18  NRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICA 77
           ++A  D  L A  LTK Y S  VV GV L V+ GE VGLLGPNGAGKTT FYM+TGL+  
Sbjct: 26  DKARYDGTLIARGLTKSYRSRRVVNGVSLVVRRGEAVGLLGPNGAGKTTCFYMITGLVPV 85

Query: 78  DSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHE 137
           D GSI+I+GND+T MPMYRRARLG+ YLPQEASIFRGLTVE+NI AVLEV++++  +R  
Sbjct: 86  DEGSIEINGNDVTTMPMYRRARLGVGYLPQEASIFRGLTVEDNIRAVLEVHDENVDRRES 145

Query: 138 KLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDI 197
           KL+ LL EF+IT  R   A  LSGG+RRRLEIAR+L + P+++LLDEPFAGVDP++++DI
Sbjct: 146 KLNDLLGEFSITHLRKSPAIALSGGERRRLEIARALATDPTFMLLDEPFAGVDPISVADI 205

Query: 198 HVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLG 257
             L+R L SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   +I+ N DVRRLYLG
Sbjct: 206 QALVRHLTSRGIGVLITDHNVRETLGLIDRAYIIHAGEVLTHGRANDIVTNPDVRRLYLG 265

Query: 258 DRFAF 262
           D F+ 
Sbjct: 266 DNFSL 270


>gi|86356060|ref|YP_467952.1| amino acid ABC transporter ATP-binding protein [Rhizobium etli CFN
           42]
 gi|86280162|gb|ABC89225.1| probable amino acid ABC transporter, ATP-binding protein [Rhizobium
           etli CFN 42]
          Length = 258

 Score =  322 bits (826), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 161/254 (63%), Positives = 195/254 (76%), Gaps = 4/254 (1%)

Query: 13  PEFQENRASKDS----LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFF 68
           PE Q   A+  S     L A  LTK Y +  VV GV L V+ GE VGLLGPNGAGKTT F
Sbjct: 5   PEPQAAGAADKSRYQGTLIARGLTKTYATRRVVNGVSLVVRRGEAVGLLGPNGAGKTTCF 64

Query: 69  YMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY 128
           YM+TGL+  D G+I+IDGND+T MPMYRR+RLG+ YLPQEASIFRGLTVEENI AVLEV+
Sbjct: 65  YMITGLVPVDEGTIEIDGNDVTTMPMYRRSRLGVGYLPQEASIFRGLTVEENIRAVLEVH 124

Query: 129 EKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAG 188
            KDK +R +KL+ LL+EF+I K R   A  LSGG+RRRLEIAR+L + P+++LLDEPFAG
Sbjct: 125 VKDKPEREQKLNELLEEFHIQKLRKSAAVALSGGERRRLEIARALATDPTFMLLDEPFAG 184

Query: 189 VDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDN 248
           VDP++++DI  L+  L +RGIG+LITDHNV E L LIDRAYIIHAG VL HG   +I++N
Sbjct: 185 VDPISVADIQNLVHHLTARGIGVLITDHNVRETLGLIDRAYIIHAGEVLTHGRANDIVNN 244

Query: 249 QDVRRLYLGDRFAF 262
            +VRRLYLGD F+ 
Sbjct: 245 PEVRRLYLGDNFSL 258


>gi|116250190|ref|YP_766028.1| ABC transporter ATP-binding component [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115254838|emb|CAK05912.1| putative ABC transporter ATP-binding component [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 266

 Score =  322 bits (825), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 156/237 (65%), Positives = 189/237 (79%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  LTK Y +  VV GV L V+ GE VGLLGPNGAGKTT FYM+TGL+  D G+I+ID
Sbjct: 30  LIARGLTKTYATRRVVNGVSLVVRRGEAVGLLGPNGAGKTTCFYMITGLVPVDEGTIEID 89

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           GND+T MPMYRR+RLG+ YLPQEASIFRGLTVEENI AVLEV+ KDK +R +KL+ LL+E
Sbjct: 90  GNDVTTMPMYRRSRLGVGYLPQEASIFRGLTVEENIRAVLEVHVKDKAEREQKLNELLEE 149

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F+I K R   A  LSGG+RRRLEIAR+L + P+++LLDEPFAGVDP++++DI  L+  L 
Sbjct: 150 FHIQKLRKSAAVALSGGERRRLEIARALATDPTFMLLDEPFAGVDPISVADIQNLVHHLT 209

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           +RGIG+LITDHNV E L LIDRAYIIHAG VL HG   +I++N +VRRLYLGD F+ 
Sbjct: 210 ARGIGVLITDHNVRETLGLIDRAYIIHAGEVLTHGRANDIVNNPEVRRLYLGDNFSL 266


>gi|261320994|ref|ZP_05960191.1| ABC transporter ATP-binding protein [Brucella ceti M644/93/1]
 gi|261293684|gb|EEX97180.1| ABC transporter ATP-binding protein [Brucella ceti M644/93/1]
          Length = 275

 Score =  322 bits (825), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 192/255 (75%), Gaps = 1/255 (0%)

Query: 9   GIEMPEFQENRASK-DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTF 67
           G++    Q N AS+    L A  L K Y    VV GV   V+ GE VG+LGPNGAGKTT 
Sbjct: 21  GVDAISGQPNMASRLKGTLVARGLCKSYRGRQVVNGVSFGVRAGEAVGILGPNGAGKTTC 80

Query: 68  FYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV 127
           FYM+TGL+ ADSGSI+IDG D+T MPMYRR+RLGI YLPQEASIF GL+VE NI AVLEV
Sbjct: 81  FYMVTGLVPADSGSIEIDGFDVTSMPMYRRSRLGIGYLPQEASIFCGLSVENNIKAVLEV 140

Query: 128 YEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFA 187
            EKD+ +R  +LD+LL+EF+I   R   A  LSGG+RRRLEIAR+L S P+++LLDEPFA
Sbjct: 141 VEKDRARRASELDALLEEFHIAHLRKAPAISLSGGERRRLEIARALASRPNFMLLDEPFA 200

Query: 188 GVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIID 247
           GVDP+A+SDI  L+R L SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   EI+ 
Sbjct: 201 GVDPIAVSDIQQLVRHLTSRGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRPAEIVA 260

Query: 248 NQDVRRLYLGDRFAF 262
           N DVRRLYLGD+F  
Sbjct: 261 NPDVRRLYLGDQFTL 275


>gi|153007514|ref|YP_001368729.1| ABC transporter-like protein [Ochrobactrum anthropi ATCC 49188]
 gi|151559402|gb|ABS12900.1| ABC transporter related [Ochrobactrum anthropi ATCC 49188]
          Length = 279

 Score =  322 bits (824), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 160/237 (67%), Positives = 185/237 (78%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y    VV GV   V+ GE VG+LGPNGAGKTT FYM+TGL+ AD+GSI+ID
Sbjct: 43  LVARGLCKSYRGRQVVNGVSFGVRAGEAVGILGPNGAGKTTCFYMVTGLVPADAGSIEID 102

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G D+T MPMYRR+RLGI YLPQEASIFRGL+VE NI AVLEV EKD+ KR  +LD+LL+E
Sbjct: 103 GFDVTSMPMYRRSRLGIGYLPQEASIFRGLSVENNIKAVLEVVEKDRSKRASELDALLEE 162

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F+I   R   A  LSGG+RRRLEIAR+L S P+++LLDEPFAGVDP+A+SDI  L+R L 
Sbjct: 163 FHIAHLRKAPAISLSGGERRRLEIARALASRPNFMLLDEPFAGVDPIAVSDIQQLVRHLT 222

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   EI+ N DVRRLYLGD+F  
Sbjct: 223 SRGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRPAEIVANPDVRRLYLGDQFTL 279


>gi|256060299|ref|ZP_05450472.1| ABC transporter ATP-binding protein [Brucella neotomae 5K33]
 gi|261324271|ref|ZP_05963468.1| ABC transporter ATP-binding protein [Brucella neotomae 5K33]
 gi|261300251|gb|EEY03748.1| ABC transporter ATP-binding protein [Brucella neotomae 5K33]
          Length = 277

 Score =  322 bits (824), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 192/255 (75%), Gaps = 1/255 (0%)

Query: 9   GIEMPEFQENRASK-DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTF 67
           G++    Q N AS+    L A  L K Y    VV GV   V+ GE VG+LGPNGAGKTT 
Sbjct: 23  GVDAISGQPNMASRLKGTLVARGLCKSYRGRQVVNGVSFGVRAGEAVGILGPNGAGKTTC 82

Query: 68  FYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV 127
           FYM+TGL+ ADSGSI+IDG D+T MPMYR +RLGI YLPQEASIFRGL+VE NI AVLEV
Sbjct: 83  FYMVTGLVPADSGSIEIDGFDVTSMPMYRCSRLGIGYLPQEASIFRGLSVENNIKAVLEV 142

Query: 128 YEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFA 187
            EKD+ +R  +LD+LL+EF+I   R   A  LSGG+RRRLEIAR+L S P+++LLDEPFA
Sbjct: 143 VEKDRARRASELDALLEEFHIAHLRKAPAISLSGGERRRLEIARALASRPNFMLLDEPFA 202

Query: 188 GVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIID 247
           GVDP+A+SDI  L+R L SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   EI+ 
Sbjct: 203 GVDPIAVSDIQQLVRHLTSRGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRPAEIVA 262

Query: 248 NQDVRRLYLGDRFAF 262
           N DVRRLYLGD+F  
Sbjct: 263 NPDVRRLYLGDQFTL 277


>gi|254713271|ref|ZP_05175082.1| ABC transporter ATP-binding protein [Brucella ceti M644/93/1]
 gi|254716376|ref|ZP_05178187.1| ABC transporter ATP-binding protein [Brucella ceti M13/05/1]
 gi|261218158|ref|ZP_05932439.1| ABC transporter ATP-binding protein [Brucella ceti M13/05/1]
 gi|260923247|gb|EEX89815.1| ABC transporter ATP-binding protein [Brucella ceti M13/05/1]
          Length = 277

 Score =  322 bits (824), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 192/255 (75%), Gaps = 1/255 (0%)

Query: 9   GIEMPEFQENRASK-DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTF 67
           G++    Q N AS+    L A  L K Y    VV GV   V+ GE VG+LGPNGAGKTT 
Sbjct: 23  GVDAISGQPNMASRLKGTLVARGLCKSYRGRQVVNGVSFGVRAGEAVGILGPNGAGKTTC 82

Query: 68  FYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV 127
           FYM+TGL+ ADSGSI+IDG D+T MPMYRR+RLGI YLPQEASIF GL+VE NI AVLEV
Sbjct: 83  FYMVTGLVPADSGSIEIDGFDVTSMPMYRRSRLGIGYLPQEASIFCGLSVENNIKAVLEV 142

Query: 128 YEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFA 187
            EKD+ +R  +LD+LL+EF+I   R   A  LSGG+RRRLEIAR+L S P+++LLDEPFA
Sbjct: 143 VEKDRARRASELDALLEEFHIAHLRKAPAISLSGGERRRLEIARALASRPNFMLLDEPFA 202

Query: 188 GVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIID 247
           GVDP+A+SDI  L+R L SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   EI+ 
Sbjct: 203 GVDPIAVSDIQQLVRHLTSRGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRPAEIVA 262

Query: 248 NQDVRRLYLGDRFAF 262
           N DVRRLYLGD+F  
Sbjct: 263 NPDVRRLYLGDQFTL 277


>gi|241202817|ref|YP_002973913.1| ABC transporter [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240856707|gb|ACS54374.1| ABC transporter related [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 258

 Score =  321 bits (823), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 156/245 (63%), Positives = 192/245 (78%)

Query: 18  NRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICA 77
           +++     L A  LTK Y +  VV GV L V+ GE VGLLGPNGAGKTT FYM+TGL+  
Sbjct: 14  DKSRYQGTLIARGLTKTYATRRVVNGVSLVVRRGEAVGLLGPNGAGKTTCFYMITGLVPV 73

Query: 78  DSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHE 137
           D G+I+IDGND+T MPMYRR+RLG+ YLPQEASIFRGLTVEENI AVLEV+ KDK +R +
Sbjct: 74  DEGTIEIDGNDVTTMPMYRRSRLGVGYLPQEASIFRGLTVEENIRAVLEVHVKDKAEREQ 133

Query: 138 KLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDI 197
           KL+ LL+EF+I K R   A  LSGG+RRRLEIAR+L + P+++LLDEPFAGVDP++++DI
Sbjct: 134 KLNELLEEFHIQKLRKSAAVALSGGERRRLEIARALATDPTFMLLDEPFAGVDPISVADI 193

Query: 198 HVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLG 257
             L+  L +RGIG+LITDHNV E L LIDRAYIIHAG VL HG   +I++N +VRRLYLG
Sbjct: 194 QNLVHHLTARGIGVLITDHNVRETLGLIDRAYIIHAGEVLTHGRANDIVNNPEVRRLYLG 253

Query: 258 DRFAF 262
           D F+ 
Sbjct: 254 DNFSL 258


>gi|1046230|gb|AAA80299.1| ABC-type permease homolog [Rhizobium leguminosarum bv. phaseoli]
          Length = 258

 Score =  321 bits (823), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 160/254 (62%), Positives = 194/254 (76%), Gaps = 4/254 (1%)

Query: 13  PEFQENRASKDS----LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFF 68
           PE Q   A+  S     L A  LTK Y +  VV GV L V+ GE VGLLGPNGAGKTT F
Sbjct: 5   PEPQAAGAADKSRYQGTLIARGLTKTYGTRRVVNGVSLVVRRGEAVGLLGPNGAGKTTCF 64

Query: 69  YMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY 128
           YM+TGL+  D G+I+IDGND+T MPMYRR+RLG+ YLPQEASIFRGLTVEENI AVLEV+
Sbjct: 65  YMITGLVPVDEGTIEIDGNDVTTMPMYRRSRLGVGYLPQEASIFRGLTVEENIRAVLEVH 124

Query: 129 EKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAG 188
            KDK +R +KL+ LL+EF+I K R   A  LS G+RRRLEIAR+L + P+++LLDEPFAG
Sbjct: 125 VKDKAEREQKLNELLEEFHIQKLRKSAAVALSAGERRRLEIARALATDPTFMLLDEPFAG 184

Query: 189 VDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDN 248
           VDP++++DI  L+  L +RGIG+LITDHNV E L LIDRAYIIHAG VL HG   +I++N
Sbjct: 185 VDPISVADIQNLVHHLTARGIGVLITDHNVRETLGLIDRAYIIHAGEVLTHGRANDIVNN 244

Query: 249 QDVRRLYLGDRFAF 262
            +VRRLYLGD F+ 
Sbjct: 245 PEVRRLYLGDNFSL 258


>gi|189023409|ref|YP_001934177.1| ATP/GTP-binding site motif A (P-loop) [Brucella abortus S19]
 gi|189018981|gb|ACD71703.1| ATP/GTP-binding site motif A (P-loop) [Brucella abortus S19]
          Length = 245

 Score =  321 bits (822), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 160/237 (67%), Positives = 185/237 (78%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y    VV GV   V+ GE VG+LGPNGAGKTT FYM+TGL+ ADSGSI+ID
Sbjct: 9   LVARGLCKSYRGRQVVNGVSFGVRAGEAVGILGPNGAGKTTCFYMVTGLVPADSGSIEID 68

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G D+T MPMYRR+RLGI YLPQEASIFRGL+VE NI AVLEV EKD+ +R  +LD+LL+E
Sbjct: 69  GFDVTSMPMYRRSRLGIGYLPQEASIFRGLSVENNIKAVLEVVEKDRARRASELDALLEE 128

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F+I   R   A  LSGG+RRRLEIAR+L S P+++LLDEPFAGVDP+A+SDI  L+R L 
Sbjct: 129 FHIAHLRKAPAISLSGGERRRLEIARALASRPNFMLLDEPFAGVDPIAVSDIQQLVRHLT 188

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   EI+ N DVRRLYLGD+F  
Sbjct: 189 SRGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRPAEIVANPDVRRLYLGDQFTL 245


>gi|260460504|ref|ZP_05808755.1| ABC transporter related protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259033609|gb|EEW34869.1| ABC transporter related protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 272

 Score =  319 bits (817), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 157/245 (64%), Positives = 186/245 (75%)

Query: 18  NRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICA 77
           ++A     L A  LTK Y    VV GV L V+ GE VGLLGPNGAGKTT FYM+TGL+  
Sbjct: 28  DKAKFKGTLIAKGLTKSYKGRKVVSGVTLGVRAGEAVGLLGPNGAGKTTCFYMVTGLVPV 87

Query: 78  DSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHE 137
           D G+I+IDG D+T MPMYRRARLGI YLPQEASIFRGL VE+NI AVLEV EKD+K R  
Sbjct: 88  DEGTIEIDGFDVTSMPMYRRARLGIGYLPQEASIFRGLNVEQNIRAVLEVVEKDRKVRER 147

Query: 138 KLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDI 197
            LD LL+EF+I+  R   +  LSGG+RRRLEIAR+L + P+Y+LLDEPFAG+DP+A++DI
Sbjct: 148 NLDELLEEFHISHLRKAPSMSLSGGERRRLEIARALATRPAYMLLDEPFAGIDPIAVADI 207

Query: 198 HVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLG 257
             L+R L +RGIG+LITDHNV E L LIDRAYIIHAG VL HG   E++ N DVRRLYLG
Sbjct: 208 QQLVRHLTARGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRADEVVANPDVRRLYLG 267

Query: 258 DRFAF 262
           + F  
Sbjct: 268 EGFTL 272


>gi|114706451|ref|ZP_01439353.1| probable amino acid ABC transporter, ATP-binding protein
           [Fulvimarina pelagi HTCC2506]
 gi|114538312|gb|EAU41434.1| probable amino acid ABC transporter, ATP-binding protein
           [Fulvimarina pelagi HTCC2506]
          Length = 280

 Score =  319 bits (817), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 155/239 (64%), Positives = 188/239 (78%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L+A  LTK Y    VV  V L VK GE VGLLGPNGAGKTT FYM+TGL+  D G I 
Sbjct: 42  SVLAASGLTKTYRGRRVVDQVGLSVKRGEAVGLLGPNGAGKTTCFYMITGLVPVDDGVIM 101

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG+D+TK+PMYRR+RLGI YLPQEASIFRGL+VE+N+ AVLEV E DK KR ++L SLL
Sbjct: 102 LDGHDVTKVPMYRRSRLGIGYLPQEASIFRGLSVEDNVRAVLEVSEPDKVKREQELTSLL 161

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EF+I   R   +  LSGG+RRR EIAR+L S P+++LLDEPFAGVDP+A++DI  L+R 
Sbjct: 162 EEFHIDHLRKQASTSLSGGERRRCEIARALASKPTFMLLDEPFAGVDPIAVADIQALVRH 221

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  RGIG+LITDHNV E L LIDRAYI+HAG VL HG  ++I+DN DVRR YLGD+F+F
Sbjct: 222 LTRRGIGVLITDHNVRETLGLIDRAYIMHAGAVLTHGNPKDIVDNADVRRFYLGDQFSF 280


>gi|90421940|ref|YP_530310.1| ABC transporter related [Rhodopseudomonas palustris BisB18]
 gi|90103954|gb|ABD85991.1| ABC transporter related [Rhodopseudomonas palustris BisB18]
          Length = 317

 Score =  318 bits (815), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 150/248 (60%), Positives = 194/248 (78%)

Query: 13  PEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMT 72
           P   +   S+D  L+   + K + S  +V+GV +YV+ GE VGLLGPNGAGKTT FYM+T
Sbjct: 68  PARAQRAPSRDGFLAVHGIEKSFGSRRIVRGVSIYVRRGEAVGLLGPNGAGKTTVFYMIT 127

Query: 73  GLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDK 132
           GLI AD G+I++DG+D+TK+PMY+RARLGI YLPQEASIFRGL+VE+NI AVLE  E D+
Sbjct: 128 GLIKADRGAIELDGHDVTKLPMYQRARLGIGYLPQEASIFRGLSVEQNIRAVLEAVEPDR 187

Query: 133 KKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPV 192
           +KR  +LD+LL EFNI + R   +  LSGG+RRR+EIAR+L S P+Y+LLDEPFAG+DP+
Sbjct: 188 RKREAELDNLLHEFNIERLRKSPSIALSGGERRRVEIARALASRPNYMLLDEPFAGIDPI 247

Query: 193 AISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVR 252
           A+ DI  L+R L +RGIG+LITDHNV E L L DRAYI++AG +L  G+ +EI++N DVR
Sbjct: 248 AVGDIQDLVRHLTNRGIGVLITDHNVRETLGLTDRAYIVYAGEILTEGSPEEIVNNPDVR 307

Query: 253 RLYLGDRF 260
           RLYLG+ F
Sbjct: 308 RLYLGEEF 315


>gi|13472789|ref|NP_104356.1| ABC transporter ATP-binding protein (in rpoN upstream)
           [Mesorhizobium loti MAFF303099]
 gi|14023536|dbj|BAB50142.1| ABC transporter ATP-binding protein [Mesorhizobium loti MAFF303099]
          Length = 272

 Score =  318 bits (814), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 156/237 (65%), Positives = 183/237 (77%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  LTK Y    VV GV L V+ GE VGLLGPNGAGKTT FYM+TGL+  D G+I+ID
Sbjct: 36  LIAKGLTKSYKGRKVVSGVTLGVRAGEAVGLLGPNGAGKTTCFYMVTGLVPVDEGTIEID 95

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G D+T MPMYRRARLGI YLPQEASIFRGL VE+NI AVLEV EKD+K R   LD LL+E
Sbjct: 96  GFDVTSMPMYRRARLGIGYLPQEASIFRGLNVEQNIRAVLEVVEKDRKVRERNLDELLEE 155

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F+I+  R   +  LSGG+RRRLEIAR+L + P+Y+LLDEPFAG+DP+A++DI  L+R L 
Sbjct: 156 FHISHLRKAPSMSLSGGERRRLEIARALATRPAYMLLDEPFAGIDPIAVADIQQLVRHLT 215

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           +RGIG+LITDHNV E L LIDRAYIIHAG VL HG   E++ N DVRRLYLG+ F  
Sbjct: 216 ARGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRADEVVANPDVRRLYLGEGFTL 272


>gi|319781471|ref|YP_004140947.1| ABC transporter [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167359|gb|ADV10897.1| ABC transporter related protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 272

 Score =  317 bits (811), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 183/237 (77%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  LTK Y    VV GV + V+ GE VGLLGPNGAGKTT FYM+TGL+  D G+I+ID
Sbjct: 36  LIAKGLTKSYKGRKVVSGVTIGVRAGEAVGLLGPNGAGKTTCFYMVTGLVPVDEGTIEID 95

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G D+T MPMYRRARLGI YLPQEASIFRGL VE+NI AVLEV EKD+K R   LD LL+E
Sbjct: 96  GFDVTSMPMYRRARLGIGYLPQEASIFRGLNVEQNIRAVLEVVEKDRKVRERNLDELLEE 155

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F+I+  R   +  LSGG+RRRLEIAR+L + P+Y+LLDEPFAG+DP+A++DI  L+R L 
Sbjct: 156 FHISHLRKAPSMSLSGGERRRLEIARALATRPAYMLLDEPFAGIDPIAVADIQQLVRHLT 215

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           +RGIG+LITDHNV E L LIDRAYIIHAG VL HG   E++ N DVRRLYLG+ F  
Sbjct: 216 ARGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRADEVVANPDVRRLYLGEGFTL 272


>gi|192288483|ref|YP_001989088.1| ABC transporter [Rhodopseudomonas palustris TIE-1]
 gi|192282232|gb|ACE98612.1| ABC transporter related [Rhodopseudomonas palustris TIE-1]
          Length = 316

 Score =  316 bits (810), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 150/237 (63%), Positives = 193/237 (81%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L+  S+ K + +  +V+GV +YV+ GE VGLLGPNGAGKTT FYM+TGLI AD+G+I+
Sbjct: 78  SYLAVHSVEKSFGTRKIVRGVSIYVRRGEAVGLLGPNGAGKTTVFYMITGLIKADNGAIE 137

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG+D+TK+PMY+RARLGI YLPQEASIFRGLTVE+NI AVLE  E DK+KR  +LD+LL
Sbjct: 138 LDGHDVTKLPMYQRARLGIGYLPQEASIFRGLTVEQNIRAVLEAVEPDKRKREAQLDNLL 197

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EFNI + R   +  LSGG+RRR+EIAR+L S P+Y+LLDEPFAG+DP+A+ DI  L+R 
Sbjct: 198 QEFNIERLRKSPSIALSGGERRRVEIARALASRPNYMLLDEPFAGIDPIAVGDIQDLVRH 257

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L +RGIG+LITDHNV E L L DRAYI++AG +L  GT +EI+++ DVRRLYLG+ F
Sbjct: 258 LTNRGIGVLITDHNVRETLGLTDRAYIVYAGEILTEGTPEEIVNDPDVRRLYLGEEF 314


>gi|92115808|ref|YP_575537.1| ABC transporter related [Nitrobacter hamburgensis X14]
 gi|91798702|gb|ABE61077.1| ABC transporter related protein [Nitrobacter hamburgensis X14]
          Length = 333

 Score =  316 bits (810), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 150/241 (62%), Positives = 192/241 (79%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A +   L+   + K + S  VV+GV +YV+ GE VGLLGPNGAGKTT FYM+TGLI AD 
Sbjct: 91  AKRPGYLAVHGVEKSFGSRQVVRGVSIYVRRGEAVGLLGPNGAGKTTVFYMITGLIPADR 150

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G+I++DG+D+TK+PMY+RARLGI YLPQEASIFRGL+VE+NI AVLEV E  KKKR  +L
Sbjct: 151 GAIELDGHDVTKLPMYQRARLGIGYLPQEASIFRGLSVEQNIRAVLEVVEPSKKKREAEL 210

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           D+LL+EFNI++ R   +  LSGG+RRR+EIAR+L + PSY+LLDEPFAG+DP+A+ DI  
Sbjct: 211 DALLEEFNISRLRKTPSIALSGGERRRVEIARALATRPSYMLLDEPFAGIDPIAVGDIQD 270

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L+R L +RGIG+LITDHNV E L L DRAYI++AG +L  G+  EI+++ DVRRLYLG+ 
Sbjct: 271 LVRHLTNRGIGVLITDHNVRETLGLTDRAYIVYAGEILTEGSPDEIVNDPDVRRLYLGEE 330

Query: 260 F 260
           F
Sbjct: 331 F 331


>gi|27375833|ref|NP_767362.1| ATP-binding protein [Bradyrhizobium japonicum USDA 110]
 gi|27348971|dbj|BAC45987.1| blr0722 [Bradyrhizobium japonicum USDA 110]
          Length = 332

 Score =  316 bits (810), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 151/239 (63%), Positives = 191/239 (79%)

Query: 22  KDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGS 81
           +   L+  S+ K + S  VV+GV +YV+ GE VGLLGPNGAGKTT FYM+TGLI AD G+
Sbjct: 92  RPGFLAVHSVEKAFGSRQVVRGVSIYVRRGEAVGLLGPNGAGKTTVFYMITGLIKADRGA 151

Query: 82  IKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDS 141
           I++DG+D+TK+PMY+RARLGI YLPQEASIFRGLTVE+NI AVLEV E  +KKR ++LDS
Sbjct: 152 IELDGHDVTKLPMYQRARLGIGYLPQEASIFRGLTVEQNIRAVLEVVEPSRKKREQQLDS 211

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           LL EFNIT+ R   +  LSGG+RRR+EIAR+L + P+Y+LLDEPFAG+DP+A+ DI  L+
Sbjct: 212 LLDEFNITRLRKSPSIALSGGERRRVEIARALATRPNYMLLDEPFAGIDPIAVGDIQDLV 271

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           R L +RGIG+LITDHNV E L L DRAYI++AG +L  G+  EI+ + DVRRLYLG+ F
Sbjct: 272 RHLTNRGIGVLITDHNVRETLGLTDRAYIVYAGEILTEGSPDEIVADPDVRRLYLGEEF 330


>gi|146337287|ref|YP_001202335.1| putative ABC transporter ATP-binding protein [Bradyrhizobium sp.
           ORS278]
 gi|146190093|emb|CAL74085.1| putative ABC transporter (ATP-binding protein) [Bradyrhizobium sp.
           ORS278]
          Length = 349

 Score =  316 bits (809), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 148/239 (61%), Positives = 191/239 (79%)

Query: 22  KDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGS 81
           +   L+  S+ K + S  VV+GV +YV+ GE VGLLGPNGAGKTT FYM+TGLI AD G+
Sbjct: 109 RPGFLAVHSIEKSFGSRQVVRGVSIYVRRGEAVGLLGPNGAGKTTVFYMITGLIKADRGA 168

Query: 82  IKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDS 141
           I++DG+D+T++PMY+RARLGI YLPQEASIFRGLTVE+NI AVLEV E  +KKR  +LD+
Sbjct: 169 IELDGHDVTRLPMYQRARLGIGYLPQEASIFRGLTVEQNIRAVLEVVEPSRKKRERELDA 228

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           LL+EF IT+ R   +  LSGG+RRR+EIAR+L + P+Y+LLDEPFAG+DP+A+ DI  L+
Sbjct: 229 LLEEFTITRLRKSPSIALSGGERRRVEIARALATRPNYMLLDEPFAGIDPIAVGDIQQLV 288

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           R L +RGIG+LITDHNV E L L DRAYI++AG +L  G+ +EI+ + DVRRLYLG+ F
Sbjct: 289 RHLTNRGIGVLITDHNVRETLGLTDRAYIVYAGQILTEGSPEEIVADPDVRRLYLGEEF 347


>gi|85714034|ref|ZP_01045023.1| ABC transporter, ATPase subunit [Nitrobacter sp. Nb-311A]
 gi|85699160|gb|EAQ37028.1| ABC transporter, ATPase subunit [Nitrobacter sp. Nb-311A]
          Length = 333

 Score =  316 bits (809), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 149/241 (61%), Positives = 195/241 (80%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A++ S L+   + K + S  VV+GV +YV+ GE VGLLGPNGAGKTT FYM+TGLI AD 
Sbjct: 91  AARPSYLAVHGVEKSFGSRQVVRGVSIYVRRGEAVGLLGPNGAGKTTVFYMITGLIPADR 150

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G+I++DG+D+T++PMY+RARLGI YLPQEASIFRGL+VE+NI AVLEV E +KKKR  +L
Sbjct: 151 GAIELDGHDVTRLPMYQRARLGIGYLPQEASIFRGLSVEQNIRAVLEVVEPNKKKREAEL 210

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           D+LL+EFNIT+ R   +  LSGG+RRR+EIAR+L + P+Y+LLDEPFAG+DP+A+ DI  
Sbjct: 211 DALLEEFNITRLRKSPSIALSGGERRRVEIARALATRPNYMLLDEPFAGIDPIAVGDIQD 270

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L+R L +RGIG+LITDHNV E L L DRAYI++AG +L  G+ + I+++ DVRRLYLG+ 
Sbjct: 271 LVRHLTNRGIGVLITDHNVRETLGLTDRAYIVYAGEILTEGSPETIVNDPDVRRLYLGEE 330

Query: 260 F 260
           F
Sbjct: 331 F 331


>gi|39933129|ref|NP_945405.1| putative ABC transporter ATP-binding protein [Rhodopseudomonas
           palustris CGA009]
 gi|39652754|emb|CAE25493.1| possible ABC transporter ATP-binding protein (in rpoN upstream)
           [Rhodopseudomonas palustris CGA009]
          Length = 321

 Score =  316 bits (809), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 150/237 (63%), Positives = 193/237 (81%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L+  S+ K + +  +V+GV +YV+ GE VGLLGPNGAGKTT FYM+TGLI AD+G+I+
Sbjct: 83  SYLAVHSVEKSFGTRKIVRGVSIYVRRGEAVGLLGPNGAGKTTVFYMITGLIKADNGAIE 142

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG+D+TK+PMY+RARLGI YLPQEASIFRGLTVE+NI AVLE  E DK+KR  +LD+LL
Sbjct: 143 LDGHDVTKLPMYQRARLGIGYLPQEASIFRGLTVEQNIRAVLEAVEPDKRKREAQLDNLL 202

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EFNI + R   +  LSGG+RRR+EIAR+L S P+Y+LLDEPFAG+DP+A+ DI  L+R 
Sbjct: 203 QEFNIERLRKSPSIALSGGERRRVEIARALASRPNYMLLDEPFAGIDPIAVGDIQDLVRH 262

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L +RGIG+LITDHNV E L L DRAYI++AG +L  GT +EI+++ DVRRLYLG+ F
Sbjct: 263 LTNRGIGVLITDHNVRETLGLTDRAYIVYAGEILTEGTPEEIVNDPDVRRLYLGEEF 319


>gi|300021930|ref|YP_003754541.1| ABC transporter [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523751|gb|ADJ22220.1| ABC transporter related protein [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 288

 Score =  315 bits (808), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 154/238 (64%), Positives = 185/238 (77%)

Query: 23  DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSI 82
           +  L+A  + K Y    VVKGV L V  GE VGLLGPNGAGKTT FYM+TGL+ AD G I
Sbjct: 47  EGWLTAFHVKKSYRKRMVVKGVSLAVGRGESVGLLGPNGAGKTTVFYMITGLVAADDGRI 106

Query: 83  KIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSL 142
            IDG ++T +PMY+RARLG+ YLPQEASIFRGLTVE+NI+AVLE+ E D+K R E+LDSL
Sbjct: 107 TIDGENVTSLPMYQRARLGVGYLPQEASIFRGLTVEQNIMAVLELIEPDRKARREQLDSL 166

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+IT+ R   A  LSGG+RRR EIAR+L S PS++LLDEPFAG+DP+A+ DI  L+R
Sbjct: 167 LEEFSITRLRKSPALALSGGERRRCEIARALASRPSFMLLDEPFAGIDPIAVGDIQQLVR 226

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIG+LITDHNV E L+LIDRAYII+ G VL  G   EII N+DVRR+YLGD F
Sbjct: 227 HLTERGIGVLITDHNVRETLSLIDRAYIIYDGQVLTQGKPSEIISNEDVRRVYLGDMF 284


>gi|316931446|ref|YP_004106428.1| ABC transporter-like protein [Rhodopseudomonas palustris DX-1]
 gi|315599160|gb|ADU41695.1| ABC transporter related protein [Rhodopseudomonas palustris DX-1]
          Length = 316

 Score =  315 bits (808), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 149/241 (61%), Positives = 194/241 (80%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A+    L+  S+ K + +  +V+GV +YV+ GE VGLLGPNGAGKTT FYM+TGLI AD+
Sbjct: 74  ATPSGYLAVHSVEKSFGTRKIVRGVSIYVRRGEAVGLLGPNGAGKTTVFYMITGLIKADN 133

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G+I++DG+D+TK+PMY+RARLGI YLPQEASIFRGLTVE+NI AVLE  E DK+KR  +L
Sbjct: 134 GAIELDGHDVTKLPMYQRARLGIGYLPQEASIFRGLTVEQNIRAVLESVEPDKRKRECQL 193

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           D+LL+EFNI + R   +  LSGG+RRR+EIAR+L S P+Y+LLDEPFAG+DP+A+ DI  
Sbjct: 194 DNLLQEFNIERLRKSPSIALSGGERRRVEIARALASRPNYMLLDEPFAGIDPIAVGDIQD 253

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L+R L +RGIG+LITDHNV E L L DRAYI++AG +L  GT ++I+++ DVRRLYLG+ 
Sbjct: 254 LVRHLTNRGIGVLITDHNVRETLGLTDRAYIVYAGEILTEGTPEDIVNDPDVRRLYLGEE 313

Query: 260 F 260
           F
Sbjct: 314 F 314


>gi|304392225|ref|ZP_07374167.1| lipopolysaccharide export system ATP-binding protein LptB [Ahrensia
           sp. R2A130]
 gi|303296454|gb|EFL90812.1| lipopolysaccharide export system ATP-binding protein LptB [Ahrensia
           sp. R2A130]
          Length = 267

 Score =  315 bits (808), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 159/246 (64%), Positives = 189/246 (76%), Gaps = 1/246 (0%)

Query: 17  ENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLIC 76
           E RA +D +L A  L K Y    VV G  L V+ GE VGLLGPNGAGKTT FYM+TGL+ 
Sbjct: 23  EPRA-RDGVLLARGLKKTYKGRTVVDGASLGVRRGESVGLLGPNGAGKTTCFYMITGLVQ 81

Query: 77  ADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRH 136
            D G I++DG+D+T MPMY+R+RLGI YLPQEASIFRGL+VE+NI AVLEV EKD+ KR 
Sbjct: 82  PDEGKIELDGHDVTHMPMYQRSRLGIGYLPQEASIFRGLSVEDNIKAVLEVVEKDRSKRA 141

Query: 137 EKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISD 196
           E+LDSLL EF I   R   +  LSGG+RRRLEIAR+L S P+++LLDEPFAGVDP+A+ D
Sbjct: 142 EQLDSLLDEFKIGHLRKSPSIALSGGERRRLEIARALASRPAFMLLDEPFAGVDPIAVGD 201

Query: 197 IHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYL 256
           I  L+R L  RGIG+LITDHNV E L LIDRAYII +G VL HG+ QEI++N DVRRLYL
Sbjct: 202 IQDLVRHLTKRGIGVLITDHNVRETLGLIDRAYIIASGQVLTHGSPQEIVNNPDVRRLYL 261

Query: 257 GDRFAF 262
           GD+F  
Sbjct: 262 GDQFTL 267


>gi|75674373|ref|YP_316794.1| ABC transporter, ATPase subunit [Nitrobacter winogradskyi Nb-255]
 gi|74419243|gb|ABA03442.1| ABC transporter, ATPase subunit [Nitrobacter winogradskyi Nb-255]
          Length = 332

 Score =  315 bits (808), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 148/241 (61%), Positives = 194/241 (80%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A++   L+   + K + S  VV+GV +YV+ GE VGLLGPNGAGKTT FYM+TGLI AD 
Sbjct: 90  ATRPGYLAVHGVEKSFGSRQVVRGVSIYVRRGEAVGLLGPNGAGKTTVFYMITGLIPADR 149

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G+I++DG+D+T++PMY+RARLGI YLPQEASIFRGL+VE+NI AVLEV E +KKKR  +L
Sbjct: 150 GAIELDGHDVTRLPMYQRARLGIGYLPQEASIFRGLSVEQNIRAVLEVVEPNKKKREAEL 209

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           D+LL+EFNIT+ R   +  LSGG+RRR+EIAR+L + P+Y+LLDEPFAG+DP+A+ DI  
Sbjct: 210 DALLEEFNITRLRKSPSIALSGGERRRVEIARALATRPNYMLLDEPFAGIDPIAVGDIQD 269

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L+R L +RGIG+LITDHNV E L L DRAYI++AG +L  G+ + I+++ DVRRLYLG+ 
Sbjct: 270 LVRHLTNRGIGVLITDHNVRETLGLTDRAYIVYAGEILTEGSPEAIVNDPDVRRLYLGEE 329

Query: 260 F 260
           F
Sbjct: 330 F 330


>gi|163757836|ref|ZP_02164925.1| ABC transporter related protein [Hoeflea phototrophica DFL-43]
 gi|162285338|gb|EDQ35620.1| ABC transporter related protein [Hoeflea phototrophica DFL-43]
          Length = 268

 Score =  315 bits (806), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 190/240 (79%)

Query: 23  DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSI 82
           D  L A +LTK Y S  VV GV L V+ GE VGLLGPNGAGKTT FYM+TGL+  DSG+I
Sbjct: 29  DGTLIARNLTKAYKSRRVVDGVSLGVRRGEAVGLLGPNGAGKTTCFYMITGLVPVDSGTI 88

Query: 83  KIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSL 142
           +IDG+D++ +PMYRRARLG+ YLPQEASIFRGL+VE NI AVLEV EK++  R EKLDSL
Sbjct: 89  EIDGHDVSDLPMYRRARLGVGYLPQEASIFRGLSVEANIRAVLEVVEKNRALREEKLDSL 148

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EF+I+  R   +  LSGG+RRRLEIAR+L S P+++LLDEPFAGVDP+A+SDI  L+R
Sbjct: 149 LSEFHISHLRKSASISLSGGERRRLEIARALASDPTFMLLDEPFAGVDPIAVSDIQDLVR 208

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L  RGIG+LITDHNV E L LIDRAYI++AG +L HG   EI+ N DVRRLYLG++F+ 
Sbjct: 209 HLTRRGIGVLITDHNVRETLGLIDRAYIMNAGVLLTHGRPSEIVANPDVRRLYLGEQFSL 268


>gi|148251743|ref|YP_001236328.1| putative ABC transporter ATP-binding protein [Bradyrhizobium sp.
           BTAi1]
 gi|146403916|gb|ABQ32422.1| putative ABC transporter (ATP-binding protein) [Bradyrhizobium sp.
           BTAi1]
          Length = 336

 Score =  315 bits (806), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 148/239 (61%), Positives = 191/239 (79%)

Query: 22  KDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGS 81
           +   L+  S+ K + S  VV+GV +YV+ GE VGLLGPNGAGKTT FYM+TGLI AD G+
Sbjct: 96  RPGFLAVHSIEKSFGSRQVVRGVSIYVRRGEAVGLLGPNGAGKTTVFYMITGLIKADRGA 155

Query: 82  IKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDS 141
           I++DG+D+T++PMY+RARLGI YLPQEASIFRGLTVE+NI AVLEV E  +KKR  +LD+
Sbjct: 156 IELDGHDVTRLPMYQRARLGIGYLPQEASIFRGLTVEQNIRAVLEVVEPSRKKRERELDA 215

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           LL+EF IT+ R   +  LSGG+RRR+EIAR+L + P+Y+LLDEPFAG+DP+A+ DI  L+
Sbjct: 216 LLEEFTITRLRKSPSIALSGGERRRVEIARALATRPNYMLLDEPFAGIDPIAVGDIQQLV 275

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           R L +RGIG+LITDHNV E L L DRAYI++AG +L  G+ +EI+ + DVRRLYLG+ F
Sbjct: 276 RHLTNRGIGVLITDHNVRETLGLTDRAYIVYAGQILTEGSPEEIVADPDVRRLYLGEEF 334


>gi|86747782|ref|YP_484278.1| ABC transporter related [Rhodopseudomonas palustris HaA2]
 gi|86570810|gb|ABD05367.1| ABC transporter related [Rhodopseudomonas palustris HaA2]
          Length = 314

 Score =  313 bits (802), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 149/240 (62%), Positives = 190/240 (79%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
           S    L+   + K + +  +V+GV +YV+ GE VGLLGPNGAGKTT FYM+TGLI AD G
Sbjct: 73  SHSGYLAVHRVEKSFGTRKIVRGVSIYVRRGEAVGLLGPNGAGKTTVFYMITGLIKADRG 132

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLD 140
           +I++DG+D+TK+PMY+RARLGI YLPQEASIFRGL VE+NILAVLE  E DK+KR  +LD
Sbjct: 133 AIELDGHDVTKLPMYQRARLGIGYLPQEASIFRGLNVEQNILAVLEAVEPDKRKREAELD 192

Query: 141 SLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVL 200
           +LL EFNI + R   +  LSGG+RRR+EIAR+L S P+Y+LLDEPFAG+DP+A+ DI  L
Sbjct: 193 NLLHEFNIERLRKSPSIALSGGERRRVEIARALASRPNYMLLDEPFAGIDPIAVGDIQDL 252

Query: 201 IRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +R L +RGIG+LITDHNV E L L DRAYI++AG +L  G+ +EI++N DVRRLYLG+ F
Sbjct: 253 VRHLTNRGIGVLITDHNVRETLGLTDRAYIVYAGEILTEGSPEEIVNNPDVRRLYLGEEF 312


>gi|91974659|ref|YP_567318.1| ABC transporter related [Rhodopseudomonas palustris BisB5]
 gi|91681115|gb|ABE37417.1| ABC transporter related [Rhodopseudomonas palustris BisB5]
          Length = 317

 Score =  313 bits (801), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 149/244 (61%), Positives = 191/244 (78%)

Query: 17  ENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLIC 76
           + R S    L+   + K + +  +V+GV +YV+ GE VGLLGPNGAGKTT FYM+TGLI 
Sbjct: 72  QPRESHTGYLAVHRVEKSFGTRKIVRGVSIYVRRGEAVGLLGPNGAGKTTVFYMITGLIK 131

Query: 77  ADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRH 136
           AD G+I++DG+D+TK+PMY+RARLGI YLPQEASIFRGL VE+NI AVLE  E DK+KR 
Sbjct: 132 ADRGAIELDGHDVTKLPMYQRARLGIGYLPQEASIFRGLNVEQNIRAVLEAVEPDKRKRE 191

Query: 137 EKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISD 196
            +LD+LL EFNI + R   +  LSGG+RRR+EIAR+L S P+Y+LLDEPFAG+DP+A+ D
Sbjct: 192 AELDNLLHEFNIERLRKSPSIALSGGERRRVEIARALASRPNYMLLDEPFAGIDPIAVGD 251

Query: 197 IHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYL 256
           I  L+R L +RGIG+LITDHNV E L L DRAYI++AG +L  G+ +EI++N DVRRLYL
Sbjct: 252 IQDLVRHLTNRGIGVLITDHNVRETLGLTDRAYIVYAGEILTEGSPEEIVNNPDVRRLYL 311

Query: 257 GDRF 260
           G+ F
Sbjct: 312 GEEF 315


>gi|121601906|ref|YP_989615.1| ABC transporter, ATP-binding protein [Bartonella bacilliformis
           KC583]
 gi|120614083|gb|ABM44684.1| ABC transporter, ATP-binding protein [Bartonella bacilliformis
           KC583]
          Length = 264

 Score =  313 bits (801), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 156/237 (65%), Positives = 184/237 (77%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L+A  L K Y    +V GV   ++ GE VG+LGPNGAGKTT FYM+TGL+ AD GSI+ID
Sbjct: 28  LAARDLIKIYQGRQIVNGVSFSLRTGEAVGILGPNGAGKTTCFYMVTGLVKADGGSIEID 87

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G D+T MPMYRRARLGI YLPQEASIFRGL+VE NI AVLE+ EKD+ KR E+L++LL E
Sbjct: 88  GFDVTHMPMYRRARLGIGYLPQEASIFRGLSVENNIKAVLEIVEKDRFKRGEELNALLHE 147

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F I   R V A  LSGG+RRRLEIARSL S P +ILLDEPFAG+DP+AISDI  LIR L 
Sbjct: 148 FKIDHLRKVPAISLSGGERRRLEIARSLASRPDFILLDEPFAGIDPIAISDIQQLIRHLT 207

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIG+LITDHNV E L LIDRAYI+HAG VL HG   +II++ D RR+YLG++F+ 
Sbjct: 208 QRGIGVLITDHNVRETLGLIDRAYIVHAGQVLIHGCPNDIINDADTRRIYLGNQFSL 264


>gi|118589458|ref|ZP_01546864.1| probable ATP-binding protein [Stappia aggregata IAM 12614]
 gi|118438158|gb|EAV44793.1| probable ATP-binding protein [Stappia aggregata IAM 12614]
          Length = 270

 Score =  313 bits (801), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 160/260 (61%), Positives = 188/260 (72%)

Query: 3   SIRNYLGIEMPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGA 62
           S  N L   MP+   +       L    + K Y    VVK V L VKPGE VGLLGPNGA
Sbjct: 11  SENNGLQGNMPDTGHDGEDLSQALVVEGIGKTYGRRQVVKYVSLTVKPGEAVGLLGPNGA 70

Query: 63  GKTTFFYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENIL 122
           GKTT FYM+TGLI  D G I ++G +IT+MPMYRRARLGI YLPQEASIFRGLTVEENI 
Sbjct: 71  GKTTTFYMITGLIRPDQGQISLEGFNITRMPMYRRARLGIGYLPQEASIFRGLTVEENIR 130

Query: 123 AVLEVYEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILL 182
           AVLEV E +++KR E+LDSLL EF +T  R   +  LSGG+RRR+EIAR+L S PS++LL
Sbjct: 131 AVLEVIEPNRQKRREELDSLLAEFGLTHLRKSPSIALSGGERRRVEIARALASRPSFMLL 190

Query: 183 DEPFAGVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTV 242
           DEPFAG+DP+A+ DI  L+R L  RGIG+LITDHNV E L LIDRAYII +G VL  G  
Sbjct: 191 DEPFAGIDPIAVGDIQQLVRHLTQRGIGVLITDHNVRETLGLIDRAYIIASGEVLTEGLP 250

Query: 243 QEIIDNQDVRRLYLGDRFAF 262
           QEI+ N DVRRLYLG++F  
Sbjct: 251 QEIVTNPDVRRLYLGEQFTL 270


>gi|240849698|ref|YP_002971086.1| ABC transporter, ATP-binding protein [Bartonella grahamii as4aup]
 gi|240266821|gb|ACS50409.1| ABC transporter, ATP-binding protein [Bartonella grahamii as4aup]
          Length = 264

 Score =  312 bits (799), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 161/249 (64%), Positives = 189/249 (75%), Gaps = 3/249 (1%)

Query: 17  ENRASKDSL---LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTG 73
           E+ ASK+ L   L A +L K Y     V GV   ++ GE VG+LGPNGAGKTT FYM+TG
Sbjct: 16  ESEASKNPLKGTLIASNLIKVYRGRRTVNGVSFGIRTGEAVGILGPNGAGKTTCFYMVTG 75

Query: 74  LICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKK 133
           LI +D GSIKIDG DIT +PMYRRARLGI YLPQEASIFRGL+VE NI AVLEV EKD+ 
Sbjct: 76  LIKSDGGSIKIDGFDITHLPMYRRARLGIGYLPQEASIFRGLSVENNIKAVLEVVEKDRL 135

Query: 134 KRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
           K+ E+LDSLL EF I   R + A  LSGG+RRRLEIAR+L S P ++LLDEPFAG+DP+A
Sbjct: 136 KQREELDSLLHEFKIDHLRKMSALSLSGGERRRLEIARALASRPHFMLLDEPFAGIDPIA 195

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           I DI  LIR L  RGIG+LITDHNV E L L+DRAYIIH G VL HG   +II+N DVRR
Sbjct: 196 IFDIQQLIRHLTRRGIGVLITDHNVRETLGLVDRAYIIHTGRVLVHGCPNDIINNVDVRR 255

Query: 254 LYLGDRFAF 262
           +YLG++F+ 
Sbjct: 256 IYLGNQFSL 264


>gi|90420564|ref|ZP_01228471.1| ATP-binding protein, ABC-type transporter [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90335292|gb|EAS49045.1| ATP-binding protein, ABC-type transporter [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 272

 Score =  312 bits (799), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 154/242 (63%), Positives = 183/242 (75%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
           + +  L+A  LTK Y    VV  V L V+ GE VGLLGPNGAGKTT FYM+TGL+  D G
Sbjct: 31  AAEGTLAAAGLTKSYRGRRVVDDVGLLVRRGEAVGLLGPNGAGKTTCFYMITGLVPVDQG 90

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLD 140
            I +DG+DIT +PMYRR+RLGI YLPQEASIFRGL+VE NI AVLEV E D+  R E+L 
Sbjct: 91  RIMLDGHDITTVPMYRRSRLGIGYLPQEASIFRGLSVEGNIRAVLEVVEPDRDVREEELT 150

Query: 141 SLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVL 200
           +LL EF+I   R   +  LSGG+RRR EIAR+L S P+++LLDEPFAGVDP+A+SDI  L
Sbjct: 151 ALLSEFHIDHLRKQASTSLSGGERRRCEIARALASKPTFMLLDEPFAGVDPIAVSDIQQL 210

Query: 201 IRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +R L  RGIG+L+TDHNV E L LIDRAYI+HAG VL HG  QEI+DN DVRR YLGD F
Sbjct: 211 VRHLTKRGIGVLVTDHNVRETLGLIDRAYIMHAGAVLTHGKPQEIVDNPDVRRFYLGDEF 270

Query: 261 AF 262
           +F
Sbjct: 271 SF 272


>gi|110635993|ref|YP_676201.1| ABC transporter related [Mesorhizobium sp. BNC1]
 gi|110286977|gb|ABG65036.1| ABC transporter related protein [Chelativorans sp. BNC1]
          Length = 261

 Score =  312 bits (799), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 154/237 (64%), Positives = 184/237 (77%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  LTK Y +  VV GV L V+ GE VGLLGPNGAGKTT FYM+TGL+  D G+I ID
Sbjct: 25  LIARGLTKSYKNRQVVSGVSLGVRAGEAVGLLGPNGAGKTTCFYMVTGLVPVDQGTIHID 84

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G D+T MPMYRRARLGI YLPQEASIFRGL+VE NI A+LEV E+ +K+R   LD+LL+E
Sbjct: 85  GYDVTSMPMYRRARLGIGYLPQEASIFRGLSVEANIRAILEVVERSRKERERTLDALLEE 144

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F+I+  R   A  LSGG+RRRLEIAR+L S P+++LLDEPFAG+DP+A++DI  L+R L 
Sbjct: 145 FHISHLRKSSAISLSGGERRRLEIARALASKPNFMLLDEPFAGIDPIAVTDIQQLVRHLT 204

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           +RGIG+LITDHNV E L LIDRAYIIHAG VL HG   +I+ N DVRRLYLG+ F  
Sbjct: 205 ARGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRPDDIVGNPDVRRLYLGEGFTL 261


>gi|307943003|ref|ZP_07658348.1| lipopolysaccharide export system ATP-binding protein LptB
           [Roseibium sp. TrichSKD4]
 gi|307773799|gb|EFO33015.1| lipopolysaccharide export system ATP-binding protein LptB
           [Roseibium sp. TrichSKD4]
          Length = 263

 Score =  311 bits (798), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 155/239 (64%), Positives = 183/239 (76%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L    + K Y    VVK + L V+PGE VGLLGPNGAGKTT FYM+TGL+  D G I 
Sbjct: 25  SALVVNGIGKTYGRRQVVKYISLSVRPGESVGLLGPNGAGKTTTFYMITGLVRPDQGQIS 84

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           ++G DIT++PMYRRARLGI YLPQEASIFRGLTVEENI AVLEV E ++KKR E+LDSLL
Sbjct: 85  LEGFDITRLPMYRRARLGIGYLPQEASIFRGLTVEENIRAVLEVIEPNRKKRAEELDSLL 144

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EF +T  R   +  LSGG+RRR+EIAR+L S PS++LLDEPFAG+DP+A+ DI  L+R 
Sbjct: 145 EEFGLTYLRKSPSMALSGGERRRVEIARALASRPSFMLLDEPFAGIDPIAVGDIQALVRH 204

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  RGIG+LITDHNV E L LIDRAYII AG VL HG   EI+ N DVRRLYLG++F  
Sbjct: 205 LTQRGIGVLITDHNVRETLGLIDRAYIIAAGEVLTHGLPNEIVANPDVRRLYLGEQFTL 263


>gi|319403505|emb|CBI77084.1| ABC transporter/ATP-binding protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 264

 Score =  311 bits (796), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 153/244 (62%), Positives = 188/244 (77%)

Query: 19  RASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICAD 78
           + + +  L A +L K Y    VV  V   +  GE VG+LGPNGAGKTT FYM+TGL+ +D
Sbjct: 21  KKTSNRTLVAHNLVKVYRGRQVVDRVSFNIHAGETVGILGPNGAGKTTCFYMVTGLVKSD 80

Query: 79  SGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK 138
            GSI+IDG DIT +PMYRRARLGI YLPQEASIFRGL+VE+NI AVLEV +KD+ KRHE+
Sbjct: 81  GGSIEIDGFDITHLPMYRRARLGIGYLPQEASIFRGLSVEDNIKAVLEVIQKDRFKRHEE 140

Query: 139 LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIH 198
           LD+LL EF I   R + A  LSGG+RRRLEIAR+L S P+++LLDEPFAG+DP+AISDI 
Sbjct: 141 LDALLHEFKIDHLRKMPALSLSGGERRRLEIARALASRPNFMLLDEPFAGIDPIAISDIK 200

Query: 199 VLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGD 258
            L+R L  RGIG+L+TDHNV E L L+DRAYIIHAG VL HG   +II+N DVR +YLG+
Sbjct: 201 QLVRHLTQRGIGVLVTDHNVRETLELVDRAYIIHAGKVLVHGCPNDIINNADVREIYLGE 260

Query: 259 RFAF 262
           +F+ 
Sbjct: 261 QFSL 264


>gi|209883612|ref|YP_002287469.1| ABC transporter, ATPase subunit [Oligotropha carboxidovorans OM5]
 gi|209871808|gb|ACI91604.1| ABC transporter, ATPase subunit [Oligotropha carboxidovorans OM5]
          Length = 375

 Score =  310 bits (795), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 146/235 (62%), Positives = 189/235 (80%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L+   + K + +  VV+G+++YV+ GE VGLLGPNGAGKTT FYM+TGLI AD G I++D
Sbjct: 139 LAVHGIEKSFGTRKVVRGINIYVRRGEAVGLLGPNGAGKTTAFYMITGLIKADKGRIELD 198

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G+D+T +PMY+RARLGI YLPQEASIFRGL+VE+NI AVLEV E D++KR  +LDSLL+E
Sbjct: 199 GHDVTNLPMYQRARLGIGYLPQEASIFRGLSVEDNIRAVLEVAEPDRRKREYELDSLLEE 258

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           FNI + R   +  LSGG+RRR+EIAR+L + P+Y+LLDEPFAG+DP+A+ DI  L+R L 
Sbjct: 259 FNIVRLRKSPSIALSGGERRRVEIARALATKPNYMLLDEPFAGIDPIAVGDIQQLVRHLT 318

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +RGIG+LITDHNV E L L DRAYI++AG VL  G  +EI+++ DVRRLYLG+ F
Sbjct: 319 NRGIGVLITDHNVRETLGLTDRAYIVYAGEVLTEGQPEEIVNDPDVRRLYLGEEF 373


>gi|299133327|ref|ZP_07026522.1| ABC transporter related protein [Afipia sp. 1NLS2]
 gi|298593464|gb|EFI53664.1| ABC transporter related protein [Afipia sp. 1NLS2]
          Length = 388

 Score =  310 bits (794), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 193/248 (77%), Gaps = 3/248 (1%)

Query: 13  PEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMT 72
           P+  + RA     L+   + K + +  VV+G+++YV+ GE VGLLGPNGAGKTT FYM+T
Sbjct: 142 PQRSQPRAG---YLAVHGIEKSFGTRKVVRGINIYVRRGEAVGLLGPNGAGKTTAFYMIT 198

Query: 73  GLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDK 132
           GLI AD G I++DG D+T +PMY+RARLGI YLPQEASIFRGL+VE+NI AVLEV E D+
Sbjct: 199 GLIKADKGRIELDGYDVTSLPMYQRARLGIGYLPQEASIFRGLSVEDNIRAVLEVAEPDR 258

Query: 133 KKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPV 192
           +KR  +LDSLL+EFNI + R   +  LSGG+RRR+EIAR+L + P+Y+LLDEPFAG+DP+
Sbjct: 259 RKREYELDSLLEEFNIVRLRKSPSIALSGGERRRVEIARALATKPNYMLLDEPFAGIDPI 318

Query: 193 AISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVR 252
           A+ DI  L+R L +RGIG+LITDHNV E L L DRAYI++AG VL  G  +EI+++ DVR
Sbjct: 319 AVGDIQQLVRHLTNRGIGVLITDHNVRETLGLTDRAYIVYAGEVLTEGQPEEIVNDPDVR 378

Query: 253 RLYLGDRF 260
           RLYLG+ F
Sbjct: 379 RLYLGEEF 386


>gi|319406419|emb|CBI80059.1| ABC transporter/ATP-binding protein [Bartonella sp. 1-1C]
          Length = 263

 Score =  309 bits (791), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 153/237 (64%), Positives = 184/237 (77%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L K Y    VV  V   +  GE VG+LGPNGAGKTT FYM+TGL+ +D GSI+ID
Sbjct: 27  LVAHNLVKVYRGRQVVDRVSFNIHAGETVGILGPNGAGKTTCFYMVTGLVKSDGGSIEID 86

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DIT +PMYRRARLGI YLPQEASIFRGL+VE NI AVLEV +KD+ KRHE+LD+LL E
Sbjct: 87  GFDITHLPMYRRARLGIGYLPQEASIFRGLSVENNIKAVLEVIQKDRFKRHEELDALLHE 146

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F I   R + A  LSGG+RRRLEIAR+L S P+++LLDEPFAG+DP+AISDI  L+R L 
Sbjct: 147 FKIDHLRKMPALSLSGGERRRLEIARALASRPNFMLLDEPFAGIDPIAISDIKQLVRHLT 206

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIG+L+TDHNV E L L+DRAYIIHAG VL HG   +II+N DVR +YLG++F+ 
Sbjct: 207 QRGIGVLVTDHNVRETLELVDRAYIIHAGKVLVHGCPNDIINNADVREIYLGEQFSL 263


>gi|158425550|ref|YP_001526842.1| putative ABC transporter ATP-binding protein in ntrA/rpoN 5'region
           [Azorhizobium caulinodans ORS 571]
 gi|465646|sp|P33982|Y3926_AZOC5 RecName: Full=Probable ABC transporter ATP-binding protein
           AZC_3926; AltName: Full=ORF1
 gi|311388|emb|CAA49581.1| unnamed protein product [Azorhizobium caulinodans ORS 571]
 gi|158332439|dbj|BAF89924.1| putative ABC transporter ATP-binding protein in ntrA/rpoN 5'region
           [Azorhizobium caulinodans ORS 571]
          Length = 281

 Score =  308 bits (790), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 150/241 (62%), Positives = 188/241 (78%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A+ +  L+A  L K Y    VV+ V L V+ GE VGLLGPNGAGKTT FYM+TGL+ AD 
Sbjct: 39  ATAEGSLAAFGLAKSYGGRKVVRDVSLDVRRGEAVGLLGPNGAGKTTVFYMITGLVKADQ 98

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G I++DG+D+T MPMYRRARLGI YLPQEASIFRGL+VE+NI AVLE+ E ++K+R E+L
Sbjct: 99  GRIELDGHDVTPMPMYRRARLGIGYLPQEASIFRGLSVEDNIGAVLEITEPNRKRRAEEL 158

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           D+LL+EF IT  R   +  LSGG+RRR+EIAR+L S P+++LLDEPFAG+DP+A+ DI  
Sbjct: 159 DALLEEFKITHVRKSPSIALSGGERRRVEIARALASRPAFMLLDEPFAGIDPIAVGDIQA 218

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L+R L +RGIG+LITDHNV E L LIDRAYIIH+G VL  G  + I+ + DVRRLYLG+ 
Sbjct: 219 LVRHLTTRGIGVLITDHNVRETLGLIDRAYIIHSGTVLMEGDPESIVASPDVRRLYLGEE 278

Query: 260 F 260
           F
Sbjct: 279 F 279


>gi|115522457|ref|YP_779368.1| ABC transporter related [Rhodopseudomonas palustris BisA53]
 gi|115516404|gb|ABJ04388.1| ABC transporter related [Rhodopseudomonas palustris BisA53]
          Length = 314

 Score =  308 bits (788), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 190/235 (80%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L+  S+ K + +  +V+GV +YV+ GE VGLLGPNGAGKTT FYM+TGLI AD G++++D
Sbjct: 78  LAVHSVEKSFGTRKIVRGVSIYVRRGEAVGLLGPNGAGKTTVFYMITGLIKADRGAVELD 137

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G+D+TK+PMY+RARLGI YLPQEASIFRGL+VE+NI AVLE  E ++ KR  +LD+LL+E
Sbjct: 138 GHDVTKLPMYQRARLGIGYLPQEASIFRGLSVEQNIRAVLEAVEPNRDKREAELDNLLRE 197

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F+I + R   +  LSGG+RRR+EIAR+L S P+Y+LLDEPFAG+DP+A+ DI  L+R L 
Sbjct: 198 FHIERLRKSPSIALSGGERRRVEIARALASRPNYMLLDEPFAGIDPIAVGDIQDLVRHLT 257

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +RGIG+LITDHNV E L L DRAYI++AG +L  G+ +EI++N DVRRLYLG+ F
Sbjct: 258 NRGIGVLITDHNVRETLGLTDRAYIVYAGEILTEGSPEEIVNNPDVRRLYLGEEF 312


>gi|49473703|ref|YP_031745.1| ABC transporter/ATP-binding protein [Bartonella quintana str.
           Toulouse]
 gi|49239206|emb|CAF25523.1| ABC transporter/ATP-binding protein [Bartonella quintana str.
           Toulouse]
          Length = 264

 Score =  307 bits (787), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 154/237 (64%), Positives = 182/237 (76%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y    V+  V   ++ GE +G+LGPNGAGKTT FYM+TGLI +D G IKID
Sbjct: 28  LVASHLVKVYRGRQVINDVSFGIRTGEAIGILGPNGAGKTTCFYMVTGLIKSDGGKIKID 87

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DIT +PMYRRARLGI YLPQEASIFRGL+VE NI AVLEV EKD+ KR E+L++LL E
Sbjct: 88  GFDITHLPMYRRARLGIGYLPQEASIFRGLSVENNIKAVLEVVEKDRFKRREELNALLHE 147

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F I   R + A  LSGG+RRRLEIAR+L S P++ILLDEPFAG+DP+AI DI  LIR L 
Sbjct: 148 FKINHLRKMPALSLSGGERRRLEIARALASRPNFILLDEPFAGIDPIAIFDIQQLIRYLT 207

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIG+LITDHNV E L L+DRAYIIHAG VL HG   +II+N DVRR+YLG++F+ 
Sbjct: 208 QRGIGVLITDHNVRETLELVDRAYIIHAGKVLVHGCPNDIINNTDVRRIYLGNQFSL 264


>gi|319898208|ref|YP_004158301.1| ABC transporter, ATP-binding protein [Bartonella clarridgeiae 73]
 gi|319402172|emb|CBI75698.1| ABC transporter, ATP-binding protein [Bartonella clarridgeiae 73]
          Length = 264

 Score =  307 bits (786), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 153/244 (62%), Positives = 187/244 (76%)

Query: 19  RASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICAD 78
           + + + +L A +L K Y    VV  V   ++ GE VG+LGPNGAGKTT FYM+TGLI +D
Sbjct: 21  KKTSNRILVAHNLIKAYRGRQVVNHVSFNIRAGETVGILGPNGAGKTTCFYMVTGLIKSD 80

Query: 79  SGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK 138
            G I+IDG DIT +PMYRRARLGI YLPQEASIFRGL+VE NI AVLEV +KD+ KR E+
Sbjct: 81  GGLIEIDGFDITHLPMYRRARLGIGYLPQEASIFRGLSVENNIKAVLEVIQKDRFKRCEE 140

Query: 139 LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIH 198
           LD+LL EF I   R + A  LSGG+RRRLEIAR+L S P++ILLDEPFAG+DP+AISDI 
Sbjct: 141 LDALLHEFKIDHLRKIPALSLSGGERRRLEIARALASRPNFILLDEPFAGIDPIAISDIK 200

Query: 199 VLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGD 258
            L+R L  RGIG+LITDHNV E L L+DRAYIIH+G VL HG    II+N DVR++YLG+
Sbjct: 201 QLVRHLTQRGIGVLITDHNVRETLELVDRAYIIHSGKVLVHGCPDVIINNADVRKIYLGN 260

Query: 259 RFAF 262
           +F+ 
Sbjct: 261 QFSL 264


>gi|163867322|ref|YP_001608516.1| ABC transporter/ATP-binding protein [Bartonella tribocorum CIP
           105476]
 gi|161016963|emb|CAK00521.1| ABC transporter/ATP-binding protein [Bartonella tribocorum CIP
           105476]
          Length = 264

 Score =  307 bits (786), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 159/248 (64%), Positives = 186/248 (75%), Gaps = 3/248 (1%)

Query: 18  NRASKDSL---LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGL 74
           + ASK  L   L A  L K Y     V GV   ++ GE VG+LGPNGAGKTT FYM+TGL
Sbjct: 17  SEASKKRLKGTLIASHLIKIYRGRPTVNGVSFGIRTGEAVGILGPNGAGKTTCFYMVTGL 76

Query: 75  ICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKK 134
           I +D GSIKIDG DIT +PMYRRARLGI YLPQEASIFRGL+VE NI AVLEV EKD+ K
Sbjct: 77  IKSDGGSIKIDGFDITHLPMYRRARLGIGYLPQEASIFRGLSVENNIKAVLEVVEKDRLK 136

Query: 135 RHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAI 194
           + E+L+SLL EF I   R + A  LSGG+RRRLEIAR+L S P ++LLDEPFAG+DP+AI
Sbjct: 137 QREELESLLHEFKIDHLRKMSALSLSGGERRRLEIARALASRPHFMLLDEPFAGIDPIAI 196

Query: 195 SDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRL 254
            DI  LIR L  RGIG+LITDHNV E L L+DRAYIIH G VL HG   +II+N DVRR+
Sbjct: 197 FDIQQLIRHLTKRGIGVLITDHNVRETLGLVDRAYIIHTGKVLVHGRPHDIINNVDVRRI 256

Query: 255 YLGDRFAF 262
           YLG++F+ 
Sbjct: 257 YLGNQFSL 264


>gi|254502853|ref|ZP_05115004.1| ABC transporter, ATP-binding protein, putative [Labrenzia
           alexandrii DFL-11]
 gi|222438924|gb|EEE45603.1| ABC transporter, ATP-binding protein, putative [Labrenzia
           alexandrii DFL-11]
          Length = 260

 Score =  306 bits (784), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 153/233 (65%), Positives = 179/233 (76%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
            + K Y    VVK V L V+PGE VGLLGPNGAGKTT FYM+TGLI  D G I ++G DI
Sbjct: 28  GIGKTYGRRQVVKNVGLMVRPGEAVGLLGPNGAGKTTTFYMITGLIRPDQGKIYLEGFDI 87

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           T+MPMYRRARLGI YLPQEASIFRGLTVEENI AVLEV E ++K+R E LDSLL EF +T
Sbjct: 88  TRMPMYRRARLGIGYLPQEASIFRGLTVEENIRAVLEVIEPNRKQRKEDLDSLLAEFGLT 147

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             R   +  LSGG+RRR+EIAR+L S PS++LLDEPFAG+DP+A+ DI  L+R L  RGI
Sbjct: 148 HLRKSPSIALSGGERRRVEIARALASRPSFMLLDEPFAGIDPIAVGDIQQLVRHLTKRGI 207

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           G+LITDHNV E L LIDRAYII AG VL  G  ++I+ N DVRRLYLG++F  
Sbjct: 208 GVLITDHNVRETLGLIDRAYIIAAGEVLTEGLPRDIVSNPDVRRLYLGEQFTL 260


>gi|319404929|emb|CBI78529.1| ABC transporter/ATP-binding protein [Bartonella sp. AR 15-3]
          Length = 264

 Score =  306 bits (784), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 151/244 (61%), Positives = 187/244 (76%)

Query: 19  RASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICAD 78
           + + +  L A +L K Y    VV  V   +  GEIVG+LGPNGAGKTT FYM+TGL+ +D
Sbjct: 21  KKNSNRTLVAHNLIKVYRGRQVVNCVSFNICAGEIVGILGPNGAGKTTCFYMVTGLVKSD 80

Query: 79  SGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK 138
            GSI+IDG DIT +PMYRRARLGI YLPQEASIFRGL+VE NI AVLE+ +KD+ KR E+
Sbjct: 81  GGSIEIDGFDITHLPMYRRARLGIGYLPQEASIFRGLSVENNIKAVLELIQKDRLKRCEE 140

Query: 139 LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIH 198
           LD+LL EF I   R + A  LSGG+RRRLEIAR+L S P+++LLDEPFAG+DP+AISDI 
Sbjct: 141 LDALLHEFKIDHLRKMPALSLSGGERRRLEIARALASSPNFMLLDEPFAGIDPIAISDIK 200

Query: 199 VLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGD 258
            L+R L  RGIG+L+TDHNV E L L+DRAY+IHAG VL HG   +II+N DVR +YLG+
Sbjct: 201 QLVRHLTQRGIGVLVTDHNVRETLELVDRAYVIHAGEVLVHGCPNDIINNADVREIYLGN 260

Query: 259 RFAF 262
           +F+ 
Sbjct: 261 QFSL 264


>gi|49474848|ref|YP_032889.1| ABC transporter/ATP-binding protein [Bartonella henselae str.
           Houston-1]
 gi|49237653|emb|CAF26833.1| ABC transporter/ATP-binding protein [Bartonella henselae str.
           Houston-1]
          Length = 264

 Score =  306 bits (783), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 183/237 (77%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y    V+  V   ++ GE VG+LGPNGAGKTT FYM+TGLI +D GSIKID
Sbjct: 28  LIASHLVKFYRGRQVINDVSFGIRTGEAVGILGPNGAGKTTCFYMVTGLIKSDGGSIKID 87

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DIT +PMYRRARLGI YLPQEASIFRGL+VE+NI AVLEV EKD+ KR E LD+LL E
Sbjct: 88  GFDITHLPMYRRARLGIGYLPQEASIFRGLSVEKNIKAVLEVVEKDRLKRREDLDALLHE 147

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F I   R + A  LSGG+RRRLEIAR+L S P+++LLDEPFAG+DP+AI DI  LIR L 
Sbjct: 148 FKIDHLRKMPALSLSGGERRRLEIARALASRPNFMLLDEPFAGIDPIAIFDIQQLIRYLT 207

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIG+LITDHNV E L L+DRAYIIHAG VL HG   +II++ DVRR+YLG++F+ 
Sbjct: 208 RRGIGVLITDHNVRETLGLVDRAYIIHAGQVLVHGCPNDIINDADVRRIYLGNQFSL 264


>gi|154244023|ref|YP_001414981.1| ABC transporter related [Xanthobacter autotrophicus Py2]
 gi|154158108|gb|ABS65324.1| ABC transporter related [Xanthobacter autotrophicus Py2]
          Length = 310

 Score =  305 bits (781), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 148/237 (62%), Positives = 184/237 (77%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L+A  + K Y    VV+ V L V+ GE VGLLGPNGAGKTT FYM+TGL+ AD G I+
Sbjct: 72  SALAAFGIAKSYGGRQVVRDVSLNVRRGEAVGLLGPNGAGKTTCFYMVTGLVKADRGRIE 131

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG+DIT MPMYRRARLG+ YLPQEASIFRGL+VE+NI+ VLEV E ++ +R E+ ++LL
Sbjct: 132 LDGHDITPMPMYRRARLGVGYLPQEASIFRGLSVEDNIMGVLEVTEPNRARRREETEALL 191

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EF IT  R   +  LSGG+RRRLEIAR+L S PS++LLDEPFAG+DP+A+ DI  L+R 
Sbjct: 192 EEFKITHVRKSPSIALSGGERRRLEIARALASQPSFMLLDEPFAGIDPIAVGDIQALVRH 251

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L SRGIG+LITDHNV E L LIDRAYIIH+G VL  G  + I+ + +VRRLYLG+ F
Sbjct: 252 LTSRGIGVLITDHNVRETLGLIDRAYIIHSGSVLMEGDPESIVSSPEVRRLYLGEEF 308


>gi|220921153|ref|YP_002496454.1| ABC transporter-like protein [Methylobacterium nodulans ORS 2060]
 gi|219945759|gb|ACL56151.1| ABC transporter related [Methylobacterium nodulans ORS 2060]
          Length = 282

 Score =  305 bits (780), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 150/248 (60%), Positives = 182/248 (73%)

Query: 13  PEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMT 72
           P+          +L+   L K Y +  VV    L V+ GE VGLLGPNGAGKTT FYM+T
Sbjct: 33  PQTAAEALGGPGILAVHGLRKSYGARTVVHEAGLAVQTGEAVGLLGPNGAGKTTIFYMIT 92

Query: 73  GLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDK 132
           GL+ AD G I +DG +IT++PMY+RARLGI YLPQEASIFRGL VE+NI AVLEV E D+
Sbjct: 93  GLVSADRGVISLDGREITRLPMYQRARLGIGYLPQEASIFRGLNVEDNIRAVLEVVEPDR 152

Query: 133 KKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPV 192
           K R  +LD+LL EFNIT+ R   +  LSGG+RRRLEIAR+L S PS++LLDEPFAG+DP+
Sbjct: 153 KLRERRLDALLDEFNITRLRKSPSIALSGGERRRLEIARALASSPSFVLLDEPFAGIDPI 212

Query: 193 AISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVR 252
           A+ DI  L+  L  RGIG+LITDHNV E L LIDRAYI+H+G +L  GT  EI+ N DVR
Sbjct: 213 AVGDIQDLVMHLKGRGIGVLITDHNVRETLGLIDRAYIVHSGRILTEGTPDEIVANDDVR 272

Query: 253 RLYLGDRF 260
           RLYLG+ F
Sbjct: 273 RLYLGEDF 280


>gi|298290364|ref|YP_003692303.1| ABC transporter [Starkeya novella DSM 506]
 gi|296926875|gb|ADH87684.1| ABC transporter related protein [Starkeya novella DSM 506]
          Length = 327

 Score =  305 bits (780), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 147/248 (59%), Positives = 188/248 (75%), Gaps = 4/248 (1%)

Query: 13  PEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMT 72
           PE  ++R     +L A  L K Y    VV+   + V+ GE VGLLGPNGAGKTT FYM+T
Sbjct: 82  PEPVDDRG----VLRATGLAKSYGGRKVVRDASINVRRGEAVGLLGPNGAGKTTIFYMIT 137

Query: 73  GLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDK 132
           GL+ AD+G I++DG+D+T +PMYRRARLG+ YLPQEASIFRGL+VE NI AVLEV E  +
Sbjct: 138 GLVKADAGRIELDGHDVTHLPMYRRARLGVGYLPQEASIFRGLSVENNIRAVLEVVEPSR 197

Query: 133 KKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPV 192
           K+R  +LD+LL+EF +T  R   +  LSGG+RRR+EIAR+L S P+++LLDEPFAG+DP+
Sbjct: 198 KERERQLDALLEEFRVTHVRKSPSIALSGGERRRVEIARALASRPTFMLLDEPFAGIDPI 257

Query: 193 AISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVR 252
           A+ DI  L+R L  RGIG+LITDHNV E L LIDRAYIIH+G VL  G+  EI+ +++VR
Sbjct: 258 AVGDIQTLVRHLTQRGIGVLITDHNVRETLGLIDRAYIIHSGAVLMEGSPDEIVASEEVR 317

Query: 253 RLYLGDRF 260
           RLYLG+ F
Sbjct: 318 RLYLGEEF 325


>gi|217976354|ref|YP_002360501.1| ABC transporter related [Methylocella silvestris BL2]
 gi|217501730|gb|ACK49139.1| ABC transporter related [Methylocella silvestris BL2]
          Length = 321

 Score =  303 bits (775), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 144/241 (59%), Positives = 184/241 (76%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A  + +LS   L K Y    +++ V L V+ GE VGLLGPNGAGKTT FYM++GLI  D+
Sbjct: 79  ADSEGVLSVMRLRKSYKMRRIIEDVSLTVRRGEAVGLLGPNGAGKTTLFYMISGLIRPDA 138

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G I++DG+D+T++PMYRRARLGI YLPQE SIFRGLTVE+NI AVLE+ + DK+KR  +L
Sbjct: 139 GRIELDGHDVTRLPMYRRARLGIGYLPQEPSIFRGLTVEDNIRAVLEITQSDKQKREREL 198

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           D+LL+EF+I   R   +  LSGG+RRR EIAR+L   PS+ILLDEPFAG+DP+A++DI  
Sbjct: 199 DALLEEFDIAALRRSPSVALSGGERRRCEIARALACRPSFILLDEPFAGIDPIAVADIQT 258

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L++ L +RGIG+L+TDHNV E L LIDRAYIIHAG VL  GT  +I+ + + RR YLGD 
Sbjct: 259 LVQHLKTRGIGVLVTDHNVRETLGLIDRAYIIHAGRVLTQGTPADIVADAEARRFYLGDD 318

Query: 260 F 260
           F
Sbjct: 319 F 319


>gi|328545550|ref|YP_004305659.1| ABC transporter ATPase [polymorphum gilvum SL003B-26A1]
 gi|326415291|gb|ADZ72354.1| ABC transporter, ATPase subunit [Polymorphum gilvum SL003B-26A1]
          Length = 265

 Score =  302 bits (773), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 150/246 (60%), Positives = 183/246 (74%)

Query: 17  ENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLIC 76
           ++  ++D  L    + K Y    VVK V L V+PGE VGLLGPNGAGKTT FYM+TGLI 
Sbjct: 20  QDAGTEDGALVVEGIGKSYRRRQVVKYVSLTVRPGEAVGLLGPNGAGKTTVFYMITGLIR 79

Query: 77  ADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRH 136
            D G I++DG DIT +PMYRRARLGI YLPQEASIFRGL VE+NI AVLEV E D+++R 
Sbjct: 80  PDQGKIELDGFDITDLPMYRRARLGIGYLPQEASIFRGLNVEDNIRAVLEVVEPDRRRRE 139

Query: 137 EKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISD 196
           + L+ LL EF +T  R   +  LSGG+RRR+EIAR+L S PS++LLDEPFAG+DP+A+ D
Sbjct: 140 QDLNDLLSEFGLTHLRRSPSIALSGGERRRVEIARALASRPSFMLLDEPFAGIDPIAVGD 199

Query: 197 IHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYL 256
           I  L+R L  RGIG+LITDHNV E L LIDRAYII AG VL  G+  EI+ + DVRRLYL
Sbjct: 200 IQQLVRHLTQRGIGVLITDHNVRETLGLIDRAYIIAAGEVLTEGSPFEIVADPDVRRLYL 259

Query: 257 GDRFAF 262
           G++F  
Sbjct: 260 GEQFTL 265


>gi|182677563|ref|YP_001831709.1| ABC transporter related [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182633446|gb|ACB94220.1| ABC transporter related [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 311

 Score =  301 bits (770), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 149/243 (61%), Positives = 187/243 (76%)

Query: 18  NRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICA 77
           N  + + +L+A  L K Y +  VV+ V L+V+ GE VGLLGPNGAGKTT FYM+TGLI  
Sbjct: 67  NPETSEGVLAASHLRKFYKTRRVVEDVSLHVRRGEAVGLLGPNGAGKTTVFYMITGLIRP 126

Query: 78  DSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHE 137
           D G+I +DG+D+T +PMYRRARLG+ YLPQEASIFRGL+VE+NI AVLE+ + DK KR E
Sbjct: 127 DQGNIFLDGHDVTPLPMYRRARLGVGYLPQEASIFRGLSVEDNIRAVLEISQPDKHKRAE 186

Query: 138 KLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDI 197
           +L+SLL EF+I + R   +  LSGG+RRR EIAR+L   P+++LLDEPFAGVDP+A++DI
Sbjct: 187 ELESLLDEFDIKRLRKSPSIALSGGERRRCEIARALAGKPAFMLLDEPFAGVDPIAVNDI 246

Query: 198 HVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLG 257
            VL+R L  RGIG+LITDH V E L LIDRAYIIH+G VL  GT  EI+ ++DVRR YLG
Sbjct: 247 KVLVRHLTQRGIGVLITDHAVRETLGLIDRAYIIHSGHVLTDGTPDEIVAHEDVRRFYLG 306

Query: 258 DRF 260
             F
Sbjct: 307 ADF 309


>gi|319407891|emb|CBI81543.1| ABC transporter/ATP-binding protein [Bartonella schoenbuchensis R1]
          Length = 264

 Score =  300 bits (768), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 151/237 (63%), Positives = 180/237 (75%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y    VVK V   V  GE VG+LGPNGAGKTT FYM+TGL+ AD G+I+I+
Sbjct: 28  LVARHLVKAYRGRQVVKDVSFNVCTGEAVGILGPNGAGKTTCFYMVTGLVEADGGTIEIN 87

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G ++T MPMY+RARLGI YLPQEASIFRGL+VE NI AVLEV EKD+ KR E+LD+LL E
Sbjct: 88  GFNVTHMPMYQRARLGIGYLPQEASIFRGLSVENNIKAVLEVIEKDRFKRREELDALLCE 147

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F I   R   A  LSGG+RRRLEIAR+L S P+++LLDEPFAG+DP+AISDI  L+  L 
Sbjct: 148 FKIDHLRKTPAISLSGGERRRLEIARALASRPNFMLLDEPFAGIDPIAISDIQRLVHHLT 207

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIG+LITDHNV E L L+DRAYIIH G VL  G   +II+N DVRR+YLG++F+ 
Sbjct: 208 QRGIGVLITDHNVRETLNLVDRAYIIHEGQVLIDGCPNDIINNADVRRIYLGNQFSL 264


>gi|254471082|ref|ZP_05084485.1| ABC transporter, ATPase subunit [Pseudovibrio sp. JE062]
 gi|211960224|gb|EEA95421.1| ABC transporter, ATPase subunit [Pseudovibrio sp. JE062]
          Length = 264

 Score =  299 bits (765), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 150/251 (59%), Positives = 185/251 (73%)

Query: 12  MPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMM 71
            PE  +     +++L    + K Y    VVK V L V+ GE VGLLGPNGAGKTT FYM+
Sbjct: 14  QPEGIKYADPSEAVLEVDGIGKSYGRRQVVKHVSLNVRRGEAVGLLGPNGAGKTTCFYMI 73

Query: 72  TGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD 131
           TGLI  D G+I++D  D+T++PMYRRARLG+ YLPQEASIFRGL+VE+NI AVLEV E +
Sbjct: 74  TGLIRPDHGAIRLDNFDMTQLPMYRRARLGVGYLPQEASIFRGLSVEDNIRAVLEVVEPN 133

Query: 132 KKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDP 191
           KK+R E LDSLL EF +T  R   +  LSGG+RRR+EIAR+L S PS++LLDEPFAG+DP
Sbjct: 134 KKRREEDLDSLLTEFGVTHLRKSPSIALSGGERRRVEIARALASRPSFMLLDEPFAGIDP 193

Query: 192 VAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDV 251
           +A+ DI  L+R L  RGIG+LITDHNV E L LIDRAYII AG VL  G   +I+ + DV
Sbjct: 194 IAVGDIQQLVRHLTQRGIGVLITDHNVRETLGLIDRAYIIAAGEVLTEGKPHQIVADPDV 253

Query: 252 RRLYLGDRFAF 262
           RRLYLG++F  
Sbjct: 254 RRLYLGEQFTL 264


>gi|312114051|ref|YP_004011647.1| ABC transporter [Rhodomicrobium vannielii ATCC 17100]
 gi|311219180|gb|ADP70548.1| ABC transporter related protein [Rhodomicrobium vannielii ATCC
           17100]
          Length = 279

 Score =  298 bits (764), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 151/251 (60%), Positives = 184/251 (73%), Gaps = 2/251 (0%)

Query: 13  PEFQENRASKD--SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYM 70
           P  +E R +      L    + K +    VVKGV + +K GE VGLLGPNGAGKTT FYM
Sbjct: 28  PVLRERRPAPQVREQLIVNGVKKSFKKRMVVKGVSVNLKRGESVGLLGPNGAGKTTVFYM 87

Query: 71  MTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK 130
           +TGLI  D G++ IDG D+T + MYRRARLGI+YLPQEASIFRGL+VE+NI+AVLEV E 
Sbjct: 88  ITGLIKPDEGNVHIDGYDVTALSMYRRARLGIAYLPQEASIFRGLSVEDNIMAVLEVSEP 147

Query: 131 DKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVD 190
           D+K+R  +LD LL EF I + R   +  LSGG+RRR EIAR+L S PSY+LLDEPFAG+D
Sbjct: 148 DRKERKRRLDELLDEFKIGRLRKSPSIALSGGERRRCEIARALASNPSYVLLDEPFAGID 207

Query: 191 PVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQD 250
           P+AI DI  L+  L  RGIG+LITDHNV E L LIDRAYII+ G VL  GT  E++ N+D
Sbjct: 208 PIAIGDIRQLVTHLTDRGIGVLITDHNVRETLDLIDRAYIIYDGRVLTEGTPAEVVANED 267

Query: 251 VRRLYLGDRFA 261
           VRR+YLGD F+
Sbjct: 268 VRRVYLGDMFS 278


>gi|170751838|ref|YP_001758098.1| ABC transporter related [Methylobacterium radiotolerans JCM 2831]
 gi|170658360|gb|ACB27415.1| ABC transporter related [Methylobacterium radiotolerans JCM 2831]
          Length = 283

 Score =  298 bits (764), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 148/237 (62%), Positives = 178/237 (75%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
            +LS   L K Y +  VV    L V+ GE VGLLGPNGAGKTT FYM+TGL+ AD G I 
Sbjct: 45  GILSVRGLRKSYGARTVVHEAGLTVRTGEAVGLLGPNGAGKTTIFYMITGLVAADRGHIT 104

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG  IT +PMY+RARLGI YLPQEASIFRGLTVE+NI AVLEV E D+K R  KLDSLL
Sbjct: 105 LDGLPITHLPMYQRARLGIGYLPQEASIFRGLTVEDNIRAVLEVVEPDRKTRARKLDSLL 164

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EF+I + R   +  LSGG+RRR EIAR+L S P+++LLDEPFAG+DP+A+ DI  L++ 
Sbjct: 165 EEFDIARLRKSPSIALSGGERRRCEIARALASSPTFMLLDEPFAGIDPIAVGDIQDLVKH 224

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L LIDRAYI H+G +L  GT +EI+ N D RRLYLG+ F
Sbjct: 225 LKQRGIGVLITDHNVRETLGLIDRAYIAHSGRILTEGTPEEIVANPDARRLYLGEDF 281


>gi|254292598|ref|YP_003058621.1| ABC transporter [Hirschia baltica ATCC 49814]
 gi|254041129|gb|ACT57924.1| ABC transporter related [Hirschia baltica ATCC 49814]
          Length = 256

 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 142/236 (60%), Positives = 182/236 (77%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A ++ K +    VVK V L ++ GEIVGLLGPNGAGKTT FYM+ GLI  D+G ++ID
Sbjct: 20  LQALNIAKSFKGRSVVKDVSLSLQRGEIVGLLGPNGAGKTTCFYMIMGLIAVDNGRVEID 79

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G D+T +PMY+RARLG+ YLPQE SIFRG+TVE+NI++V E+ EK K+KRHE + SL+ E
Sbjct: 80  GEDVTALPMYQRARLGVGYLPQENSIFRGMTVEQNIMSVAELTEKSKEKRHELVASLMDE 139

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
            N+   R   A  LSGG+RRR+EIAR+L S PS+ILLDEPFAG+DP+A+SDI  L+R L 
Sbjct: 140 LNVAHLRDQSANSLSGGERRRVEIARALASRPSFILLDEPFAGIDPLAVSDISDLVRYLK 199

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
            RG+G+LITDH V E+L ++DRA II+ G VL  G  +EI+ N+DVRR+YLGDRFA
Sbjct: 200 QRGLGVLITDHQVREMLDIVDRASIIYEGEVLFEGQPEEILANKDVRRVYLGDRFA 255


>gi|170740423|ref|YP_001769078.1| ABC transporter-like protein [Methylobacterium sp. 4-46]
 gi|168194697|gb|ACA16644.1| ABC transporter related [Methylobacterium sp. 4-46]
          Length = 282

 Score =  296 bits (757), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 148/236 (62%), Positives = 180/236 (76%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L+   L K Y +  VV    L V+ GE VGLLGPNGAGKTT FYM+TGL+ AD G I +
Sbjct: 45  ILAVHGLRKSYGARTVVHEAGLTVQTGEAVGLLGPNGAGKTTIFYMITGLVTADRGLITL 104

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           DG +IT++PMY+RARLGI YLPQEASIFRGL VE+NI AVLEV E D+++R  +LD+LL 
Sbjct: 105 DGREITRLPMYQRARLGIGYLPQEASIFRGLNVEDNIRAVLEVVEPDRRERERRLDALLD 164

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EFNI + R   A  LSGG+RRRLEIAR+L S PS++LLDEPFAG+DP+A+ DI  L+  L
Sbjct: 165 EFNIARLRKSPAIALSGGERRRLEIARALASSPSFVLLDEPFAGIDPIAVGDIQDLVMHL 224

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             RGIG+LITDHNV E L LIDRAYI+H+G +L  GT  EI+ N DVRRLYLG+ F
Sbjct: 225 KGRGIGVLITDHNVRETLGLIDRAYIVHSGRILTEGTPAEIVANDDVRRLYLGEDF 280


>gi|218530674|ref|YP_002421490.1| ABC transporter [Methylobacterium chloromethanicum CM4]
 gi|218522977|gb|ACK83562.1| ABC transporter related [Methylobacterium chloromethanicum CM4]
          Length = 290

 Score =  296 bits (757), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 146/237 (61%), Positives = 178/237 (75%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
            +L    L K Y +  VV    L V  GE VGLLGPNGAGKTT FYM+TGL+ AD G I 
Sbjct: 52  GVLHVRGLRKSYGARTVVHEAGLTVHNGEAVGLLGPNGAGKTTIFYMITGLVPADRGFIS 111

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG +IT +PMY+RARLGI YLPQEASIFRGLTVE+NI AVLEV E D+K R  KLDSLL
Sbjct: 112 LDGMEITHLPMYQRARLGIGYLPQEASIFRGLTVEDNIRAVLEVAEPDRKARERKLDSLL 171

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EF+I + R   +  LSGG+RRR EIAR+L S P+++LLDEPFAG+DP+A+ DI  L++ 
Sbjct: 172 EEFDIARLRKSPSIALSGGERRRCEIARALASSPTFMLLDEPFAGIDPIAVGDIQDLVKH 231

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L LIDRAYI H+G +L  GT ++I+ N+D RRLYLG+ F
Sbjct: 232 LKQRGIGVLITDHNVRETLGLIDRAYIAHSGRILTEGTPEQIVANEDARRLYLGEDF 288


>gi|163851923|ref|YP_001639966.1| ABC transporter related [Methylobacterium extorquens PA1]
 gi|163663528|gb|ABY30895.1| ABC transporter related [Methylobacterium extorquens PA1]
          Length = 289

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 146/237 (61%), Positives = 178/237 (75%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
            +L    L K Y +  VV    L V  GE VGLLGPNGAGKTT FYM+TGL+ AD G I 
Sbjct: 51  GVLHVRGLRKSYGARTVVHEAGLTVHNGEAVGLLGPNGAGKTTIFYMITGLVPADRGFIS 110

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG +IT +PMY+RARLGI YLPQEASIFRGLTVE+NI AVLEV E D+K R  KLDSLL
Sbjct: 111 LDGMEITHLPMYQRARLGIGYLPQEASIFRGLTVEDNIRAVLEVAEPDRKARERKLDSLL 170

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EF+I + R   +  LSGG+RRR EIAR+L S P+++LLDEPFAG+DP+A+ DI  L++ 
Sbjct: 171 EEFDIARLRKSPSIALSGGERRRCEIARALASSPTFMLLDEPFAGIDPIAVGDIQDLVKH 230

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L LIDRAYI H+G +L  GT ++I+ N+D RRLYLG+ F
Sbjct: 231 LKQRGIGVLITDHNVRETLGLIDRAYIAHSGRILTEGTPEQIVANEDARRLYLGEDF 287


>gi|240139046|ref|YP_002963521.1| putative ABC transporter, ATPase [Methylobacterium extorquens AM1]
 gi|240009018|gb|ACS40244.1| putative ABC transporter, ATPase [Methylobacterium extorquens AM1]
          Length = 289

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 146/237 (61%), Positives = 178/237 (75%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
            +L    L K Y +  VV    L V  GE VGLLGPNGAGKTT FYM+TGL+ AD G I 
Sbjct: 51  GVLHVRGLRKSYGARTVVHEAGLTVHNGEAVGLLGPNGAGKTTIFYMITGLVPADRGFIS 110

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG +IT +PMY+RARLGI YLPQEASIFRGLTVE+NI AVLEV E D+K R  KLDSLL
Sbjct: 111 LDGMEITHLPMYQRARLGIGYLPQEASIFRGLTVEDNIRAVLEVAEPDRKARERKLDSLL 170

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EF+I + R   +  LSGG+RRR EIAR+L S P+++LLDEPFAG+DP+A+ DI  L++ 
Sbjct: 171 EEFDIARLRKSPSIALSGGERRRCEIARALASSPTFMLLDEPFAGIDPIAVGDIQDLVKH 230

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L LIDRAYI H+G +L  GT ++I+ N+D RRLYLG+ F
Sbjct: 231 LKQRGIGVLITDHNVRETLGLIDRAYIAHSGRILTEGTPEQIVANEDARRLYLGEDF 287


>gi|254561641|ref|YP_003068736.1| ABC transporter ATPase [Methylobacterium extorquens DM4]
 gi|254268919|emb|CAX24880.1| putative ABC transporter, ATPase [Methylobacterium extorquens DM4]
          Length = 289

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 146/237 (61%), Positives = 178/237 (75%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
            +L    L K Y +  VV    L V  GE VGLLGPNGAGKTT FYM+TGL+ AD G I 
Sbjct: 51  GVLHVRGLRKSYGARTVVHEAGLTVHNGEAVGLLGPNGAGKTTIFYMITGLVPADRGFIS 110

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG +IT +PMY+RARLGI YLPQEASIFRGLTVE+NI AVLEV E D+K R  KLDSLL
Sbjct: 111 LDGMEITHLPMYQRARLGIGYLPQEASIFRGLTVEDNIRAVLEVAEPDRKARERKLDSLL 170

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EF+I + R   +  LSGG+RRR EIAR+L S P+++LLDEPFAG+DP+A+ DI  L++ 
Sbjct: 171 EEFDIARLRKSPSIALSGGERRRCEIARALASSPTFMLLDEPFAGIDPIAVGDIQDLVKH 230

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L LIDRAYI H+G +L  GT ++I+ N+D RRLYLG+ F
Sbjct: 231 LKQRGIGVLITDHNVRETLGLIDRAYIAHSGRILTEGTPEQIVANEDARRLYLGEDF 287


>gi|46205066|ref|ZP_00049084.2| COG1137: ABC-type (unclassified) transport system, ATPase component
           [Magnetospirillum magnetotacticum MS-1]
          Length = 238

 Score =  295 bits (755), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 145/236 (61%), Positives = 178/236 (75%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L    L K Y +  VV    L V  GE VGLLGPNGAGKTT FYM+TGL+ AD G I +
Sbjct: 1   MLQVRGLRKSYGARTVVHEAGLTVHNGEAVGLLGPNGAGKTTIFYMITGLVPADRGFISL 60

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           DG +IT +PMY+RARLGI YLPQEASIFRGL+VE+NI AVLEV E D+K R  KLDSLL+
Sbjct: 61  DGMEITHLPMYQRARLGIGYLPQEASIFRGLSVEDNIRAVLEVAEPDRKARERKLDSLLE 120

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+I + R   +  LSGG+RRR EIAR+L S P+++LLDEPFAG+DP+A+ DI  L++ L
Sbjct: 121 EFDIARLRKSPSIALSGGERRRCEIARALASSPTFMLLDEPFAGIDPIAVGDIQDLVKHL 180

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             RGIG+LITDHNV E L LIDRAYI H+G +L  GT ++I+ N+D RRLYLG+ F
Sbjct: 181 KQRGIGVLITDHNVRETLGLIDRAYIAHSGRILTEGTPEQIVANEDARRLYLGEDF 236


>gi|330993405|ref|ZP_08317340.1| putative ABC transporter ATP-binding protein [Gluconacetobacter sp.
           SXCC-1]
 gi|329759435|gb|EGG75944.1| putative ABC transporter ATP-binding protein [Gluconacetobacter sp.
           SXCC-1]
          Length = 263

 Score =  295 bits (754), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 176/237 (74%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  + K Y    VV+ V L V+ GE V LLGPNGAGKTT FYM+ GL+  D G+I +D
Sbjct: 27  LIASGIGKSYKKRQVVRDVSLQVQRGEAVALLGPNGAGKTTSFYMIVGLVRPDMGTITLD 86

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DIT++PMYRRAR+GI YLPQE+SIFRGLTVE+NI+A LE+ E D  +R   LD LL E
Sbjct: 87  GADITQLPMYRRARMGIGYLPQESSIFRGLTVEQNIMAALEIVEPDPDRRQTMLDGLLGE 146

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F IT+ RH  +  LSGG+RRRLEIAR+L S P Y+LLDEP AG+DP+A+ +I  L+  L 
Sbjct: 147 FGITRLRHSSSLALSGGERRRLEIARALASQPHYVLLDEPLAGIDPIAVGEIRDLVAHLK 206

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIG+LITDHNV E L +IDRAYI+H+G VL  G  +EI+ N+DVRR+YLG++F  
Sbjct: 207 DRGIGVLITDHNVRETLEVIDRAYIMHSGQVLTEGRPEEIVANEDVRRVYLGEKFTL 263


>gi|188581680|ref|YP_001925125.1| ABC transporter [Methylobacterium populi BJ001]
 gi|179345178|gb|ACB80590.1| ABC transporter related [Methylobacterium populi BJ001]
          Length = 289

 Score =  294 bits (753), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 145/237 (61%), Positives = 178/237 (75%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
            +L    L K Y +  VV    L V  GE VGLLGPNGAGKTT FYM+TGL+ AD G I 
Sbjct: 51  GVLHVRGLRKSYGARTVVHEAGLTVHNGEAVGLLGPNGAGKTTIFYMITGLVPADRGFIS 110

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG +IT +PMY+RARLGI YLPQEASIFRGL+VE+NI AVLEV E D+K R  KLDSLL
Sbjct: 111 LDGMEITHLPMYQRARLGIGYLPQEASIFRGLSVEDNIRAVLEVAEPDRKTRERKLDSLL 170

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EF+I + R   +  LSGG+RRR EIAR+L S P+++LLDEPFAG+DP+A+ DI  L++ 
Sbjct: 171 EEFDIARLRKSPSIALSGGERRRCEIARALASSPTFMLLDEPFAGIDPIAVGDIQDLVKH 230

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L LIDRAYI H+G +L  GT ++I+ N+D RRLYLG+ F
Sbjct: 231 LKQRGIGVLITDHNVRETLGLIDRAYIAHSGRILTEGTPEQIVANEDARRLYLGEDF 287


>gi|296115071|ref|ZP_06833713.1| ABC transporter ATP-binding protein [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295978408|gb|EFG85144.1| ABC transporter ATP-binding protein [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 268

 Score =  294 bits (753), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 142/237 (59%), Positives = 176/237 (74%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  + K Y    VV+ V L V+ GE VGLLGPNGAGKTT FYM+ GL+  D G+I +D
Sbjct: 32  LIASGIGKSYRKRSVVRDVSLQVQRGEAVGLLGPNGAGKTTSFYMIVGLVRPDIGTITLD 91

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DIT++PMYRRAR+GI YLPQE+SIFRGL VE+NI+A LE+ E D  +R   LD LL E
Sbjct: 92  GADITQLPMYRRARMGIGYLPQESSIFRGLNVEQNIMAALEIVEPDADRRQTMLDGLLGE 151

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F IT+ RH  +  LSGG+RRRLEIAR+L S P YILLDEP AG+DP+A+ +I  L+  L 
Sbjct: 152 FGITRLRHSPSLALSGGERRRLEIARALASQPHYILLDEPLAGIDPIAVGEIRDLVAHLK 211

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIG+LITDHNV E L +IDRAYI+H+G VL  G  +EI+ N+DVRR+YLG++F  
Sbjct: 212 DRGIGVLITDHNVRETLEVIDRAYIMHSGQVLTEGRPEEIVANEDVRRVYLGEKFTL 268


>gi|58040274|ref|YP_192238.1| ABC transporter ATP-binding protein [Gluconobacter oxydans 621H]
 gi|58002688|gb|AAW61582.1| ABC transporter ATP-binding protein [Gluconobacter oxydans 621H]
          Length = 251

 Score =  294 bits (752), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 144/237 (60%), Positives = 176/237 (74%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  + K Y    VVK V L V+ GE VGLLGPNGAGKTT FYM+ GL+  D+G+I +D
Sbjct: 15  LVASGIGKSYKKRAVVKNVSLQVQRGEAVGLLGPNGAGKTTSFYMIVGLVQPDTGTITLD 74

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DIT++PMYRRARLG+ YLPQEASIFRGL VE+NI+A LEV E D +KR   L+ LL E
Sbjct: 75  GADITQLPMYRRARLGVGYLPQEASIFRGLNVEQNIMAALEVVEPDPEKRDLMLNGLLAE 134

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F IT  R   +  LSGG+RRRLEIAR+L S P+YILLDEP AG+DP+A+ +I  L+  L 
Sbjct: 135 FGITHLRRSPSLALSGGERRRLEIARALASQPNYILLDEPLAGIDPIAVGEIRDLVSHLK 194

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIG+LITDHNV E L +IDRAYI+H G VL  GT + I+ N+DVRR+YLG+ F+ 
Sbjct: 195 DRGIGVLITDHNVRETLEVIDRAYIMHGGQVLMEGTPEAIVANEDVRRVYLGENFSL 251


>gi|167648912|ref|YP_001686575.1| ABC transporter-like protein [Caulobacter sp. K31]
 gi|167351342|gb|ABZ74077.1| ABC transporter related [Caulobacter sp. K31]
          Length = 256

 Score =  292 bits (748), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 144/254 (56%), Positives = 188/254 (74%), Gaps = 1/254 (0%)

Query: 8   LGIEMPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTF 67
           +   M     + ++ D L    ++ K +    VVK V L +K GE+ GLLGPNGAGKTT 
Sbjct: 1   MAFSMQSLSVDSSTSDGLF-VDAIGKSFGDRPVVKSVSLRLKRGEVAGLLGPNGAGKTTC 59

Query: 68  FYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV 127
           FYM+TGL+ AD GSI +DG DIT  PM++RAR+G+ YLPQEASIFRG+TVE+N++AV+E+
Sbjct: 60  FYMITGLVAADYGSIYLDGEDITSQPMFQRARMGVGYLPQEASIFRGMTVEQNVMAVVEM 119

Query: 128 YEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFA 187
            +K ++   E++ S+L+E +IT  R   A  LSGG+RRR+EIAR+L S PS++LLDEPFA
Sbjct: 120 RQKSQRAAREQVTSILEELHITHIRKSPAVALSGGERRRVEIARALASEPSFMLLDEPFA 179

Query: 188 GVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIID 247
           G+DP+AI+DI  +I  L  RGIGILITDHNV E L +IDRA IIHAG VL  G+ QEI+D
Sbjct: 180 GIDPLAIADIREVIGYLKGRGIGILITDHNVRETLDIIDRASIIHAGEVLFEGSPQEIVD 239

Query: 248 NQDVRRLYLGDRFA 261
           N +VRR+YLGD FA
Sbjct: 240 NPEVRRVYLGDSFA 253


>gi|114797827|ref|YP_758938.1| ABC transporter ATP-binding protein [Hyphomonas neptunium ATCC
           15444]
 gi|114738001|gb|ABI76126.1| ABC transporter, ATP-binding protein [Hyphomonas neptunium ATCC
           15444]
          Length = 244

 Score =  292 bits (747), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 181/232 (78%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           +L K +    VV+ V L +  GE+VGLLGPNGAGKTT FYM+ GLI ADSGSI IDG D+
Sbjct: 12  NLAKAFGKRQVVRDVSLSLARGEVVGLLGPNGAGKTTCFYMIMGLIGADSGSISIDGEDV 71

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           T++PMY+RARLG+ YLPQEASIFRG+TVEEN+LAV E+ EKD+  R  ++D LL E ++ 
Sbjct: 72  TRLPMYQRARLGVGYLPQEASIFRGMTVEENVLAVAELVEKDRAARMAQVDGLLSELHVE 131

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             R+  A  LSGG+RRR+EIAR+L S PS++LLDEPF G+DP+AISDI  L+R L  RG+
Sbjct: 132 HLRNQPATSLSGGERRRVEIARALASRPSFMLLDEPFTGIDPLAISDISELVRYLKQRGL 191

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
           G+LITDH V E L ++DRAY+++ G VL  GT ++++ N+DVRR+YLG++FA
Sbjct: 192 GVLITDHQVRETLQIVDRAYVMYDGEVLFAGTPEDVLKNEDVRRVYLGEQFA 243


>gi|288956949|ref|YP_003447290.1| ABC transporter ATP-binding protein [Azospirillum sp. B510]
 gi|288909257|dbj|BAI70746.1| ABC transporter ATP-binding protein [Azospirillum sp. B510]
          Length = 264

 Score =  291 bits (746), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 147/243 (60%), Positives = 177/243 (72%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A+    L A  L K +    VV+ V L V+ GE VGLLGPNGAGKTT FYM+TGLI ADS
Sbjct: 22  ATPTEGLVAQHLGKSFKKRPVVRDVSLSVQRGEAVGLLGPNGAGKTTCFYMITGLIAADS 81

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G+I +DG DIT +PMYRRARLGI YLPQEASIFRG+TVE NI +VLEV E D+  R   L
Sbjct: 82  GTITLDGQDITALPMYRRARLGIGYLPQEASIFRGMTVENNIRSVLEVVESDRDAREAML 141

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           D LL EF++T  R   A  LSGG+RRR+EIAR+L   P +ILLDEP AG+DP+A++DI  
Sbjct: 142 DELLAEFSVTHLRRSPALALSGGERRRVEIARALAGQPHFILLDEPLAGIDPIAVNDIRE 201

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L+  L  RGIG+LITDHNV E L L+DRAYI+H G VL  G   EI+ ++ VRR+YLGDR
Sbjct: 202 LVGHLRDRGIGVLITDHNVRETLDLVDRAYILHDGVVLMEGRPDEIVAHEGVRRVYLGDR 261

Query: 260 FAF 262
           F+ 
Sbjct: 262 FSL 264


>gi|154250649|ref|YP_001411473.1| ABC transporter-like protein [Parvibaculum lavamentivorans DS-1]
 gi|154154599|gb|ABS61816.1| ABC transporter related [Parvibaculum lavamentivorans DS-1]
          Length = 267

 Score =  291 bits (746), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 175/232 (75%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K +    VV+GV  +V+ GE VGLLGPNGAGKTT FYM+TGLI  D G+I +DG+D+T
Sbjct: 36  LGKSFKGRPVVRGVSFHVQRGEAVGLLGPNGAGKTTVFYMITGLIQPDYGTISLDGDDVT 95

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITK 150
            +PMYRRAR GI YLPQEASIFRG+TVE+NI AVLEV E D+ +R  +LD LL EF+IT 
Sbjct: 96  GLPMYRRARRGIGYLPQEASIFRGMTVEQNIRAVLEVIEPDRDRREAELDDLLAEFSITH 155

Query: 151 WRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIG 210
            R   +  LSGG+RRR+EIAR+L + PS++LLDEPFAG+DP+AI DI  L+  L  RGIG
Sbjct: 156 LRRTPSIALSGGERRRVEIARALATQPSFMLLDEPFAGIDPIAIGDIRDLVAHLKDRGIG 215

Query: 211 ILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           +LITDHNV E L LID A IIH G VL  G    I+ N+DVRRLYLG+RF+ 
Sbjct: 216 VLITDHNVRETLELIDHAVIIHDGTVLMEGDPSAIVGNEDVRRLYLGERFSL 267


>gi|162147902|ref|YP_001602363.1| ABC transporter ATP-binding protein in rpoN region
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786479|emb|CAP56061.1| putative ABC transporter ATP-binding protein in rpoN region
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 263

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 142/237 (59%), Positives = 175/237 (73%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  + K Y    VV+ V + V  GE VGLLGPNGAGKTT FYM+ GL+  D+G+I +D
Sbjct: 27  LIANGIGKTYKKRPVVRNVSIQVHRGEAVGLLGPNGAGKTTSFYMIVGLVQPDTGAITLD 86

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DIT++PMYRRARLGI YLPQEASIFRGL VE+NI+A LEV E D ++R   LD LL E
Sbjct: 87  GTDITQLPMYRRARLGIGYLPQEASIFRGLNVEQNIMAALEVVEADPERREAMLDGLLGE 146

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F I+  R   +  LSGG+RRRLEIAR+L S P YILLDEP AG+DP+A+ +I  L+  L 
Sbjct: 147 FGISHLRRAPSLALSGGERRRLEIARALASQPHYILLDEPLAGIDPIAVGEIRDLVSHLK 206

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIG+LITDHNV E L +IDRAYI+H+G VL  G  +EI+ N+DVRR+YLG+ F+ 
Sbjct: 207 DRGIGVLITDHNVRETLEVIDRAYIMHSGQVLMEGRPEEIVANEDVRRVYLGENFSL 263


>gi|296533701|ref|ZP_06896254.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Roseomonas cervicalis ATCC 49957]
 gi|296265975|gb|EFH12047.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Roseomonas cervicalis ATCC 49957]
          Length = 259

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 139/242 (57%), Positives = 183/242 (75%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
           + D+ L A  L K+Y    VV+ V L VK GE VGLLGPNGAGKTT FYM+TGL+  D G
Sbjct: 18  AGDAGLVATGLGKRYKKRPVVRNVSLSVKRGEAVGLLGPNGAGKTTTFYMITGLVRPDQG 77

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLD 140
            + +DG+D+T +PMYRRAR+G+ YLPQEASIFRGL++E+NI A LEV E  +++R + LD
Sbjct: 78  QVFMDGHDVTTLPMYRRARMGLGYLPQEASIFRGLSLEDNIRAALEVVEPVRERREQMLD 137

Query: 141 SLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVL 200
           SLL EF +T  R   +  LSGG+RRR EIAR+L + P+Y+LLDEP AG+DP+A+ +I  L
Sbjct: 138 SLLAEFGLTHLRRSPSLALSGGERRRCEIARALATHPAYVLLDEPLAGIDPIAVGEIRDL 197

Query: 201 IRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           ++ L +RGIG+LITDHNV E L +IDRAYI+H G VL  GT Q+I+ ++ VRR+YLG+RF
Sbjct: 198 VKHLKNRGIGVLITDHNVRETLEIIDRAYILHDGQVLMEGTPQDIVAHEGVRRVYLGERF 257

Query: 261 AF 262
           + 
Sbjct: 258 SL 259


>gi|209542519|ref|YP_002274748.1| ABC transporter-like protein [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209530196|gb|ACI50133.1| ABC transporter related [Gluconacetobacter diazotrophicus PAl 5]
          Length = 263

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 142/237 (59%), Positives = 175/237 (73%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  + K Y    VV+ V + V  GE VGLLGPNGAGKTT FYM+ GL+  D+G+I +D
Sbjct: 27  LIANGIGKTYKKRPVVRNVSIQVHRGEAVGLLGPNGAGKTTSFYMIVGLVQPDTGAITLD 86

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DIT++PMYRRARLGI YLPQEASIFRGL VE+NI+A LEV E D ++R   LD LL E
Sbjct: 87  GTDITQLPMYRRARLGIGYLPQEASIFRGLNVEQNIMAALEVVEADPERREAMLDGLLGE 146

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F I+  R   +  LSGG+RRRLEIAR+L S P YILLDEP AG+DP+A+ +I  L+  L 
Sbjct: 147 FGISHLRRAPSLALSGGERRRLEIARALASQPHYILLDEPLAGIDPIAVGEIRDLVSHLK 206

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIG+LITDHNV E L +IDRAYI+H+G VL  G  +EI+ N+DVRR+YLG+ F+ 
Sbjct: 207 DRGIGVLITDHNVRETLEVIDRAYIMHSGQVLMEGRPEEIVANEDVRRVYLGENFSL 263


>gi|209966461|ref|YP_002299376.1| ABC transporter, ATP-binding protein, putative [Rhodospirillum
           centenum SW]
 gi|209959927|gb|ACJ00564.1| ABC transporter, ATP-binding protein, putative [Rhodospirillum
           centenum SW]
          Length = 272

 Score =  290 bits (742), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 145/237 (61%), Positives = 176/237 (74%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y    V++ V L V  GE VGLLGPNGAGKTT FY++TGLI  D GSI +D
Sbjct: 36  LIASKLGKSYKGRPVLRDVSLSVNRGEAVGLLGPNGAGKTTCFYIITGLILPDYGSITLD 95

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G +IT++PMYRRARLGI YLPQEASIFRGL+VE NI AVLEV E D+  R   LD LL E
Sbjct: 96  GTEITELPMYRRARLGIGYLPQEASIFRGLSVENNIRAVLEVVEPDRDTREHMLDELLAE 155

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F+I+  R   A  LSGG+RRR+EIAR+L S P +ILLDEPFAG+DP+A++DI  L+  L 
Sbjct: 156 FSISHLRRTPALALSGGERRRVEIARALASQPHFILLDEPFAGIDPIAVNDIRELVSHLR 215

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIG+LITDHNV E L ++DRAYI+H G VL  G   EI+ ++DVRR+YLG+RF+ 
Sbjct: 216 ERGIGVLITDHNVRETLDIVDRAYILHDGMVLMEGAPSEIVAHKDVRRVYLGERFSL 272


>gi|295691421|ref|YP_003595114.1| ABC transporter-like protein [Caulobacter segnis ATCC 21756]
 gi|295433324|gb|ADG12496.1| ABC transporter related protein [Caulobacter segnis ATCC 21756]
          Length = 252

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 141/232 (60%), Positives = 182/232 (78%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           S+ K +    VVK V L +K GE+ GLLGPNGAGKTT FYM+TGLI AD G+I +DG +I
Sbjct: 15  SVGKSFGDRPVVKNVSLRLKRGEVAGLLGPNGAGKTTCFYMITGLIAADYGAIYLDGENI 74

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           T  PM++RARLG+ YLPQEASIFRG+TVE+N++AV+E+ +KD +K  E++ S+L+E  IT
Sbjct: 75  TAQPMFQRARLGVGYLPQEASIFRGMTVEQNVMAVVEMRQKDARKAREQVTSILEELRIT 134

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             R   A  LSGG+RRR+EIAR+L S PS++LLDEPFAG+DP+AI+DI  ++  L SRGI
Sbjct: 135 HIRKSPAVALSGGERRRVEIARALASEPSFMLLDEPFAGIDPLAIADIREVVGYLKSRGI 194

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
           GILITDHNV E L +IDRA IIHAG VL  G+ +EI+DN +V+R+YLGD F+
Sbjct: 195 GILITDHNVRETLDIIDRASIIHAGEVLFEGSPREIVDNPEVKRVYLGDSFS 246


>gi|329114441|ref|ZP_08243203.1| Putative ABC transporter ATP-binding protein [Acetobacter pomorum
           DM001]
 gi|326696517|gb|EGE48196.1| Putative ABC transporter ATP-binding protein [Acetobacter pomorum
           DM001]
          Length = 275

 Score =  288 bits (738), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 144/237 (60%), Positives = 174/237 (73%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  + K Y    VVK V + V  GE VGLLGPNGAGKTT FYM+ GL+  D+GSI +D
Sbjct: 39  LYARGIGKSYKKREVVKNVSIEVHRGEAVGLLGPNGAGKTTSFYMIVGLVQPDTGSITLD 98

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DIT++PMYRRARLGI YLPQEASIFRGL VE+NILA LEV E D  +R   LD LL E
Sbjct: 99  GADITQLPMYRRARLGIGYLPQEASIFRGLNVEQNILAALEVVEPDPDQRQVMLDGLLSE 158

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F I+  R   +  LSGG+RRRLEIAR+L S P YILLDEP AG+DP+A+ +I  L+  L 
Sbjct: 159 FGISHLRRSPSLALSGGERRRLEIARALASQPHYILLDEPLAGIDPIAVGEIRDLVSHLK 218

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIG+LITDHNV E L +IDRAYI+H+G VL  G  +EI+ ++DVRR+YLG+ F+ 
Sbjct: 219 DRGIGVLITDHNVRETLEVIDRAYIMHSGQVLMQGVPEEIVAHEDVRRVYLGESFSL 275


>gi|296444897|ref|ZP_06886859.1| ABC transporter related protein [Methylosinus trichosporium OB3b]
 gi|296257565|gb|EFH04630.1| ABC transporter related protein [Methylosinus trichosporium OB3b]
          Length = 314

 Score =  288 bits (737), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 141/241 (58%), Positives = 178/241 (73%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A +  +LS   L K Y    VV+ V L+V  GE VGLLGPNGAGKTT FYM+TGL+  D 
Sbjct: 72  ADQQGVLSIRHLAKSYKQRRVVEDVSLHVARGEAVGLLGPNGAGKTTVFYMITGLVKPDK 131

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G I +DG D+T +PMYRRARLGI YLPQEASIFRGL+VE+NI AVLE+ + D+++R  +L
Sbjct: 132 GVIALDGYDVTGLPMYRRARLGIGYLPQEASIFRGLSVEDNIRAVLEITQPDRREREREL 191

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           D+LL+EF + + R   A  LSGG+RRR EIAR+L   PS++LLDEPFAG+DP+A+  I  
Sbjct: 192 DALLEEFKLERLRQSPAIALSGGERRRCEIARALAGRPSFMLLDEPFAGIDPIAVGGIQD 251

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L+R L  RGIG+LITDH+V E L L DRAYII+ G VL  G  +EI+ + DVRR+YLG+ 
Sbjct: 252 LVRHLKKRGIGVLITDHSVRETLGLTDRAYIIYNGHVLTEGAPEEIVADPDVRRIYLGED 311

Query: 260 F 260
           F
Sbjct: 312 F 312


>gi|258541776|ref|YP_003187209.1| ABC transporter ATP-binding protein [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632854|dbj|BAH98829.1| ABC transporter ATP-binding protein [Acetobacter pasteurianus IFO
           3283-01]
 gi|256635911|dbj|BAI01880.1| ABC transporter ATP-binding protein [Acetobacter pasteurianus IFO
           3283-03]
 gi|256638966|dbj|BAI04928.1| ABC transporter ATP-binding protein [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642020|dbj|BAI07975.1| ABC transporter ATP-binding protein [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645075|dbj|BAI11023.1| ABC transporter ATP-binding protein [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648130|dbj|BAI14071.1| ABC transporter ATP-binding protein [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651183|dbj|BAI17117.1| ABC transporter ATP-binding protein [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654174|dbj|BAI20101.1| ABC transporter ATP-binding protein [Acetobacter pasteurianus IFO
           3283-12]
          Length = 273

 Score =  287 bits (735), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 144/237 (60%), Positives = 173/237 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  + K Y    VVK V + V  GE VGLLGPNGAGKTT FYM+ GL+  D+GSI +D
Sbjct: 37  LYARGIGKSYKKREVVKNVSIEVHRGEAVGLLGPNGAGKTTSFYMIVGLVQPDTGSITLD 96

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DIT++PMYRRARLGI YLPQEASIFRGL VE+NILA LEV E D  +R   LD LL E
Sbjct: 97  GADITQLPMYRRARLGIGYLPQEASIFRGLNVEQNILAALEVVEPDPDQRQVMLDGLLSE 156

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F I   R   +  LSGG+RRRLEIAR+L S P YILLDEP AG+DP+A+ +I  L+  L 
Sbjct: 157 FGIGHLRRSPSLALSGGERRRLEIARALASQPHYILLDEPLAGIDPIAVGEIRDLVSHLK 216

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIG+LITDHNV E L +IDRAYI+H+G VL  G  +EI+ ++DVRR+YLG+ F+ 
Sbjct: 217 DRGIGVLITDHNVRETLEVIDRAYIMHSGQVLMQGVPEEIVAHEDVRRVYLGESFSL 273


>gi|114568660|ref|YP_755340.1| ABC transporter-like protein [Maricaulis maris MCS10]
 gi|114339122|gb|ABI64402.1| ABC transporter related protein [Maricaulis maris MCS10]
          Length = 253

 Score =  287 bits (734), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 146/254 (57%), Positives = 182/254 (71%), Gaps = 1/254 (0%)

Query: 8   LGIEMPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTF 67
           + I  P  +   AS   L+    + K Y    VVKGV + ++ GE+ GLLGPNGAGKTT 
Sbjct: 1   MAITEPTPRTETASAGGLVVE-QIGKAYRKRPVVKGVSVSLQRGEVAGLLGPNGAGKTTC 59

Query: 68  FYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV 127
           FYM+TGL+ AD G I +DG DIT++PMY+RARLGI YLPQE SIF G+TVE+N+LAV EV
Sbjct: 60  FYMITGLVEADYGRILLDGEDITRLPMYQRARLGIGYLPQEKSIFHGMTVEQNVLAVAEV 119

Query: 128 YEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFA 187
            EKD+  RH  +D LL++  I+  R   AP LSGG+RRR+EIAR+L + PS++LLDEPFA
Sbjct: 120 VEKDRDARHALVDQLLEDLRISHLREAPAPSLSGGERRRMEIARALATRPSFMLLDEPFA 179

Query: 188 GVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIID 247
           G+DP+AI+DI  LIR L  RGIGILITDHNV E L + DRA IIH G VL  G+  EI  
Sbjct: 180 GIDPLAITDIRDLIRFLKERGIGILITDHNVRETLEITDRATIIHEGEVLFEGSPAEIRA 239

Query: 248 NQDVRRLYLGDRFA 261
           + DVRR+YLG+ F 
Sbjct: 240 DPDVRRVYLGESFG 253


>gi|310817099|ref|YP_003965063.1| ABC transporter, ATP-binding protein [Ketogulonicigenium vulgare
           Y25]
 gi|308755834|gb|ADO43763.1| ABC transporter, ATP-binding protein [Ketogulonicigenium vulgare
           Y25]
          Length = 250

 Score =  287 bits (734), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 136/232 (58%), Positives = 173/232 (74%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K Y    V++ V L ++ GE+V LLGPNG+GKTT FY + GL+ AD G + +DG D+T
Sbjct: 18  LRKSYRRRTVIRDVSLRLERGEVVALLGPNGSGKTTCFYAIAGLVQADDGQVSLDGRDVT 77

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITK 150
            +PMYRRARLGI YLPQE SIFRG++VE+NI+A+LE+ E D  +R EKL+ LL EF+IT 
Sbjct: 78  NLPMYRRARLGIGYLPQEMSIFRGMSVEDNIMAILEIAEPDHARRREKLEELLAEFSITH 137

Query: 151 WRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIG 210
            R   A  LSGG+RRR EIAR L + PSY+LLDEP+AGVDP+A+++I  L+  L +RGIG
Sbjct: 138 IRRSPALALSGGERRRAEIARCLAAGPSYVLLDEPYAGVDPIAVAEIRALVAQLKTRGIG 197

Query: 211 ILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           +LITDHNV E L ++DRAYI+H G VL  GT  EII N DVRR+YLG  F+ 
Sbjct: 198 VLITDHNVRETLEIVDRAYILHDGQVLMSGTTAEIIANDDVRRVYLGADFSM 249


>gi|163794944|ref|ZP_02188913.1| ABC-type (unclassified) transport system, ATPase component [alpha
           proteobacterium BAL199]
 gi|159179763|gb|EDP64290.1| ABC-type (unclassified) transport system, ATPase component [alpha
           proteobacterium BAL199]
          Length = 266

 Score =  286 bits (733), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 180/237 (75%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A ++ K +    V++ V + V+ GE VGLLGPNGAGKTT FY++TGLI AD+GS+ +D
Sbjct: 30  LVARNIGKSFKKRPVLRDVSVNVRRGEAVGLLGPNGAGKTTCFYVITGLISADAGSVALD 89

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           GND+T +PMYRRARLGI YLPQEASIFRGLTVE+NI AVLEV E +  +R   LD LL E
Sbjct: 90  GNDVTDLPMYRRARLGIGYLPQEASIFRGLTVEQNIRAVLEVVEPNANRRDAMLDDLLAE 149

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F+I+  R   +  LSGG+RRR+EIAR+L S P++ILLDEP AG+DP+A+S+I  LI  L 
Sbjct: 150 FSISHLRRTPSLALSGGERRRVEIARALASQPNFILLDEPLAGIDPIAVSEIRDLISHLT 209

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RG+G+LITDHNV E L ++DRAYI+H G VL  G   +I+ ++DVRR YLG+RF+ 
Sbjct: 210 DRGLGVLITDHNVRETLDIVDRAYILHDGMVLMEGAPGDIVAHRDVRRFYLGERFSL 266


>gi|163733022|ref|ZP_02140466.1| ABC transporter, ATP-binding protein, putative [Roseobacter
           litoralis Och 149]
 gi|161393557|gb|EDQ17882.1| ABC transporter, ATP-binding protein, putative [Roseobacter
           litoralis Och 149]
          Length = 252

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 131/230 (56%), Positives = 173/230 (75%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K Y    V++   + +  GE+V LLGPNG+GKTT FY + GL+  + GS++IDG D+T
Sbjct: 20  LRKSYRKKTVIRDFSMELDRGEVVALLGPNGSGKTTTFYAIAGLVTPEGGSVRIDGQDVT 79

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITK 150
             PMYRRA+LGI YLPQE SIFRGL+V++NI A+L++ E D+ KR E+L+ LL EF+I  
Sbjct: 80  TFPMYRRAQLGIGYLPQEMSIFRGLSVQDNIAAILDITESDRHKRRERLEELLSEFSIEH 139

Query: 151 WRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIG 210
            R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+++ DI  L+ DL  RGIG
Sbjct: 140 LRRAPALALSGGERRRVEIARCLAANPRYLLLDEPFAGVDPISVDDIRTLVSDLKKRGIG 199

Query: 211 ILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +LITDHNV E L ++DRAYI+H G VL  GT Q+++DN++VRR+YLGD+F
Sbjct: 200 VLITDHNVRETLEIVDRAYILHEGKVLMSGTPQDVVDNENVRRVYLGDKF 249


>gi|304320836|ref|YP_003854479.1| putative ATP-binding protein [Parvularcula bermudensis HTCC2503]
 gi|303299738|gb|ADM09337.1| putative ATP-binding protein [Parvularcula bermudensis HTCC2503]
          Length = 261

 Score =  286 bits (732), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 138/231 (59%), Positives = 178/231 (77%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           +L K++    VV  V  +V  GE VGLLGPNGAGKTT FYM+TGL+ AD G+I +DG+D+
Sbjct: 29  NLQKRFRRRQVVNHVSFHVSRGEAVGLLGPNGAGKTTCFYMVTGLLPADGGTITLDGHDV 88

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           T +PMY+RA+LGI YLPQEASIFRGLTVE+N+LAV+E+  K +  + E   SLL+EF I 
Sbjct: 89  THLPMYQRAKLGIGYLPQEASIFRGLTVEQNLLAVVELAHKGRATQREVTHSLLEEFGIA 148

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             R   A  LSGG+RRRLEIAR++ + P Y+LLDEPFAG+DP+AI+DI  L+  L +RG+
Sbjct: 149 HVRDSAATALSGGERRRLEIARAVATGPDYMLLDEPFAGIDPLAIADIRELVAHLTARGL 208

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           G+LITDHNV E L +IDRAYIIH G VL+ GT Q+++ N+DVRR+YLG+ F
Sbjct: 209 GVLITDHNVRETLDIIDRAYIIHRGEVLSEGTPQDLVVNEDVRRVYLGETF 259


>gi|323135856|ref|ZP_08070939.1| ABC transporter related protein [Methylocystis sp. ATCC 49242]
 gi|322398947|gb|EFY01466.1| ABC transporter related protein [Methylocystis sp. ATCC 49242]
          Length = 332

 Score =  286 bits (732), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 146/236 (61%), Positives = 182/236 (77%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           LLS  +L K Y +  VV+ V L+VK GE VGLLGPNGAGKTT FYM+TGL+  D G I +
Sbjct: 95  LLSVHNLAKSYKARRVVEDVSLHVKRGEAVGLLGPNGAGKTTVFYMITGLVKPDRGVISL 154

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           DG D+T +PMYRRARLGI YLPQEAS+FRGL+VE+NI AVLE+ + D+KKR E+L++LL 
Sbjct: 155 DGYDVTPLPMYRRARLGIGYLPQEASVFRGLSVEDNIRAVLEITQPDEKKREEELEALLD 214

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF +T+ RH  A  LSGG+RRR EIAR+L   PS++LLDEPFAG+DP+A+  I  L+R L
Sbjct: 215 EFRLTRMRHTPAVALSGGERRRCEIARALAGHPSFMLLDEPFAGIDPIAVGGIQDLVRHL 274

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            +RGIG+LITDH+V E L L DRAYII+ G VL  G  +EI+ N DVRR+YLG+ F
Sbjct: 275 KARGIGVLITDHSVRETLGLTDRAYIIYNGHVLTEGPPEEIVANPDVRRIYLGEDF 330


>gi|21328700|gb|AAM48706.1| ABC transporter, ATP-binding protein [uncultured marine
           proteobacterium]
          Length = 252

 Score =  285 bits (730), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 176/231 (76%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           SL K Y    V+  V +++  GE+V LLGPNG+GKTT FY + GL+  + G + IDG D+
Sbjct: 19  SLRKSYRKRLVISDVSMHLHRGEVVALLGPNGSGKTTCFYSIAGLVTPEGGRVSIDGRDV 78

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           T++PMYRRARLGI YLPQE SIFRG+ VE+NILAVLE+  KD+ +R E+L+ LL EF+I 
Sbjct: 79  TRLPMYRRARLGIGYLPQETSIFRGMNVEDNILAVLELSMKDRVRRFERLEELLNEFSIE 138

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             R   A  LSGGQRRR+EIAR L + P Y+LLDEPFAGVDP+A+++I  L+ DL +RG+
Sbjct: 139 HLRRSPALALSGGQRRRVEIARCLAANPKYLLLDEPFAGVDPIAVAEIRNLVSDLKNRGL 198

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           G+LITDHNV E L ++DRAYI+H G VL  GT QEI+++++VRR+YLG+ F
Sbjct: 199 GVLITDHNVRETLDIVDRAYILHDGVVLRSGTAQEIVEDENVRRVYLGENF 249


>gi|148260670|ref|YP_001234797.1| ABC transporter related [Acidiphilium cryptum JF-5]
 gi|326403864|ref|YP_004283946.1| putative ABC transporter ATP-binding protein [Acidiphilium
           multivorum AIU301]
 gi|146402351|gb|ABQ30878.1| ABC transporter related protein [Acidiphilium cryptum JF-5]
 gi|325050726|dbj|BAJ81064.1| putative ABC transporter ATP-binding protein [Acidiphilium
           multivorum AIU301]
          Length = 264

 Score =  285 bits (730), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 139/235 (59%), Positives = 173/235 (73%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K +    VV+ V + ++ GE VGLLGPNGAGKTT FYM+ GLI  DSGSI +D
Sbjct: 28  LVARGLGKSFRKRPVVRNVSVTLRRGEAVGLLGPNGAGKTTTFYMIVGLIQPDSGSIMLD 87

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DI+ +PMYRRARLGI YLPQEAS+FRGLTVE+NI A LEV E D  +R   LD+LL E
Sbjct: 88  GADISTLPMYRRARLGIGYLPQEASVFRGLTVEQNITAALEVVENDPDRREAMLDALLAE 147

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F I+  R   A  LSGG+RRR+EIAR+L + PSYILLDEP AG+DP+A+ +I  ++  L 
Sbjct: 148 FGISHLRRTPALALSGGERRRVEIARALATGPSYILLDEPLAGIDPIAVGEIRDMVAQLK 207

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            RG+G++ITDHNV E L +IDRAYI+H G VL  G   E++ + +VRR+YLGDRF
Sbjct: 208 QRGLGVVITDHNVRETLEVIDRAYILHEGHVLMEGAPDEVVAHPEVRRVYLGDRF 262


>gi|149912955|ref|ZP_01901489.1| ABC transporter, ATP-binding protein, putative [Roseobacter sp.
           AzwK-3b]
 gi|149813361|gb|EDM73187.1| ABC transporter, ATP-binding protein, putative [Roseobacter sp.
           AzwK-3b]
          Length = 252

 Score =  285 bits (728), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 181/249 (72%)

Query: 12  MPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMM 71
           MP+   + A +   L   +L K Y    V++ V + ++ GE+V LLGPNG+GKTT FY +
Sbjct: 1   MPKPDLHIAHESKGLEVRNLRKSYKRRMVIRDVSMSLRQGEVVALLGPNGSGKTTTFYAI 60

Query: 72  TGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD 131
            GL+  + G + IDG ++T +PMYRRA+LGI YLPQE SIFRGL+VE+NILA+L++ E D
Sbjct: 61  AGLVQPEGGHVLIDGQEVTNLPMYRRAKLGIGYLPQEMSIFRGLSVEDNILAILDISEAD 120

Query: 132 KKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDP 191
           + KR E+L+ LL EF+I   R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP
Sbjct: 121 RHKRRERLEELLSEFSIEHLRRAPALALSGGERRRVEIARCLAAHPKYLLLDEPFAGVDP 180

Query: 192 VAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDV 251
           +++ DI  L+ DL  RGIG+LITDHNV E L ++DRAYI+H G VL  GT  E+++N++V
Sbjct: 181 ISVGDIRHLVADLKKRGIGVLITDHNVRETLEIVDRAYILHDGKVLMSGTPAEVVENENV 240

Query: 252 RRLYLGDRF 260
           RR+YLGD F
Sbjct: 241 RRVYLGDNF 249


>gi|85705768|ref|ZP_01036865.1| ABC transporter, ATP-binding protein [Roseovarius sp. 217]
 gi|85669758|gb|EAQ24622.1| ABC transporter, ATP-binding protein [Roseovarius sp. 217]
          Length = 252

 Score =  285 bits (728), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 135/241 (56%), Positives = 181/241 (75%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A +++ L   +L K Y    V++ V L +K GE+V LLGPNG+GKTT FY + GLI  + 
Sbjct: 9   AHENAGLVVENLRKSYRKRLVIRDVSLSLKQGEVVALLGPNGSGKTTTFYAIAGLIYPEG 68

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G I IDG D+T +PMYRRA+LGI YLPQE SIFRGL+VE+NILA+L++ E+D+ KR E+L
Sbjct: 69  GHIHIDGQDVTSLPMYRRAKLGIGYLPQEMSIFRGLSVEDNILAILDIAERDRHKRRERL 128

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL +F+I   R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+++ DI  
Sbjct: 129 EELLSDFSIEHLRRAPALALSGGERRRVEIARCLAANPRYLLLDEPFAGVDPISVGDIRH 188

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L+ DL  RGIG+LITDHNV E L ++DRAYI+H G VL  G+ +++++N++VRR+YLGD 
Sbjct: 189 LVADLKKRGIGVLITDHNVRETLEIVDRAYILHDGKVLMSGSPRDVVENENVRRVYLGDT 248

Query: 260 F 260
           F
Sbjct: 249 F 249


>gi|83591351|ref|YP_425103.1| ABC transporter protein [Rhodospirillum rubrum ATCC 11170]
 gi|83574265|gb|ABC20816.1| ABC transporter component [Rhodospirillum rubrum ATCC 11170]
          Length = 288

 Score =  285 bits (728), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 175/237 (73%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L+A  L K++    V++ V L V+ GE VGLLGPNGAGKTT FY +TGLI  D GSI +D
Sbjct: 52  LAAVGLGKRFKKRRVLRDVSLSVQRGEAVGLLGPNGAGKTTCFYCVTGLITPDEGSIYLD 111

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G D+T +PMYRRARLGI YLPQEASIFRGL+VE+N+L VLEV E D + R E+L++LL E
Sbjct: 112 GADVTTLPMYRRARLGIGYLPQEASIFRGLSVEQNVLGVLEVVEPDPEIRREELETLLSE 171

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F+I   RH  A  LSGG+RRR EIAR+L S P +ILLDEP AG+DP+A+ +I  L+  L 
Sbjct: 172 FSIAHLRHSPAMALSGGERRRAEIARALASRPGFILLDEPLAGIDPIAVGEIRDLVAHLK 231

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RG+G+LITDHNV E L ++DRAYI+H G V+  G    I+ ++ VRR+YLGD F+ 
Sbjct: 232 DRGLGVLITDHNVRETLEIVDRAYILHEGTVMMEGPPSAIVVHEGVRRVYLGDHFSL 288


>gi|16127830|ref|NP_422394.1| ABC transporter ATP-binding protein [Caulobacter crescentus CB15]
 gi|221236650|ref|YP_002519087.1| ABC transporter ATP-binding protein [Caulobacter crescentus NA1000]
 gi|13425346|gb|AAK25562.1| ABC transporter, ATP-binding protein [Caulobacter crescentus CB15]
 gi|220965823|gb|ACL97179.1| ABC transporter ATP-binding protein [Caulobacter crescentus NA1000]
          Length = 252

 Score =  285 bits (728), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 180/231 (77%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           S+ K +    VVK V L +K GE+ GLLGPNGAGKTT FYM+TGLI AD G+I +DG +I
Sbjct: 15  SVGKSFGDRPVVKNVSLRLKRGEVAGLLGPNGAGKTTCFYMVTGLIAADYGAIYLDGENI 74

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           T  PM++RARLG+ YLPQEASIFRG+TVE+N++AV+E+ E+D +K  E++ S+L+E  IT
Sbjct: 75  TAQPMFQRARLGVGYLPQEASIFRGMTVEQNVMAVVEMRERDPRKAREQVTSILEELRIT 134

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             R   A  LSGG+RRR+EIAR+L S PS++LLDEPFAG+DP+AI+DI  +I  L  RGI
Sbjct: 135 HIRKSPAVALSGGERRRVEIARALASEPSFMLLDEPFAGIDPLAIADIREVIGYLKGRGI 194

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           GILITDHNV E L +IDRA IIHAG VL  G+ +EI++N +V+R+YLG+ F
Sbjct: 195 GILITDHNVRETLDIIDRASIIHAGEVLFEGSPREIVENPEVKRVYLGESF 245


>gi|114327361|ref|YP_744518.1| ABC transporter ATP-binding protein [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315535|gb|ABI61595.1| ABC transporter ATP-binding protein [Granulibacter bethesdensis
           CGDNIH1]
          Length = 280

 Score =  284 bits (727), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 137/237 (57%), Positives = 173/237 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L+A  + K Y    VV+ V ++V+ GE VGLLGPNGAGKTT FYM+ GL+  D+GSI++D
Sbjct: 44  LAAIGVGKTYKKRPVVRNVSVFVQRGEAVGLLGPNGAGKTTTFYMIVGLVRPDTGSIQLD 103

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G+DIT +PMYRRARLGI YLPQEASIFRGL VE+NI+A LEV E ++  R   L  LL E
Sbjct: 104 GSDITGLPMYRRARLGIGYLPQEASIFRGLNVEQNIMAALEVVESNRTTREHMLAELLSE 163

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F I   R   A  LSGG+RRRLEIAR+L + P YILLDEP AG+DP+A+ +I  L+  L 
Sbjct: 164 FGIGHLRRTPALALSGGERRRLEIARALATQPGYILLDEPLAGIDPIAVGEIRDLVGHLK 223

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIG+LITDHNV E L +IDRAYI+H G +L  G   E++ ++ VRR+YLG+ F+ 
Sbjct: 224 QRGIGVLITDHNVRETLEVIDRAYILHGGQLLMEGAPHEVVQHEGVRRVYLGESFSL 280


>gi|149201447|ref|ZP_01878422.1| ABC transporter, ATP-binding protein [Roseovarius sp. TM1035]
 gi|149145780|gb|EDM33806.1| ABC transporter, ATP-binding protein [Roseovarius sp. TM1035]
          Length = 252

 Score =  284 bits (726), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 135/241 (56%), Positives = 181/241 (75%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A + + L   +L K Y    V++ V L ++ GE+V LLGPNG+GKTT FY + GLI  + 
Sbjct: 9   AHESTGLVVENLRKSYRKRLVIRDVTLTLRQGEVVALLGPNGSGKTTTFYAIAGLIYPEG 68

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G I+IDG D+T +PMYRRA+LGI YLPQE SIFRGL+VE+NILA+L++ EKD+ KR E+L
Sbjct: 69  GHIRIDGRDVTGLPMYRRAKLGIGYLPQEMSIFRGLSVEDNILAILDIAEKDRHKRRERL 128

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL +F+I   R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+++ DI  
Sbjct: 129 EELLSDFSIEHLRRAPALALSGGERRRVEIARCLAANPRYLLLDEPFAGVDPISVGDIRH 188

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L+ DL  RGIG+LITDHNV E L ++DRAYI+H G VL  G+ +++++N++VRR+YLGD 
Sbjct: 189 LVADLKKRGIGVLITDHNVRETLEIVDRAYILHDGKVLMSGSPRDVVENENVRRVYLGDS 248

Query: 260 F 260
           F
Sbjct: 249 F 249


>gi|46201481|ref|ZP_00054958.2| COG1137: ABC-type (unclassified) transport system, ATPase component
           [Magnetospirillum magnetotacticum MS-1]
          Length = 265

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 177/237 (74%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A ++ K +    V++ V + V+ GE VGLLGPNGAGKTT FY +TGLI  D+GSI +D
Sbjct: 29  LLAQNIGKSFKGRPVLRDVSISVQRGEAVGLLGPNGAGKTTCFYCITGLINPDTGSISLD 88

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G +IT +PMYRRARLGI YLPQEASIFRGL+VE NI+AVLEV E D ++R   L+SL+ E
Sbjct: 89  GTEITDLPMYRRARLGIGYLPQEASIFRGLSVEGNIMAVLEVVEPDLERRQHDLESLMAE 148

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F+I+  R   A  LSGG+RRR+EIAR+L   P +ILLDEP AG+DP+A+SDI  L+  L 
Sbjct: 149 FSISHLRRAPAMALSGGERRRVEIARALACRPHFILLDEPLAGIDPIAVSDIRDLVSHLK 208

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIG+LITDHNV E L LIDRAYI+H G VL  G   EI+ ++ VRR+YLG+RF+ 
Sbjct: 209 HRGIGVLITDHNVRETLDLIDRAYILHDGAVLMEGRPAEIVAHEGVRRVYLGERFSM 265


>gi|260577294|ref|ZP_05845267.1| ABC transporter related protein [Rhodobacter sp. SW2]
 gi|259020475|gb|EEW23798.1| ABC transporter related protein [Rhodobacter sp. SW2]
          Length = 253

 Score =  283 bits (723), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 174/238 (73%)

Query: 23  DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSI 82
           D+ L    L K Y    V++ V +++  GE+V LLGPNG+GKTT FY + GL+  + G +
Sbjct: 13  DAGLHIRHLRKSYKRRPVIRDVSMHLNRGEVVALLGPNGSGKTTCFYAIAGLVTPEGGQV 72

Query: 83  KIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSL 142
            IDG D+T +PMYRRARLGI YLPQE SIFRGL+VE+NILAVLE+   D+ KR E+L+ L
Sbjct: 73  LIDGRDVTALPMYRRARLGIGYLPQEVSIFRGLSVEDNILAVLEIALPDRHKRRERLEEL 132

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EF+IT  R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+A+ +I  L+ 
Sbjct: 133 LSEFSITHLRRAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDPIAVGEIRTLVH 192

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           DL SRGIG+LITDHNV E L ++DRAYI+H G VL  GT  E++ ++ VRR+YLG  F
Sbjct: 193 DLKSRGIGVLITDHNVRETLEIVDRAYILHDGKVLMSGTTDEVVRDETVRRVYLGQNF 250


>gi|21674713|ref|NP_662778.1| ABC transporter, ATP-binding protein [Chlorobium tepidum TLS]
 gi|21647922|gb|AAM73120.1| ABC transporter, ATP-binding protein [Chlorobium tepidum TLS]
          Length = 247

 Score =  282 bits (722), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 173/239 (72%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+LS  +L K YN   VVK   L VK GEIVGLLGPNGAGKTT FYM+ GL+  D+G + 
Sbjct: 6   SILSCTNLKKVYNKREVVKSSTLEVKQGEIVGLLGPNGAGKTTTFYMIVGLVKPDAGQVL 65

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +D  +ITK+PMY+RAR GI YLPQEAS+FR LTVE+NIL VLE     K +R EK + +L
Sbjct: 66  LDQEEITKLPMYKRARKGIGYLPQEASVFRKLTVEQNILGVLEFTTLSKAERQEKTEQML 125

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           ++ NI   R+ +   LSGG+RRR EIAR+L   P +ILLDEPFAGVDP+A+ DI  ++ D
Sbjct: 126 EDLNIAHIRNSMGYALSGGERRRTEIARALALDPRFILLDEPFAGVDPIAVEDIQQIVED 185

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  R IG+LITDHNVHE L++ D AY++  G +  HGT +EI +N + R+LYLG++F+ 
Sbjct: 186 LVKRNIGVLITDHNVHETLSITDHAYLLFDGSIFMHGTPEEIAENTEARKLYLGEKFSL 244


>gi|83944934|ref|ZP_00957300.1| ABC transporter, ATP-binding protein [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851716|gb|EAP89571.1| ABC transporter, ATP-binding protein [Oceanicaulis alexandrii
           HTCC2633]
          Length = 252

 Score =  282 bits (722), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 143/231 (61%), Positives = 171/231 (74%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           +L K Y    VVK V L +K GE+VGLLGPNGAGKTT FYM+TGL+ AD G I +DG DI
Sbjct: 22  NLGKSYGKRTVVKNVSLSLKRGEVVGLLGPNGAGKTTCFYMITGLVSADHGRIMLDGEDI 81

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           T  PMY+RARLGI YLPQEASIFRGL+V ENI AV E+ E D K+R   +D LL E +I 
Sbjct: 82  TGFPMYQRARLGIGYLPQEASIFRGLSVGENIAAVAEIVEPDSKRRDTLVDELLDELHIG 141

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             RH  A  LSGG+RRR+EIAR+L + PS++LLDEPFAG+DP+AI+DI  L+  L  RGI
Sbjct: 142 HLRHSPAMALSGGERRRVEIARALAAQPSFMLLDEPFAGIDPLAIADIRDLVDYLKQRGI 201

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           GILITDHNV E L + DRA IIH G VL  G  + + ++QDVRR YLG+RF
Sbjct: 202 GILITDHNVRETLEITDRATIIHDGEVLFEGAPEAVRNDQDVRRYYLGERF 252


>gi|110677770|ref|YP_680777.1| ABC transporter, ATP-binding protein, putative [Roseobacter
           denitrificans OCh 114]
 gi|109453886|gb|ABG30091.1| ABC transporter, ATP-binding protein, putative [Roseobacter
           denitrificans OCh 114]
          Length = 252

 Score =  281 bits (720), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 172/230 (74%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K Y    V++   + +  GE+V LLGPNG+GKTT FY + GL+  + GS++IDG D+T
Sbjct: 20  LRKSYRKKTVIRDFSMELDRGEVVALLGPNGSGKTTTFYAIAGLVTPEGGSVQIDGQDVT 79

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITK 150
             PMYRRA+LGI YLPQE SIFRGL+V++NI A+L++ E D+ KR E+L+ LL EF+I  
Sbjct: 80  TFPMYRRAQLGIGYLPQEMSIFRGLSVQDNIAAILDITEPDRHKRRERLEELLSEFSIEH 139

Query: 151 WRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIG 210
            R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+++ DI  L+ DL  R IG
Sbjct: 140 LRRAPALALSGGERRRVEIARCLAANPRYLLLDEPFAGVDPISVDDIRTLVADLKKRSIG 199

Query: 211 ILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +LITDHNV E L ++DRAYI+H G VL  GT Q++++N++VRR+YLGD+F
Sbjct: 200 VLITDHNVRETLEIVDRAYILHEGKVLMSGTPQDVVENENVRRVYLGDKF 249


>gi|126724656|ref|ZP_01740499.1| ABC transporter, ATPase subunit [Rhodobacterales bacterium
           HTCC2150]
 gi|126705820|gb|EBA04910.1| ABC transporter, ATPase subunit [Rhodobacterales bacterium
           HTCC2150]
          Length = 253

 Score =  281 bits (720), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 174/235 (74%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L   +L K Y    V++ V L +  GE+V LLGPNG+GKTT FY + GL+  + G + ID
Sbjct: 16  LKVSNLRKSYKRRPVIRDVSLELGRGEVVALLGPNGSGKTTCFYSIAGLVTPEGGEVLID 75

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G D+T +PMYRRA++GI YLPQE SIFRGL+VE+NILAVLE+ EK+K KR  +L+ LL E
Sbjct: 76  GQDVTLLPMYRRAKMGIGYLPQEVSIFRGLSVEDNILAVLEITEKNKTKRRARLEELLNE 135

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F+I+  R   A  LSGG+RRR+EIAR L S P Y+LLDEPFAGVDP+A+ +I  L+  L 
Sbjct: 136 FSISHLRQAAALSLSGGERRRVEIARCLASDPKYLLLDEPFAGVDPIAVGEIRGLVGQLK 195

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +RGIG+LITDHNV E L ++DRAYI+H G VL +GT  E++ +Q+VRR+YLG  F
Sbjct: 196 NRGIGVLITDHNVRETLEIVDRAYILHDGTVLMNGTADEVVADQNVRRVYLGQNF 250


>gi|84514854|ref|ZP_01002217.1| ABC transporter, ATP-binding protein [Loktanella vestfoldensis
           SKA53]
 gi|84511013|gb|EAQ07467.1| ABC transporter, ATP-binding protein [Loktanella vestfoldensis
           SKA53]
          Length = 247

 Score =  281 bits (720), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 179/240 (74%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
           + D  L   SL K Y    V++ V + +  GE+V LLGPNG+GKTT FY + GL+  + G
Sbjct: 5   TGDVGLQVISLRKSYRKRPVIRDVSITLGRGEVVALLGPNGSGKTTCFYAIAGLVAPEGG 64

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLD 140
            + IDG D+T +PMYRRA+LGI YLPQE SIFRG++VE+NI+++LE+  KD+ +R E+L+
Sbjct: 65  KVIIDGRDVTTLPMYRRAQLGIGYLPQEMSIFRGMSVEDNIMSILEIAVKDRHQRRERLE 124

Query: 141 SLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVL 200
           +LL EF+I   R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+A+++I  L
Sbjct: 125 TLLSEFSIEHLRRASAMALSGGERRRVEIARCLAAGPKYVLLDEPFAGVDPIAVAEIRHL 184

Query: 201 IRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           + DL +RGIG+LITDHNV E L ++DRAYI+H G VL  GT Q+++ +++VRR+YLG+ F
Sbjct: 185 VADLKNRGIGVLITDHNVQETLQIVDRAYILHDGKVLMSGTTQDVVQDENVRRVYLGNNF 244


>gi|77464737|ref|YP_354241.1| ABC transporter, ATPase subunit [Rhodobacter sphaeroides 2.4.1]
 gi|126463577|ref|YP_001044691.1| ABC transporter related [Rhodobacter sphaeroides ATCC 17029]
 gi|332559630|ref|ZP_08413952.1| ABC transporter related protein [Rhodobacter sphaeroides WS8N]
 gi|77389155|gb|ABA80340.1| ABC transporter, ATPase subunit [Rhodobacter sphaeroides 2.4.1]
 gi|126105241|gb|ABN77919.1| ABC transporter related [Rhodobacter sphaeroides ATCC 17029]
 gi|332277342|gb|EGJ22657.1| ABC transporter related protein [Rhodobacter sphaeroides WS8N]
          Length = 253

 Score =  281 bits (720), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 134/237 (56%), Positives = 173/237 (72%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L    L K Y    V++ V +++  GE+V LLGPNG+GKTT FY + GL+  + G + 
Sbjct: 14  SGLQVVGLRKSYKRRPVIRDVTMHLDRGEVVALLGPNGSGKTTCFYAIAGLVSPEGGQVM 73

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           I+G D+T +PMYRRAR+GI YLPQE SIFRGL+VE+NILAVLE+ EKD   R E+L+ LL
Sbjct: 74  IEGRDVTALPMYRRARMGIGYLPQEVSIFRGLSVEDNILAVLEITEKDPHTRRERLEELL 133

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            EF+I   R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+A+ +I  L+ D
Sbjct: 134 GEFSIAHLRRTPALALSGGERRRVEIARCLAADPRYLLLDEPFAGVDPIAVGEIRGLVHD 193

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L SRGIG+LITDHNV E L ++DRAYI+H G VL  GT +E++ ++ VRR+YLG  F
Sbjct: 194 LKSRGIGVLITDHNVRETLEIVDRAYILHDGTVLKSGTTEEVVRDETVRRVYLGQNF 250


>gi|126738424|ref|ZP_01754129.1| ABC transporter, ATP-binding protein [Roseobacter sp. SK209-2-6]
 gi|126720223|gb|EBA16929.1| ABC transporter, ATP-binding protein [Roseobacter sp. SK209-2-6]
          Length = 253

 Score =  281 bits (719), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 133/230 (57%), Positives = 173/230 (75%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K Y    V++ V + +  GE V LLGPNG+GKTT FY + GLI  ++G + IDG D+T
Sbjct: 21  LRKSYRKKVVIREVSMTLDRGEAVALLGPNGSGKTTSFYAIAGLIFPEAGKVSIDGQDVT 80

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITK 150
            +PMYRRARLGI YLPQE SIFRGL+VE+NILAVL++ EK   KR E+L+ LL +F+I  
Sbjct: 81  TLPMYRRARLGIGYLPQEMSIFRGLSVEDNILAVLDIAEKHDHKRRERLEELLSDFSIEH 140

Query: 151 WRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIG 210
            R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+++ DI  L+ DL +RGIG
Sbjct: 141 LRRAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDPISVGDIRHLVADLKTRGIG 200

Query: 211 ILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +LITDHNV E L ++DRAYI+H G VL  G+ +E+++N++VRR+YLGD F
Sbjct: 201 VLITDHNVRETLEIVDRAYILHDGQVLMSGSPEEVVENENVRRVYLGDNF 250


>gi|83313035|ref|YP_423299.1| ABC transporter ATPase [Magnetospirillum magneticum AMB-1]
 gi|82947876|dbj|BAE52740.1| ABC-type (unclassified) transport system, ATPase component
           [Magnetospirillum magneticum AMB-1]
          Length = 265

 Score =  281 bits (718), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 146/256 (57%), Positives = 182/256 (71%), Gaps = 1/256 (0%)

Query: 8   LGIEMPEFQENRASKDSL-LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTT 66
           L  E P     R   D+  L A ++ K +    V++ V + V+ GE VGLLGPNGAGKTT
Sbjct: 10  LAAEKPVVAGPRLVADNPGLVARNIGKSFKGRPVLRDVSISVQRGEAVGLLGPNGAGKTT 69

Query: 67  FFYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLE 126
            FY +TGLI  D G+I +DG +IT +PMYRRARLGI YLPQEASIFRGL+VE NI+AVLE
Sbjct: 70  CFYCITGLINPDMGAILLDGTEITDLPMYRRARLGIGYLPQEASIFRGLSVEGNIMAVLE 129

Query: 127 VYEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPF 186
           V E D ++R   L+SLL EF+I+  R   A  LSGG+RRR+EIAR+L   P +ILLDEP 
Sbjct: 130 VVEPDLERRQHDLESLLAEFSISHLRRAPAMALSGGERRRVEIARALACRPHFILLDEPL 189

Query: 187 AGVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEII 246
           AG+DP+A+SDI  L+  L  RGIG+LITDHNV E L LIDRAYI+H G VL  G   EI+
Sbjct: 190 AGIDPIAVSDIRDLVAHLKHRGIGVLITDHNVRETLDLIDRAYILHDGSVLMEGRPAEIV 249

Query: 247 DNQDVRRLYLGDRFAF 262
            ++ VRR+YLG+RF+ 
Sbjct: 250 AHEGVRRVYLGERFSM 265


>gi|84500654|ref|ZP_00998903.1| ABC transporter, ATP-binding protein [Oceanicola batsensis
           HTCC2597]
 gi|84391607|gb|EAQ03939.1| ABC transporter, ATP-binding protein [Oceanicola batsensis
           HTCC2597]
          Length = 252

 Score =  281 bits (718), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 136/248 (54%), Positives = 177/248 (71%), Gaps = 2/248 (0%)

Query: 13  PEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMT 72
           P+ Q +   K   L    L K Y    V++ V + V  GE+  LLGPNG+GKTT FY + 
Sbjct: 4   PDLQLHTGGKG--LRIEQLRKSYKKRIVIRDVTMKVDQGEVAALLGPNGSGKTTTFYAVA 61

Query: 73  GLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDK 132
           GLI  + G++ +DG D+T +PMYRRARLGI YLPQE SIFRGL+VE+NI A+L++   D+
Sbjct: 62  GLIVPEGGTVVVDGRDVTGLPMYRRARLGIGYLPQEMSIFRGLSVEDNISAILDITHSDR 121

Query: 133 KKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPV 192
            KR E+L+ LL EF+I   R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+
Sbjct: 122 HKRRERLEELLSEFSIEHLRRAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDPI 181

Query: 193 AISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVR 252
           ++SDI  L+ DL  RGIG+LITDHNV E L ++DRAYI+H G VL  GT +E++ N++VR
Sbjct: 182 SVSDIRHLVADLKKRGIGVLITDHNVRETLEIVDRAYILHDGKVLMSGTPEEVVQNENVR 241

Query: 253 RLYLGDRF 260
           R+YLGD F
Sbjct: 242 RVYLGDTF 249


>gi|329847149|ref|ZP_08262177.1| ABC transporter family protein [Asticcacaulis biprosthecum C19]
 gi|328842212|gb|EGF91781.1| ABC transporter family protein [Asticcacaulis biprosthecum C19]
          Length = 255

 Score =  281 bits (718), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 174/228 (76%)

Query: 33  KKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKM 92
           K Y    VVK V L +  GE+VGLLGPNGAGKTT FYM+TGLI AD G+I +DG DIT+ 
Sbjct: 27  KSYKDRAVVKSVSLKLGRGEVVGLLGPNGAGKTTCFYMITGLIEADYGTILLDGQDITRQ 86

Query: 93  PMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITKWR 152
           PMY+RAR+GI YLPQEASIFRG++VE+N+LAVLE+ EK+  K  E    LL++  IT  R
Sbjct: 87  PMYQRARMGIGYLPQEASIFRGMSVEQNLLAVLELNEKNPAKVQEDATKLLEDLRITHIR 146

Query: 153 HVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIGIL 212
           H  A  LSGG+RRR+EIAR+L   PS++LLDEPFAG+DP+AISDI  +I  L SRGIGIL
Sbjct: 147 HSPATALSGGERRRVEIARALAGKPSFMLLDEPFAGIDPLAISDIRDVIIYLKSRGIGIL 206

Query: 213 ITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           ITDHNV E L ++DRA IIH+G VL  GT ++I  + +V+R+YLG+ F
Sbjct: 207 ITDHNVRETLEIVDRASIIHSGEVLFEGTAEQITHDPEVKRVYLGESF 254


>gi|294675674|ref|YP_003576289.1| ABC transporter ATP-binding protein [Rhodobacter capsulatus SB
           1003]
 gi|294474494|gb|ADE83882.1| ABC transporter, ATP-binding protein [Rhodobacter capsulatus SB
           1003]
          Length = 252

 Score =  281 bits (718), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 177/249 (71%)

Query: 12  MPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMM 71
           M E +   A   + L   SL K Y    V++ V L ++ GE+V LLGPNG+GKTT FY +
Sbjct: 1   MTEAKRIDAESLTGLDVTSLRKSYRKRLVLRDVSLRLERGEVVALLGPNGSGKTTCFYAI 60

Query: 72  TGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD 131
            GL+  D+G + IDG D T +PMYRRARLGI YLPQEASIFRGLTVE+NI+AVLE+   D
Sbjct: 61  AGLVAPDAGRVSIDGIDATGLPMYRRARLGIGYLPQEASIFRGLTVEQNIMAVLEIAVAD 120

Query: 132 KKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDP 191
              R E+L+ LL +F IT  R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP
Sbjct: 121 PHHRRERLEELLGDFAITHLRQAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDP 180

Query: 192 VAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDV 251
           +A+++I  L+  L  RGIG+LITDHNV E L ++DRAYI+H G VL  G  +E++ +++V
Sbjct: 181 IAVAEIRALVSHLKERGIGVLITDHNVRETLEIVDRAYILHDGRVLMSGRTEEVVQDENV 240

Query: 252 RRLYLGDRF 260
           RR+YLG+ F
Sbjct: 241 RRVYLGENF 249


>gi|146278804|ref|YP_001168963.1| ABC transporter related [Rhodobacter sphaeroides ATCC 17025]
 gi|145557045|gb|ABP71658.1| ABC transporter related [Rhodobacter sphaeroides ATCC 17025]
          Length = 253

 Score =  281 bits (718), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 135/241 (56%), Positives = 175/241 (72%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           + + S L    L K Y    V++ V +++  GE+V LLGPNG+GKTT FY + GLI  + 
Sbjct: 10  SDERSGLQVIGLRKSYKRRPVIRDVTMHLDRGEVVALLGPNGSGKTTCFYAIAGLISPEG 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G + I+G D+T +PMYRRAR+GI YLPQE SIFRGL+VE+NILAVLE+ EKD   R E+L
Sbjct: 70  GQVLIEGRDVTALPMYRRARMGIGYLPQEVSIFRGLSVEDNILAVLEITEKDPHTRRERL 129

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL EF+I   R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+A+ +I  
Sbjct: 130 EELLGEFSIAHLRRTPALALSGGERRRVEIARCLAADPRYLLLDEPFAGVDPIAVGEIRS 189

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L+ DL SRGIG+LITDHNV E L ++DRAYI+H G VL  GT +E++ ++ VRR+YLG  
Sbjct: 190 LVHDLKSRGIGVLITDHNVRETLEIVDRAYILHDGTVLKSGTTEEVVHDEMVRRVYLGQN 249

Query: 260 F 260
           F
Sbjct: 250 F 250


>gi|221640651|ref|YP_002526913.1| ABC transporter-like protein [Rhodobacter sphaeroides KD131]
 gi|221161432|gb|ACM02412.1| ABC transporter related [Rhodobacter sphaeroides KD131]
          Length = 253

 Score =  281 bits (718), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 134/237 (56%), Positives = 173/237 (72%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L    L K Y    V++ V +++  GE+V LLGPNG+GKTT FY + GL+  + G + 
Sbjct: 14  SGLQVVGLRKSYKRRPVIRDVTMHLDRGEVVALLGPNGSGKTTCFYAIAGLVSPEGGQVM 73

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           I+G D+T +PMYRRAR+GI YLPQE SIFRGL+VE+NILAVLE+ EKD   R E+L+ LL
Sbjct: 74  IEGRDVTALPMYRRARMGIGYLPQEVSIFRGLSVEDNILAVLEITEKDPHTRRERLEELL 133

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            EF+I   R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+A+ +I  L+ D
Sbjct: 134 GEFSIAHLRRTPALALSGGERRRVEIARCLAADPRYLLLDEPFAGVDPIAVGEIRGLVHD 193

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L SRGIG+LITDHNV E L ++DRAYI+H G VL  GT +E++ ++ VRR+YLG  F
Sbjct: 194 LKSRGIGVLITDHNVRETLEIVDRAYILHDGTVLKSGTTEEVVRDEMVRRVYLGQNF 250


>gi|78188232|ref|YP_378570.1| ATPase [Chlorobium chlorochromatii CaD3]
 gi|78170431|gb|ABB27527.1| ATPase [Chlorobium chlorochromatii CaD3]
          Length = 244

 Score =  280 bits (716), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 175/240 (72%)

Query: 23  DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSI 82
           +S+LS+  L K YN   VV    + V+ G+IVGLLGPNGAGKTT FYM+ GL+  DSG +
Sbjct: 2   NSILSSHKLKKSYNKHPVVTNSSIEVRQGDIVGLLGPNGAGKTTTFYMIVGLVRPDSGEV 61

Query: 83  KIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSL 142
           ++D   IT +PMY+RARLG+ YLPQEAS+FR L+VEENI AVLE     KK+R E+++ +
Sbjct: 62  RLDDKPITHLPMYKRARLGVGYLPQEASVFRNLSVEENIAAVLEFTALSKKERQERMEKM 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+E NIT  R  +   LSGG+RRR EIAR+L   P +ILLDEPFAGVDP+A+ DI  ++ 
Sbjct: 122 LEELNITHIRKSMGYALSGGERRRTEIARALALNPKFILLDEPFAGVDPIAVEDIQHIVA 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            LA R IG+LITDHNVHE L++ +RAY++  G +   GT +EI DN +VR++YLG++F  
Sbjct: 182 GLAKRNIGVLITDHNVHETLSITNRAYLLFDGSIFMKGTPEEIADNPEVRKMYLGEKFTL 241


>gi|126732866|ref|ZP_01748657.1| ABC transporter, ATP-binding protein [Sagittula stellata E-37]
 gi|126706642|gb|EBA05716.1| ABC transporter, ATP-binding protein [Sagittula stellata E-37]
          Length = 245

 Score =  280 bits (716), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 175/238 (73%)

Query: 23  DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSI 82
           DS L    L K Y    V++ V + +  GE+V LLGPNG+GKTT FY + GL+  D+G +
Sbjct: 5   DSGLRVNHLRKAYRKRVVIRDVTMRLDRGEVVALLGPNGSGKTTSFYAIAGLVNPDAGEV 64

Query: 83  KIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSL 142
            IDG+D T +PMYRRARLGI YLPQE SIFRGL+VE+NI AVL++ + D  KR E+L+ L
Sbjct: 65  LIDGHDATYLPMYRRARLGIGYLPQEMSIFRGLSVEDNIGAVLDISQPDAHKRRERLEEL 124

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EF+I   R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+++ DI  L+ 
Sbjct: 125 LGEFSIEHLRRAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDPISVGDIRHLVA 184

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           DL +RG+G+LITDHNV E L L+DRAYI+H G VL  GT +E++ N++VRR+YLGD F
Sbjct: 185 DLKTRGLGVLITDHNVRETLELVDRAYILHDGQVLMSGTPEEVVQNENVRRVYLGDNF 242


>gi|197103640|ref|YP_002129017.1| ABC transporter, ATP-binding protein [Phenylobacterium zucineum
           HLK1]
 gi|196477060|gb|ACG76588.1| ABC transporter, ATP-binding protein [Phenylobacterium zucineum
           HLK1]
          Length = 241

 Score =  280 bits (715), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 178/232 (76%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           ++ K +    VVKGV L +  GE+ GLLGPNGAGKTT FYM+TGLI AD G+I +DG +I
Sbjct: 10  NIGKSFRGRPVVKGVSLRLARGEVAGLLGPNGAGKTTCFYMITGLIPADYGAIYLDGENI 69

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           T  PMY+RAR+G+ YLPQE SIFRG+TV EN++AV+E+ ++D+K+    +  LL+E +I 
Sbjct: 70  TAQPMYQRARMGVGYLPQETSIFRGMTVWENVMAVVELRQRDQKQARATVTELLEELHIE 129

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             R+  A  LSGG+RRR+EIAR+L S PS++LLDEPFAG+DP+AI+DI  +I  L +RGI
Sbjct: 130 HLRNAPAVSLSGGERRRVEIARALASEPSFMLLDEPFAGIDPLAIADIREVIGYLKTRGI 189

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
           GILITDHNV E L +IDRA IIHAG VL  G   EI+D+ +VRR+YLGDRFA
Sbjct: 190 GILITDHNVRETLDIIDRASIIHAGEVLFEGGPDEIVDDPEVRRVYLGDRFA 241


>gi|294084814|ref|YP_003551574.1| ABC transporter ATP-binding protein [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664389|gb|ADE39490.1| ABC transporter ATP-binding protein [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 260

 Score =  279 bits (713), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 130/241 (53%), Positives = 181/241 (75%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
           ++++ L A  + K ++   VV+ V L ++ GE VGLLGPNGAGKTT FY++ GL+ AD G
Sbjct: 19  NQNAGLQATGIGKSFDQRRVVRNVTLSLQRGEAVGLLGPNGAGKTTTFYILAGLLAADEG 78

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLD 140
           S++IDG ++T MP+++RARLGI YLPQE+SIFRGLTVE+NILAVLE  ++ +  R   LD
Sbjct: 79  SVQIDGQNVTNMPVFQRARLGIGYLPQESSIFRGLTVEQNILAVLETLDEPETDRASMLD 138

Query: 141 SLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVL 200
            L+ EF IT  R+  +  LSGG+RRRLEIAR+L + P+++LLDEP AG+DP+A+ +I  L
Sbjct: 139 DLMAEFGITHLRNTPSINLSGGERRRLEIARALAARPTFLLLDEPLAGIDPIALGEIRGL 198

Query: 201 IRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           IR L   G+G+LITDHNV E L ++DRAYIIH G V+  G+ +E++ +  VR +YLG+RF
Sbjct: 199 IRQLQDHGLGVLITDHNVRETLDVVDRAYIIHDGAVMMEGSPEEVVQHSGVREVYLGERF 258

Query: 261 A 261
           +
Sbjct: 259 S 259


>gi|89052716|ref|YP_508167.1| ABC transporter related [Jannaschia sp. CCS1]
 gi|88862265|gb|ABD53142.1| ABC transporter related protein [Jannaschia sp. CCS1]
          Length = 249

 Score =  278 bits (711), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 169/235 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L    L K Y    V++ V L +  GE+V LLGPNG+GKTT FY + GLI  D G + ID
Sbjct: 12  LRVHKLRKSYRKRPVIRDVTLELNRGEVVALLGPNGSGKTTSFYCIAGLITPDGGRVTID 71

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G D+T  PMYRRAR G+ YLPQE SIFRGLTVE+NI A+LE+ E  +KKR ++L+ LL E
Sbjct: 72  GQDVTLFPMYRRARAGVGYLPQEMSIFRGLTVEDNIKAILEIVEPKRKKRRDRLEELLSE 131

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F+I   R   A  LSGG+RRR EIAR L S P Y+LLDEPFAGVDP+A+ DI  L+ +L 
Sbjct: 132 FSIEHLRRAPALSLSGGERRRAEIARCLASDPRYVLLDEPFAGVDPIAVGDIRALVAELK 191

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +RGIG+LITDHNV E L ++DRAYI+H G ++  GT  E++++++VRR+YLG  F
Sbjct: 192 TRGIGVLITDHNVQETLAIVDRAYILHDGVIIMSGTADEVVEDENVRRVYLGQSF 246


>gi|85375675|ref|YP_459737.1| ABC-type transport system ATPase component [Erythrobacter litoralis
           HTCC2594]
 gi|84788758|gb|ABC64940.1| ABC-type transport system ATPase component [Erythrobacter litoralis
           HTCC2594]
          Length = 265

 Score =  278 bits (710), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 134/237 (56%), Positives = 174/237 (73%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L   S+ K Y+   V+  + L V  GE++GLLGPNGAGKTT FY + GL+  D+G I +D
Sbjct: 29  LEVVSIAKSYDKRAVLTDISLSVGKGEVLGLLGPNGAGKTTCFYSIMGLVRPDAGRILMD 88

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G D+T +PMYRRA LG+ YLPQE SIFRG+TVE+NI +VLE+ E D   R ++LD LL E
Sbjct: 89  GEDVTHLPMYRRAILGLGYLPQETSIFRGMTVEQNIKSVLEMVEPDADTREQELDRLLDE 148

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F + K R   A  LSGG+RRR EIAR+L + PS +LLDEPFAG+DP++ISDI  L++DL 
Sbjct: 149 FGLQKLRTAPAMALSGGERRRCEIARALAAKPSIMLLDEPFAGIDPLSISDIRDLVKDLK 208

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           +RGIG+LITDHNV E L ++DRA II+ G VL  GT QE++ +++VRRLYLG+ F  
Sbjct: 209 TRGIGVLITDHNVRETLEIVDRACIIYGGQVLFAGTPQELVADENVRRLYLGESFTL 265


>gi|254466747|ref|ZP_05080158.1| ABC transporter, ATP-binding protein [Rhodobacterales bacterium
           Y4I]
 gi|206687655|gb|EDZ48137.1| ABC transporter, ATP-binding protein [Rhodobacterales bacterium
           Y4I]
          Length = 252

 Score =  278 bits (710), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 174/230 (75%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K Y    V++ V + +  GE+V LLGPNG+GKTT FY + GL+  ++G++ IDG ++T
Sbjct: 20  LRKSYRKRVVIRDVSMSLNRGEVVALLGPNGSGKTTSFYAIAGLVFPEAGTVSIDGQNVT 79

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITK 150
            +PMYRRARLGI YLPQE SIFRGL+VE+NI AVL++ +K + KR E+L+ LL +F+I  
Sbjct: 80  GLPMYRRARLGIGYLPQEMSIFRGLSVEDNISAVLDISQKHEHKRRERLEELLSDFSIEH 139

Query: 151 WRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIG 210
            R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+++ DI  L+ DL  RGIG
Sbjct: 140 LRRAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDPISVGDIRHLVSDLKKRGIG 199

Query: 211 ILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +LITDHNV E L ++DRAYI+H G VL  G+ +E+++N++VRR+YLGD F
Sbjct: 200 VLITDHNVRETLEIVDRAYILHDGQVLMSGSPEEVVENENVRRVYLGDNF 249


>gi|163745216|ref|ZP_02152576.1| ABC transporter, ATP-binding protein, putative [Oceanibulbus
           indolifex HEL-45]
 gi|161382034|gb|EDQ06443.1| ABC transporter, ATP-binding protein, putative [Oceanibulbus
           indolifex HEL-45]
          Length = 251

 Score =  278 bits (710), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 131/241 (54%), Positives = 174/241 (72%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A  DS L    L K Y    V++   + +  GE+V LLGPNG+GKTT FY + GL+  + 
Sbjct: 8   AGGDSGLRIQHLRKSYRKKAVIRDFSMELDRGEVVALLGPNGSGKTTTFYAVAGLVTPEG 67

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G + +DG D+T +PMYRRA+LGI YLPQE SIFRGL+V++NI A+L++  K + +R E+L
Sbjct: 68  GRVTVDGKDVTTLPMYRRAQLGIGYLPQEMSIFRGLSVQDNISAILDIRVKHRHQRRERL 127

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL EF+I   R   A  LSGG+RRR+EIAR L + PSY+LLDEPFAGVDP+++ DI  
Sbjct: 128 EELLTEFSIEHLRRAPALALSGGERRRVEIARCLAANPSYLLLDEPFAGVDPISVGDIRQ 187

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L+ DL  RGIG+LITDHNV E L ++DRAYI+H G VL  GT +E++ N++VRR+YLGD 
Sbjct: 188 LVADLKKRGIGVLITDHNVRETLEIVDRAYILHEGKVLMSGTPEEVVQNENVRRVYLGDN 247

Query: 260 F 260
           F
Sbjct: 248 F 248


>gi|254461966|ref|ZP_05075382.1| ABC transporter, ATP-binding protein [Rhodobacterales bacterium
           HTCC2083]
 gi|206678555|gb|EDZ43042.1| ABC transporter, ATP-binding protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 252

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 130/237 (54%), Positives = 175/237 (73%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K Y    V++ V + +  GE+V LLGPNG+GKTT FY + GL+  + GS+ 
Sbjct: 13  SGLRIVNLRKSYKKKVVIRDVSMTLDRGEVVALLGPNGSGKTTSFYTIAGLVYPEGGSVT 72

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           IDG  +T +PMYRRA+LGI YLPQE SIFRG+ V++NI ++L++  KD++KR E+L+ LL
Sbjct: 73  IDGRVVTNLPMYRRAKLGIGYLPQEMSIFRGMNVQDNIASILDISLKDRQKRRERLEELL 132

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            EF+I   R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+++ DI  L+ D
Sbjct: 133 SEFSIEHLRSAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDPISVGDIRHLVAD 192

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L ++DRAYI+H G VL  GT +E+++N++VRR+YLGD F
Sbjct: 193 LKKRGIGVLITDHNVRETLEIVDRAYILHDGQVLMSGTPEEVVENENVRRVYLGDNF 249


>gi|189347591|ref|YP_001944120.1| ABC transporter [Chlorobium limicola DSM 245]
 gi|189341738|gb|ACD91141.1| ABC transporter related [Chlorobium limicola DSM 245]
          Length = 244

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 168/239 (70%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S LS   L K YN   VVK   L VK GEIVGLLGPNGAGKTT FYM+ GL+  D G + 
Sbjct: 3   STLSCSGLKKIYNRREVVKSSTLEVKQGEIVGLLGPNGAGKTTTFYMIVGLVQPDGGKVM 62

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG DIT +PM++RARLGI YLPQEAS+FR +TVE NIL+VLE     K +RHEK + +L
Sbjct: 63  LDGRDITTLPMHKRARLGIGYLPQEASVFRKMTVENNILSVLEFTSLSKTERHEKAEKML 122

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           ++ NI   R  +   LSGG+RRR EIAR+L   P +ILLDEPFAGVDP+A+ DI  ++ +
Sbjct: 123 EDLNIANIRKSMGYALSGGERRRTEIARALALDPKFILLDEPFAGVDPIAVEDIQQIVEE 182

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  R IG+LITDHNVHE L++   AY++  G +   G+ QEI DN + R+ YLG++F+ 
Sbjct: 183 LTKRNIGVLITDHNVHETLSITSHAYLLFDGSIFMQGSPQEIADNPEARKYYLGEKFSL 241


>gi|71909759|ref|YP_287346.1| ABC transporter related [Dechloromonas aromatica RCB]
 gi|71849380|gb|AAZ48876.1| ABC transporter related protein [Dechloromonas aromatica RCB]
          Length = 244

 Score =  277 bits (708), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 136/235 (57%), Positives = 177/235 (75%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LSA +L K+Y +  VV+ V   VK GE+VGLLGPNGAGKTT FYM+ GL+ AD G + ID
Sbjct: 8   LSANNLKKRYKTRTVVEDVSFEVKSGEVVGLLGPNGAGKTTCFYMIVGLVAADGGEVYID 67

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
            N +T +PM+ RARLG+SYLPQEAS+FR L VEENI AVLE+ +  + + +++L+ LL E
Sbjct: 68  DNRLTHLPMHSRARLGLSYLPQEASVFRKLNVEENIRAVLELLKLPEAELNDRLEGLLNE 127

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
            ++   RHV A  LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+A+ +I  +IR L 
Sbjct: 128 LHVGHVRHVNASALSGGERRRVEIARALATNPRFILLDEPFAGVDPIAVLEIQKIIRFLK 187

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            RGIG+LITDHNV E L + D AYII+AG VLA G   EI++N+ VR++YLG+ F
Sbjct: 188 ERGIGVLITDHNVRETLGICDHAYIINAGNVLAAGRPAEIVENESVRKVYLGEHF 242


>gi|89067360|ref|ZP_01154873.1| ABC transporter, ATP-binding protein [Oceanicola granulosus
           HTCC2516]
 gi|89046929|gb|EAR52983.1| ABC transporter, ATP-binding protein [Oceanicola granulosus
           HTCC2516]
          Length = 252

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 174/249 (69%)

Query: 12  MPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMM 71
           MP         D+ L    L K Y    V++ V L +  GE V LLGPNG+GKTT FY +
Sbjct: 1   MPAPALAVTEGDAGLHVAHLRKSYRKRPVIRDVSLSLGRGEAVALLGPNGSGKTTCFYSI 60

Query: 72  TGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD 131
            GLI  D+G++ IDG D T++PMYRRA+LGI YLPQE SIFRGLTVE+NILA+LE+ E  
Sbjct: 61  AGLIQPDAGTVTIDGRDATQLPMYRRAKLGIGYLPQEMSIFRGLTVEDNILAILEIAEPS 120

Query: 132 KKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDP 191
             KR  KL+ LL EF+I   R   A  LSGG+RRR EIAR L + P Y+LLDEPFAGVDP
Sbjct: 121 VVKRRRKLEQLLTEFSIDHLRRAPALALSGGERRRCEIARCLAAGPKYVLLDEPFAGVDP 180

Query: 192 VAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDV 251
           +A+ +I  L+ +L +RGIG+LITDHNV E L ++DRAYI+H G VL  GT +E++ +++V
Sbjct: 181 IAVGEIRHLVGELKTRGIGVLITDHNVRETLEIVDRAYILHDGKVLMSGTTEEVVRDENV 240

Query: 252 RRLYLGDRF 260
           RR+YLG  F
Sbjct: 241 RRVYLGQSF 249


>gi|254485990|ref|ZP_05099195.1| ABC transporter, ATP-binding protein [Roseobacter sp. GAI101]
 gi|214042859|gb|EEB83497.1| ABC transporter, ATP-binding protein [Roseobacter sp. GAI101]
          Length = 252

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 128/230 (55%), Positives = 171/230 (74%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K Y    V++   +++  GE+V LLGPNG+GKTT FY + GL+  + G++ IDG D+T
Sbjct: 20  LRKSYRKKTVIRDFSMHLDRGEVVALLGPNGSGKTTTFYAIAGLVMPEGGTVTIDGKDVT 79

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITK 150
            +PMYRRA+LGI YLPQE SIFRGL V++NI+A+L++   D +KR E+L++LL EF+I  
Sbjct: 80  SLPMYRRAQLGIGYLPQEMSIFRGLNVQDNIMAILDISVPDVRKRRERLEALLSEFSIEH 139

Query: 151 WRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIG 210
            R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+++ DI  L+ DL  RGIG
Sbjct: 140 LRRAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDPISVDDIRHLVADLKKRGIG 199

Query: 211 ILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +LITDHNV E L ++DRAYI+H G VL  GT  E++ N++VRR+YLGD F
Sbjct: 200 VLITDHNVRETLEIVDRAYILHEGKVLMSGTPSEVVANENVRRVYLGDNF 249


>gi|251773403|gb|EES53952.1| ABC transporter, ATP-binding protein [Leptospirillum
           ferrodiazotrophum]
          Length = 248

 Score =  276 bits (705), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 133/235 (56%), Positives = 171/235 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           + A  L K Y+   VV GV+L V PGE+VGLLGPNGAGKTT FYM+ GL+  D G I + 
Sbjct: 3   IEAVGLMKTYHKRRVVNGVNLLVNPGEVVGLLGPNGAGKTTSFYMIVGLVKPDGGRILMG 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DI+KMPM++RARLGISYLPQE+SIFR L+V +NI+AVLE  +    +R  +LD+LL E
Sbjct: 63  GEDISKMPMHKRARLGISYLPQESSIFRKLSVADNIMAVLEFMDLTPAERQNRLDTLLSE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
            N+   R   A  LSGG+RRR+E+AR+L + P YILLDEPFAG+DP+A+ +I  +I  L 
Sbjct: 123 LNVGHLRTSKAYTLSGGERRRVEVARALATKPEYILLDEPFAGIDPIAVIEIQKIIAQLK 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           SRGIG+LITDHNV E L + DRAY+I+ G +L  GT ++I  +  VR  YLG+RF
Sbjct: 183 SRGIGVLITDHNVRETLEITDRAYVINQGQILEEGTPRQIASSPKVREFYLGERF 237


>gi|85709583|ref|ZP_01040648.1| ABC-type transport system ATPase component [Erythrobacter sp. NAP1]
 gi|85688293|gb|EAQ28297.1| ABC-type transport system ATPase component [Erythrobacter sp. NAP1]
          Length = 303

 Score =  276 bits (705), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 134/240 (55%), Positives = 174/240 (72%)

Query: 23  DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSI 82
           D  L   S+ K Y+   V+  + L V  GE++GLLGPNGAGKTT FY + GL+  DSG I
Sbjct: 64  DGGLEVISIAKSYDKRAVLTDISLTVGKGEVLGLLGPNGAGKTTCFYSIMGLVKPDSGRI 123

Query: 83  KIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSL 142
            +DG D+T +PMYRRA LG+ YLPQE SIFRG+TVE+NI  VLE+ E D   R ++L+ L
Sbjct: 124 LMDGEDVTNLPMYRRAILGLGYLPQETSIFRGMTVEQNINCVLEMVEPDASTRRDELERL 183

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EF +T+ R   A  LSGG+RRR EIAR+L + PS +LLDEPFAG+DP++ISDI  L++
Sbjct: 184 LGEFGLTRLRESPAMALSGGERRRCEIARALAAKPSIMLLDEPFAGIDPLSISDIRDLVK 243

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           DL  RGIG+LITDHNV E L ++DRA II+ G VL  GT QE++ +++V+RLYLG+ F  
Sbjct: 244 DLKRRGIGVLITDHNVRETLDIVDRACIIYGGQVLFAGTPQELVADENVKRLYLGENFTL 303


>gi|103488477|ref|YP_618038.1| ABC transporter related [Sphingopyxis alaskensis RB2256]
 gi|98978554|gb|ABF54705.1| ABC transporter related [Sphingopyxis alaskensis RB2256]
          Length = 271

 Score =  276 bits (705), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 138/243 (56%), Positives = 176/243 (72%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A+  + L+  S+ K Y+   V+  V L V  GE+VGLLGPNGAGKTT FY + GL+  D+
Sbjct: 29  AATGNGLAVISIAKSYDKRVVLSDVSLSVGKGEVVGLLGPNGAGKTTCFYSIMGLVKPDA 88

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G I +DG DIT +PMYRRA LG+ YLPQE SIFRG+TV +NI AVLE+ E DK  R  +L
Sbjct: 89  GRIMLDGADITALPMYRRAILGLGYLPQETSIFRGMTVAQNIEAVLELAEPDKVARERRL 148

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL EF +T+ R   A  LSGG+RRR EIAR+L + PS ILLDEPFAG+DP++ISDI  
Sbjct: 149 EELLDEFGLTRLRDAAAMALSGGERRRAEIARALAANPSIILLDEPFAGIDPLSISDIRD 208

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L+ DL +RGIG+LITDHNV E L L+DRA II+ G VL  G+  E++ + +VRRLYLG+ 
Sbjct: 209 LVADLKTRGIGVLITDHNVRETLDLVDRACIIYDGKVLLAGSPAELVADPEVRRLYLGEG 268

Query: 260 FAF 262
           F+ 
Sbjct: 269 FSL 271


>gi|298369556|ref|ZP_06980873.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           sp. oral taxon 014 str. F0314]
 gi|298282113|gb|EFI23601.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           sp. oral taxon 014 str. F0314]
          Length = 244

 Score =  276 bits (705), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 174/239 (72%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE++GLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 6   SRLVVQNLQKSFRKRQVVKNFSLEIESGEVIGLLGPNGAGKTTSFYMIVGLIAADAGSVM 65

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 66  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEISTKDKNRIDSEVERLL 125

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI + RH  AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 126 SDLNIERLRHNPAPSLSGGERRRVEIARVLAMQPRFILLDEPFAGVDPIAVIDIQKIIEF 185

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   E+++N+ VR +YLG+ F +
Sbjct: 186 LKSRGIGVLITDHNVRETLSICDRAYIISDGAVLAAGKPDELVNNEQVRSVYLGENFKY 244


>gi|171060893|ref|YP_001793242.1| ABC transporter-like protein [Leptothrix cholodnii SP-6]
 gi|170778338|gb|ACB36477.1| ABC transporter-related protein [Leptothrix cholodnii SP-6]
          Length = 268

 Score =  275 bits (704), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 141/254 (55%), Positives = 183/254 (72%), Gaps = 9/254 (3%)

Query: 16  QENRASKD---SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMT 72
           Q  RA ++   S L A  L K Y +  VVK + L V  GE+VGLLGPNGAGKTT FYM+ 
Sbjct: 13  QPARAGRNGASSRLEADGLEKSYGARKVVKDIHLAVNSGEVVGLLGPNGAGKTTSFYMLV 72

Query: 73  GLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDK 132
           GL+ AD+G I+IDG  + ++P+++RAR+G+SYLPQEASIFR LTVEENI AVLE+ +  +
Sbjct: 73  GLVRADAGQIRIDGAPVQRLPIHQRARMGLSYLPQEASIFRRLTVEENIRAVLELQQDAE 132

Query: 133 KKRH------EKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPF 186
            +R+      + LD LL + +I K R   AP LSGG+RRR+EIAR+L + P +ILLDEPF
Sbjct: 133 GRRYSAQRIEQMLDGLLADLSIEKLRESPAPALSGGERRRVEIARALATQPRFILLDEPF 192

Query: 187 AGVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEII 246
           AGVDP+A+ +I  +I  L +RGIG+LITDHNV E L + DRAYII  G VLA GT   I+
Sbjct: 193 AGVDPIAVLEIQRIIGFLKARGIGVLITDHNVRETLGICDRAYIISEGRVLAEGTPAAIV 252

Query: 247 DNQDVRRLYLGDRF 260
           +N DVR++YLG+ F
Sbjct: 253 ENPDVRKVYLGEHF 266


>gi|119385332|ref|YP_916388.1| ABC transporter related [Paracoccus denitrificans PD1222]
 gi|119375099|gb|ABL70692.1| ABC transporter related protein [Paracoccus denitrificans PD1222]
          Length = 244

 Score =  275 bits (704), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 134/240 (55%), Positives = 175/240 (72%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
           S+   L    L K Y +  V++ V + ++ GE+V LLGPNG+GKTT FY + GL+  DSG
Sbjct: 2   SEKQGLRVRGLRKSYRNRPVIRDVAMDLERGEVVALLGPNGSGKTTCFYCVAGLVAPDSG 61

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLD 140
            + IDG D T++PMYRRA++GI YLPQE SIFRGLTVE+NI+AVLE+ E    +R E+L+
Sbjct: 62  QVLIDGRDATRLPMYRRAQMGIGYLPQEMSIFRGLTVEQNIMAVLELVEPHVHQRRERLE 121

Query: 141 SLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVL 200
            LL +F+I   R   A  LSGG+RRR+EIAR L + P+Y+LLDEPFAGVDP+A+ +I  L
Sbjct: 122 ELLGDFSIGHLRGASAMALSGGERRRVEIARCLAADPAYLLLDEPFAGVDPIAVGEIRAL 181

Query: 201 IRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           + DL SRGIG+LITDHNV E L ++DRAYI+H G VL  GT  EI+ +  VRR+YLG+ F
Sbjct: 182 VHDLKSRGIGVLITDHNVRETLEIVDRAYILHDGHVLKSGTTAEIVADPQVRRVYLGETF 241


>gi|294010185|ref|YP_003543645.1| ABC-type transport system ATPase component [Sphingobium japonicum
           UT26S]
 gi|292673515|dbj|BAI95033.1| ABC-type transport system ATPase component [Sphingobium japonicum
           UT26S]
          Length = 262

 Score =  275 bits (704), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 173/237 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LS  S+ K Y+   V+  V L V  GE+VGLLGPNGAGKTT FY + GL+  D G I +D
Sbjct: 26  LSVISIAKSYDKRVVLADVSLTVGKGEVVGLLGPNGAGKTTCFYSVMGLVRPDHGRIVLD 85

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DIT +PMYRR+ LG+ YLPQE SIFRGLTV +NI AVLE+ E DK  R  +L+ LL+E
Sbjct: 86  GQDITGLPMYRRSILGLGYLPQETSIFRGLTVAQNIGAVLELAEPDKAARQARLEQLLEE 145

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T+ R   A  LSGG+RRR EIAR+L + PS +LLDEPFAG+DP++I+DI  L++ L 
Sbjct: 146 FGLTRLRDSSAMALSGGERRRCEIARALAANPSIVLLDEPFAGIDPLSIADIRDLVKQLK 205

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           +RGIG+LITDHNV E L ++DRA II+ G VL  G+  E++ N DVRRLYLG+ F+ 
Sbjct: 206 TRGIGVLITDHNVRETLEIVDRACIIYDGKVLFAGSPTELVANADVRRLYLGENFSL 262


>gi|319639072|ref|ZP_07993829.1| ABC transporter [Neisseria mucosa C102]
 gi|317399650|gb|EFV80314.1| ABC transporter [Neisseria mucosa C102]
          Length = 244

 Score =  275 bits (703), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 178/243 (73%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           ++K+S L   +L K +    VVK   L ++ GE++GLLGPNGAGKTT FYM+ GLI AD+
Sbjct: 2   SAKNSRLVVQNLQKSFKKRQVVKSFSLEIESGEVIGLLGPNGAGKTTSFYMIVGLIAADA 61

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           GS+ +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +L
Sbjct: 62  GSVMLDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEISMKDKSRIDAEL 121

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL + NI + R+  AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  
Sbjct: 122 EKLLADLNIERLRNNPAPSLSGGERRRVEIARVLAMQPRFILLDEPFAGVDPIAVIDIQK 181

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           +I  L SRGIG+LITDHNV E L++ DRAYII  G VLA G   ++++N+ VR +YLG+ 
Sbjct: 182 IIEFLKSRGIGVLITDHNVRETLSICDRAYIISDGTVLASGKPDDLVNNEQVRSVYLGEN 241

Query: 260 FAF 262
           F +
Sbjct: 242 FKY 244


>gi|163738080|ref|ZP_02145496.1| ABC transporter related protein [Phaeobacter gallaeciensis BS107]
 gi|163742524|ref|ZP_02149910.1| ABC transporter, ATP-binding protein [Phaeobacter gallaeciensis
           2.10]
 gi|161384109|gb|EDQ08492.1| ABC transporter, ATP-binding protein [Phaeobacter gallaeciensis
           2.10]
 gi|161388696|gb|EDQ13049.1| ABC transporter related protein [Phaeobacter gallaeciensis BS107]
          Length = 252

 Score =  275 bits (703), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 174/241 (72%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
            S  S L    L K Y+   V++ V + +  GE+V LLGPNG+GKTT FY + GL+  ++
Sbjct: 9   TSGSSGLRIEKLRKSYSKKVVIRDVSMSLDRGEVVALLGPNGSGKTTSFYAIAGLVFPEA 68

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           GS+ IDG + T +PMYRRAR+GI YLPQE SIFRGL+VE+NI +VL++  K   KR E+L
Sbjct: 69  GSVTIDGQNATTLPMYRRARMGIGYLPQEMSIFRGLSVEDNISSVLDIAVKHAHKRRERL 128

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL +F+I   R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+++ DI  
Sbjct: 129 EELLSDFSIEHLRRAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDPISVGDIRH 188

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L+ DL  RGIG+LITDHNV E L ++DRAYI+H G VL  GT  E++DN++VRR+YLGD 
Sbjct: 189 LVGDLKKRGIGVLITDHNVRETLEIVDRAYILHDGKVLMSGTPAEVVDNENVRRVYLGDN 248

Query: 260 F 260
           F
Sbjct: 249 F 249


>gi|114769794|ref|ZP_01447404.1| ABC transporter, ATP-binding protein [alpha proteobacterium
           HTCC2255]
 gi|114549499|gb|EAU52381.1| ABC transporter, ATP-binding protein [alpha proteobacterium
           HTCC2255]
 gi|161170290|gb|ABX59260.1| ABC-type unclassified transport system ATPase component [uncultured
           marine bacterium EB000_55B11]
 gi|297183818|gb|ADI19941.1| hypothetical protein [uncultured marine bacterium EB000_55B11]
          Length = 247

 Score =  275 bits (703), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 133/230 (57%), Positives = 169/230 (73%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           + K Y +  V+  VDL ++ GE+V LLGPNGAGKTT FY + GLI  D GS+ +DG D T
Sbjct: 16  IGKAYKNKKVLHNVDLKLQKGEVVALLGPNGAGKTTCFYSIAGLISPDKGSVTVDGFDAT 75

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITK 150
            +PMYRRA+LG+ YLPQEASIFRGL VE+NI AV E++   K +  E+++ LL EF+I+ 
Sbjct: 76  NLPMYRRAQLGLGYLPQEASIFRGLNVEQNISAVSELWANSKAESKERVEELLNEFSISH 135

Query: 151 WRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIG 210
            R   A  LSGG+RRR+EIAR L + P YILLDEPFAGVDP+A+ DI  L+  L  + IG
Sbjct: 136 IRKSPAISLSGGERRRVEIARCLAANPKYILLDEPFAGVDPIAVGDIRFLVAQLKEKEIG 195

Query: 211 ILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +LITDHNV E L +IDRAYI+H G VL  GT +++I+N DVRR+YLGD F
Sbjct: 196 VLITDHNVRETLEIIDRAYILHDGKVLMSGTPEQVIENNDVRRVYLGDDF 245


>gi|159046125|ref|YP_001534919.1| ATPase [Dinoroseobacter shibae DFL 12]
 gi|157913885|gb|ABV95318.1| ATPase [Dinoroseobacter shibae DFL 12]
          Length = 254

 Score =  275 bits (703), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 131/233 (56%), Positives = 170/233 (72%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           +L K Y    V++ V L V  GE V LLGPNG+GKTT FY + GL+  ++G + IDG D+
Sbjct: 21  NLRKSYKRRPVIRDVSLEVTRGEAVALLGPNGSGKTTCFYAIAGLLAPEAGIVSIDGRDV 80

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           T +PMYRRA+LGI YLPQE SIFRG++VE+NI A+LEV  +D+  R E+L+ LL EFNI 
Sbjct: 81  TLLPMYRRAKLGIGYLPQEMSIFRGMSVEDNIRAILEVNTRDRTTRMERLEELLAEFNIE 140

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+A+ DI  L+  L +RGI
Sbjct: 141 HLRRTSALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDPIAVGDIRALVAQLKTRGI 200

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           G+LITDHNV E L ++DRAYI+H G VL  GT  E++ +++VRR+YLG+ F  
Sbjct: 201 GVLITDHNVRETLEIVDRAYILHDGVVLMSGTKDEVVRDENVRRVYLGNTFTM 253


>gi|294668945|ref|ZP_06734032.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           elongata subsp. glycolytica ATCC 29315]
 gi|291309118|gb|EFE50361.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           elongata subsp. glycolytica ATCC 29315]
          Length = 531

 Score =  275 bits (702), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 137/241 (56%), Positives = 177/241 (73%)

Query: 22  KDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGS 81
           K S L A +L K +    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GLI AD+GS
Sbjct: 291 KSSRLVARNLQKTFKKRQVVKDFSLDIESGEVVGLLGPNGAGKTTSFYMIVGLIAADNGS 350

Query: 82  IKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDS 141
           I +DG ++  MP++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDKK+   +L+ 
Sbjct: 351 IMLDGQELRHMPIHERARLGLGYLPQEASIFRKMTVEQNIRAILEISIKDKKRIDGELER 410

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           LL + NI + R   AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I
Sbjct: 411 LLADLNIERLRDNPAPSLSGGERRRVEIARVLAMQPRFILLDEPFAGVDPIAVIDIQKII 470

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
             L SRGIG+LITDHNV E L++ DRAYII  G VLA G  +++++N+ VR +YLG+ F 
Sbjct: 471 GFLKSRGIGVLITDHNVRETLSICDRAYIISDGAVLASGKPEDLVNNEQVRAVYLGENFN 530

Query: 262 F 262
           +
Sbjct: 531 Y 531


>gi|255261239|ref|ZP_05340581.1| ABC transporter, ATP-binding protein [Thalassiobium sp. R2A62]
 gi|255103574|gb|EET46248.1| ABC transporter, ATP-binding protein [Thalassiobium sp. R2A62]
          Length = 252

 Score =  275 bits (702), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 129/241 (53%), Positives = 173/241 (71%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           AS  + L   SL K Y    V++ V L +  GE+V LLGPNG+GKTT FY + GL+  + 
Sbjct: 9   ASGPAGLQVKSLRKSYRKRPVIRDVSLELGRGEVVALLGPNGSGKTTCFYSIAGLVTPEG 68

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G + I+G D+T +PMYRRA+LGI YLPQE SIFRG++VE+NI ++LE+   ++ KR E+L
Sbjct: 69  GQVMIEGRDVTTLPMYRRAKLGIGYLPQEMSIFRGMSVEDNITSILEIAVPNRTKRRERL 128

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL EF+I   R   A  LSGG+RRR EIAR L + P Y+LLDEPFAGVDP+A+ +I  
Sbjct: 129 EELLSEFSIEHLRRAPAMALSGGERRRAEIARCLAAGPKYVLLDEPFAGVDPIAVGEIRT 188

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L+ +L +RGIG+LITDHNV E L ++DRAYI+H G VL  GT  E++ +++VRR+YLG  
Sbjct: 189 LVAELKTRGIGVLITDHNVRETLEIVDRAYILHDGKVLMSGTTDEVVQDENVRRVYLGQN 248

Query: 260 F 260
           F
Sbjct: 249 F 249


>gi|99079865|ref|YP_612019.1| ABC transporter related [Ruegeria sp. TM1040]
 gi|99036145|gb|ABF62757.1| ABC transporter related [Ruegeria sp. TM1040]
          Length = 252

 Score =  275 bits (702), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 130/241 (53%), Positives = 174/241 (72%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
            S  S L    + K Y    V++ V + +  GE+V LLGPNG+GKTT FY + GL+  ++
Sbjct: 9   TSGSSGLRIEKMRKSYRKRVVIRDVSMELNRGEVVALLGPNGSGKTTSFYTIAGLVFPEA 68

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G + +DG ++T +PMYRRARLGI YLPQE SIFRGL+VE+NI AVL++   D  KR E+L
Sbjct: 69  GRVTLDGQNVTSLPMYRRARLGIGYLPQEMSIFRGLSVEDNISAVLDIAVSDDHKRRERL 128

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL +F+I   R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+++ DI  
Sbjct: 129 EELLSDFSIEHLRRAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDPISVGDIRN 188

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L+ DL +RGIG+LITDHNV E L ++DRAYI+H G VL  G+  E+++N++VRR+YLGD 
Sbjct: 189 LVADLKNRGIGVLITDHNVRETLEIVDRAYILHDGQVLMSGSPSEVVENENVRRVYLGDN 248

Query: 260 F 260
           F
Sbjct: 249 F 249


>gi|148555814|ref|YP_001263396.1| ABC transporter-like protein [Sphingomonas wittichii RW1]
 gi|148501004|gb|ABQ69258.1| ABC transporter related [Sphingomonas wittichii RW1]
          Length = 258

 Score =  275 bits (702), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 175/237 (73%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LS  S+ K Y+   V+  + L V  GE+VGLLGPNGAGKTT FY + GL+  D+G I +D
Sbjct: 22  LSVVSIAKTYDKRQVLTDISLDVARGEVVGLLGPNGAGKTTCFYSVMGLVKPDAGRILLD 81

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G+DIT +PMYRRA LG+ YLPQE SIFRGLTV +NI+AVLE+ E DK +R ++LDSLL E
Sbjct: 82  GDDITTLPMYRRAILGLGYLPQETSIFRGLTVSQNIMAVLELVEPDKAQRTQRLDSLLGE 141

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F++   R   A  LSGG+RRR EIAR+L + PS +LLDEPFAG+DP++ISDI  L+RDL 
Sbjct: 142 FHLDHLRDSAAMALSGGERRRCEIARALAADPSIMLLDEPFAGIDPISISDIRELVRDLK 201

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            R IG+LITDHNV E L ++DRA II+ G VL  G+   ++ + +VRRLYLG+ F+ 
Sbjct: 202 RRDIGVLITDHNVRETLDIVDRACIIYDGKVLFQGSPAALVADPNVRRLYLGEGFSL 258


>gi|16273074|ref|NP_439306.1| ABC transporter ATP-binding protein [Haemophilus influenzae Rd
           KW20]
 gi|145627882|ref|ZP_01783683.1| ABC transporter ATP-binding protein [Haemophilus influenzae
           22.1-21]
 gi|145630248|ref|ZP_01786030.1| ABC transporter ATP-binding protein [Haemophilus influenzae R3021]
 gi|145635599|ref|ZP_01791297.1| ABC transporter ATP-binding protein [Haemophilus influenzae PittAA]
 gi|145637100|ref|ZP_01792763.1| ABC transporter ATP-binding protein [Haemophilus influenzae PittHH]
 gi|145639332|ref|ZP_01794938.1| ABC transporter ATP-binding protein [Haemophilus influenzae PittII]
 gi|148826240|ref|YP_001290993.1| ABC transporter ATP-binding protein [Haemophilus influenzae PittEE]
 gi|260580232|ref|ZP_05848062.1| urea ABC transporter, ATP-binding protein UrtE [Haemophilus
           influenzae RdAW]
 gi|319776611|ref|YP_004139099.1| ABC transporter ATP-binding protein [Haemophilus influenzae F3047]
 gi|319897385|ref|YP_004135582.1| abc transporter ATP-binding protein [Haemophilus influenzae F3031]
 gi|1176170|sp|P45073|LPTB_HAEIN RecName: Full=Lipopolysaccharide export system ATP-binding protein
           LptB
 gi|1574704|gb|AAC22803.1| ABC transporter, ATP-binding protein [Haemophilus influenzae Rd
           KW20]
 gi|144979657|gb|EDJ89316.1| ABC transporter ATP-binding protein [Haemophilus influenzae
           22.1-21]
 gi|144984529|gb|EDJ91952.1| ABC transporter ATP-binding protein [Haemophilus influenzae R3021]
 gi|145267161|gb|EDK07167.1| ABC transporter ATP-binding protein [Haemophilus influenzae PittAA]
 gi|145269754|gb|EDK09694.1| ABC transporter ATP-binding protein [Haemophilus influenzae PittHH]
 gi|145271635|gb|EDK11546.1| ABC transporter ATP-binding protein [Haemophilus influenzae PittII]
 gi|148716400|gb|ABQ98610.1| ABC transporter ATP-binding protein [Haemophilus influenzae PittEE]
 gi|260093516|gb|EEW77449.1| urea ABC transporter, ATP-binding protein UrtE [Haemophilus
           influenzae RdAW]
 gi|301169888|emb|CBW29492.1| predicted transporter subunit: ATP-binding component of ABC
           superfamily [Haemophilus influenzae 10810]
 gi|309751206|gb|ADO81190.1| Lipooligosaccharide transporter, ATP-binding protein LptB
           [Haemophilus influenzae R2866]
 gi|317432891|emb|CBY81257.1| predicted transporter subunit: ATP-binding component of ABC
           superfamily [Haemophilus influenzae F3031]
 gi|317451202|emb|CBY87435.1| predicted transporter subunit: ATP-binding component of ABC
           superfamily [Haemophilus influenzae F3047]
          Length = 241

 Score =  274 bits (701), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 136/241 (56%), Positives = 181/241 (75%), Gaps = 3/241 (1%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L+A +L K Y S  VV  V L V   EIVGLLGPNGAGKTT FYM+ GL+  D G I 
Sbjct: 2   SILTAENLAKSYKSRKVVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMVVGLVRQDQGKIV 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD--KKKRHEKLDS 141
           IDG DI+ +PM+ RA+ GI YLPQEASIFR LTV EN++AVLE+  KD   ++R EK D 
Sbjct: 62  IDGEDISLLPMHNRAQRGIGYLPQEASIFRRLTVYENLMAVLEI-RKDLTPQQRREKADE 120

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           L++EFNI+  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++SDI  +I
Sbjct: 121 LIEEFNISHIRDNLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVSDIKKII 180

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
            DL +RG+G+LITDHNV E L + +RAYI+ AG ++A GT +++++++ V+R+YLG++F 
Sbjct: 181 TDLRNRGLGVLITDHNVRETLDVCERAYIVGAGKIIATGTPEQVMNDEQVKRVYLGEQFK 240

Query: 262 F 262
            
Sbjct: 241 L 241


>gi|241760848|ref|ZP_04758937.1| ABC transporter related protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|260753182|ref|YP_003226075.1| ABC transporter [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|283856221|ref|YP_162010.2| ABC transporter-like protein [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374467|gb|EER63928.1| ABC transporter related protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|258552545|gb|ACV75491.1| ABC transporter related [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|283775216|gb|AAV88899.2| ABC transporter related protein [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 260

 Score =  274 bits (701), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 185/256 (72%), Gaps = 12/256 (4%)

Query: 19  RASKDSL------------LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTT 66
           R +KDSL            LS  S+ K Y+   V++ V L V  GE+VGLLGPNGAGKTT
Sbjct: 5   RKTKDSLSTEAYDSGVSQGLSIISIAKSYDHRQVLEDVSLNVGRGEVVGLLGPNGAGKTT 64

Query: 67  FFYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLE 126
            FY + GL+  D+G I +DG+DIT +PMYRRA LG+ YLPQE SIFRGL+V +NI +VLE
Sbjct: 65  CFYSVMGLVKPDAGRILLDGHDITGLPMYRRAILGLGYLPQETSIFRGLSVAQNIDSVLE 124

Query: 127 VYEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPF 186
           ++  DKK R E+LD LL EF++T+     A  LSGG+RRR EIAR+L + PS +LLDEPF
Sbjct: 125 LHYPDKKARKERLDQLLSEFHLTRLYDSPAMALSGGERRRCEIARALAANPSIMLLDEPF 184

Query: 187 AGVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEII 246
           AG+DP++ISDI  LI DL++RGIG+LITDHNV E+L +++RA II+ G VL  GT + ++
Sbjct: 185 AGIDPISISDIRDLIEDLSNRGIGVLITDHNVREMLDIVNRACIIYGGRVLFQGTPEALV 244

Query: 247 DNQDVRRLYLGDRFAF 262
            +++VRRLYLG+ F  
Sbjct: 245 ADENVRRLYLGEDFTL 260


>gi|296281994|ref|ZP_06859992.1| ABC-type transport system ATPase component [Citromicrobium
           bathyomarinum JL354]
          Length = 265

 Score =  274 bits (701), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 134/237 (56%), Positives = 174/237 (73%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L   S+ K Y+   V+  + L V  GE++GLLGPNGAGKTT FY + GL+  DSG I +D
Sbjct: 29  LEVVSIAKSYDKRPVLTDISLSVGKGEVLGLLGPNGAGKTTCFYSIMGLVKPDSGRILMD 88

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G D+T +PMYRRA LG+ YLPQE SIFRGLTVE+NI  VLE+ E D++ + + L+ LL E
Sbjct: 89  GEDVTGLPMYRRAILGLGYLPQETSIFRGLTVEQNIATVLELAEPDRQAQRDGLERLLDE 148

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +TK R+  A  LSGG+RRR EIAR+L + PS +LLDEPFAG+DP++ISDI  L+ DL 
Sbjct: 149 FGLTKLRNAPAMALSGGERRRCEIARALAANPSIMLLDEPFAGIDPLSISDIRDLVIDLK 208

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIG+LITDHNV E L ++DRA II+ G VL  GT Q+++ +++VRRLYLG+ F  
Sbjct: 209 KRGIGVLITDHNVRETLDIVDRACIIYGGQVLFAGTPQDLVADENVRRLYLGENFTL 265


>gi|307294887|ref|ZP_07574729.1| ABC transporter related protein [Sphingobium chlorophenolicum L-1]
 gi|306879361|gb|EFN10579.1| ABC transporter related protein [Sphingobium chlorophenolicum L-1]
          Length = 261

 Score =  274 bits (701), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 135/237 (56%), Positives = 173/237 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LS  S+ K Y+   V+  V L V  GE+VGLLGPNGAGKTT FY + GL+  D G I +D
Sbjct: 25  LSVISIAKSYDKRVVLADVSLTVGKGEVVGLLGPNGAGKTTCFYSVMGLVRPDHGRIVLD 84

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DIT +PMYRR+ LG+ YLPQE SIFRGLTV +NI AVLE+ E DK  R  +L+ LL+E
Sbjct: 85  GQDITGLPMYRRSILGLGYLPQETSIFRGLTVAQNIGAVLELAEPDKAARQARLEQLLEE 144

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T+ R   A  LSGG+RRR EIAR+L + PS +LLDEPFAG+DP++I+DI  L++ L 
Sbjct: 145 FGLTRLRDSSAMALSGGERRRCEIARALAANPSIVLLDEPFAGIDPLSIADIRGLVKQLK 204

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           +RGIG+LITDHNV E L ++DRA II+ G +L  G+  E++ N DVRRLYLG+ F+ 
Sbjct: 205 TRGIGVLITDHNVRETLEIVDRACIIYDGKMLFAGSPTELVANADVRRLYLGENFSL 261


>gi|193211973|ref|YP_001997926.1| ABC transporter related [Chlorobaculum parvum NCIB 8327]
 gi|193085450|gb|ACF10726.1| ABC transporter related [Chlorobaculum parvum NCIB 8327]
          Length = 244

 Score =  274 bits (701), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 169/239 (70%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+LS   L K YN   VVK   + VK GEIVGLLGPNGAGKTT FYM+ GL+  D+G ++
Sbjct: 3   SILSCKDLKKIYNKREVVKSSSIEVKQGEIVGLLGPNGAGKTTTFYMIVGLVKPDAGEVR 62

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +D  +IT +PMY+RAR GI YLPQEAS+FR LTVE+NIL VLE     K +R EK + +L
Sbjct: 63  LDQEEITHLPMYKRARKGIGYLPQEASVFRKLTVEQNILGVLEFTTLSKAERQEKTEQML 122

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           ++ NI   R+ +   LSGG+RRR EIAR+L   P +ILLDEPFAGVDP+A+ DI  ++  
Sbjct: 123 EDLNIAHIRNSMGYALSGGERRRTEIARALALDPKFILLDEPFAGVDPIAVEDIQQIVEG 182

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  R IG+LITDHNVHE L++ D AY++  G +   GT +EI DN + R++YLG++F  
Sbjct: 183 LVKRNIGVLITDHNVHETLSITDHAYLLFDGSIFMQGTPEEIADNAEARKMYLGEKFTL 241


>gi|259417555|ref|ZP_05741474.1| ABC transporter, ATP-binding protein [Silicibacter sp. TrichCH4B]
 gi|259346461|gb|EEW58275.1| ABC transporter, ATP-binding protein [Silicibacter sp. TrichCH4B]
          Length = 252

 Score =  274 bits (701), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 129/241 (53%), Positives = 174/241 (72%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
            S  S L    + K Y    V++ V + +  GE+V LLGPNG+GKTT FY + GL+  ++
Sbjct: 9   TSGSSGLRIEKMRKSYRKRVVIRDVSMELNRGEVVALLGPNGSGKTTSFYTIAGLVFPEA 68

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G + +DG ++T +PMYRRAR+GI YLPQE SIFRGL+VE+NI AVL++   D  KR E+L
Sbjct: 69  GRVTLDGQNVTSLPMYRRARMGIGYLPQEMSIFRGLSVEDNISAVLDIAVSDDHKRRERL 128

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL +F+I   R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+++ DI  
Sbjct: 129 EELLSDFSIEHLRRAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDPISVGDIRN 188

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L+ DL +RGIG+LITDHNV E L ++DRAYI+H G VL  G+  E+++N++VRR+YLGD 
Sbjct: 189 LVADLKTRGIGVLITDHNVRETLEIVDRAYILHDGQVLMSGSPSEVVENENVRRVYLGDN 248

Query: 260 F 260
           F
Sbjct: 249 F 249


>gi|145641262|ref|ZP_01796842.1| ABC transporter ATP-binding protein [Haemophilus influenzae R3021]
 gi|145274099|gb|EDK13965.1| ABC transporter ATP-binding protein [Haemophilus influenzae
           22.4-21]
          Length = 241

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 136/241 (56%), Positives = 180/241 (74%), Gaps = 3/241 (1%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L+A +L K Y S  VV  V L V   EIVGLLGPNGAGKTT FYM+ GL+  D G I 
Sbjct: 2   SILTAENLAKSYKSRKVVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMVVGLVRQDQGKIV 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD--KKKRHEKLDS 141
           IDG DI+ +PM+ RA+ GI YLPQEASIFR LTV EN++AVLE+  KD   ++R EK D 
Sbjct: 62  IDGEDISLLPMHNRAQRGIGYLPQEASIFRRLTVYENLMAVLEI-RKDLTPQQRREKADE 120

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           L++EFNI   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++SDI  +I
Sbjct: 121 LIEEFNIAHIRDNLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVSDIKKII 180

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
            DL +RG+G+LITDHNV E L + +RAYI+ AG ++A GT +++++++ V+R+YLG++F 
Sbjct: 181 TDLRNRGLGVLITDHNVRETLDVCERAYIVGAGKIIATGTPEQVMNDEQVKRVYLGEQFK 240

Query: 262 F 262
            
Sbjct: 241 L 241


>gi|254474896|ref|ZP_05088282.1| ABC transporter, ATP-binding protein [Ruegeria sp. R11]
 gi|214029139|gb|EEB69974.1| ABC transporter, ATP-binding protein [Ruegeria sp. R11]
          Length = 252

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 171/230 (74%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K Y+   V++ V + +  GE+V LLGPNG+GKTT FY + GL+  ++G++ IDG + T
Sbjct: 20  LRKSYSKKVVIRDVSMSLDRGEVVALLGPNGSGKTTSFYAIAGLVFPEAGTVTIDGQNAT 79

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITK 150
            +PMYRRAR+GI YLPQE SIFRGL+VE+NI +VL++  K   KR E+L+ LL +F+I  
Sbjct: 80  TLPMYRRARMGIGYLPQEMSIFRGLSVEDNISSVLDIAVKHPHKRRERLEELLSDFSIEH 139

Query: 151 WRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIG 210
            R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+++ DI  L+ DL  RGIG
Sbjct: 140 LRRAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDPISVGDIRHLVGDLKKRGIG 199

Query: 211 ILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +LITDHNV E L ++DRAYI+H G VL  GT  E++DN++VRR+YLGD F
Sbjct: 200 VLITDHNVRETLEIVDRAYILHDGKVLMSGTPSEVVDNENVRRVYLGDNF 249


>gi|229846179|ref|ZP_04466291.1| ABC transporter ATP-binding protein [Haemophilus influenzae 7P49H1]
 gi|260581803|ref|ZP_05849599.1| urea ABC transporter, ATP-binding protein UrtE [Haemophilus
           influenzae NT127]
 gi|229811183|gb|EEP46900.1| ABC transporter ATP-binding protein [Haemophilus influenzae 7P49H1]
 gi|260094996|gb|EEW78888.1| urea ABC transporter, ATP-binding protein UrtE [Haemophilus
           influenzae NT127]
 gi|309973385|gb|ADO96586.1| Lipooligosaccharide transporter, ATP-binding protein LptB
           [Haemophilus influenzae R2846]
          Length = 241

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 136/241 (56%), Positives = 181/241 (75%), Gaps = 3/241 (1%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L+A +L K Y S  VV  V L V   EIVGLLGPNGAGKTT FYM+ GL+  D G I 
Sbjct: 2   SILTAENLAKSYKSRKVVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMVVGLVRQDQGKIV 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDK--KKRHEKLDS 141
           IDG DI+ +PM+ RA+ GI YLPQEASIFR LTV EN++AVLE+  KD   ++R EK D 
Sbjct: 62  IDGEDISLLPMHNRAQRGIGYLPQEASIFRRLTVYENLMAVLEI-RKDLTLQQRREKADE 120

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           L++EFNI+  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++SDI  +I
Sbjct: 121 LIEEFNISHIRDNLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVSDIKKII 180

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
            DL +RG+G+LITDHNV E L + +RAYI+ AG ++A GT +++++++ V+R+YLG++F 
Sbjct: 181 TDLRNRGLGVLITDHNVRETLDVCERAYIVGAGKIIATGTPEQVMNDEQVKRVYLGEQFK 240

Query: 262 F 262
            
Sbjct: 241 L 241


>gi|119358044|ref|YP_912688.1| ABC transporter related [Chlorobium phaeobacteroides DSM 266]
 gi|119355393|gb|ABL66264.1| ABC transporter related protein [Chlorobium phaeobacteroides DSM
           266]
          Length = 244

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 170/237 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LS   L K YN   VVK   L VK GEI+GLLGPNGAGKTT FYM+ GL+  D+G + +D
Sbjct: 5   LSCSKLKKIYNKREVVKSSSLEVKQGEIIGLLGPNGAGKTTTFYMIVGLVKPDAGEVFLD 64

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             +I ++PMY+RAR+GI YLPQEAS+FR +TVEENI +VLE     K  + EK + +L++
Sbjct: 65  STNIARLPMYKRARIGIGYLPQEASVFRNMTVEENIRSVLEFSSLPKAAQKEKTEKMLED 124

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
            NIT  R      LSGG+RRR EIAR+L   P +ILLDEPFAGVDP+A+ DI  ++++L 
Sbjct: 125 LNITAVRKNKGYSLSGGERRRTEIARALALDPKFILLDEPFAGVDPIAVEDIQQIVKNLV 184

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            R IG+LITDHNVHE L + D+AY++  G +  HGT +EI +N +VR+LYLG++F+ 
Sbjct: 185 KRDIGVLITDHNVHETLAITDKAYLLFDGSIFIHGTPEEIAENAEVRKLYLGEKFSL 241


>gi|94495999|ref|ZP_01302578.1| ABC transporter related protein [Sphingomonas sp. SKA58]
 gi|94424691|gb|EAT09713.1| ABC transporter related protein [Sphingomonas sp. SKA58]
          Length = 286

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 171/237 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LS  S+ K Y+   V+  V L V  GE+VGLLGPNGAGKTT FY + GL+  D G I +D
Sbjct: 50  LSVISIAKSYDKRVVLSDVSLTVGKGEVVGLLGPNGAGKTTCFYSVMGLVRPDRGRIVLD 109

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DIT +PMYRRA LG+ YLPQE SIFRGL+V +NI AVLE+ E DK  R  +L+ LL E
Sbjct: 110 GQDITGLPMYRRAILGLGYLPQETSIFRGLSVAQNISAVLELAEPDKAARAARLEQLLDE 169

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T+ R   A  LSGG+RRR EIAR+L + PS +LLDEPFAG+DP++I+DI  L++DL 
Sbjct: 170 FGLTRLRDSSAMALSGGERRRCEIARALAANPSIVLLDEPFAGIDPLSIADIRDLVKDLK 229

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           +RGIG+LITDHNV E L ++DRA II+ G VL  G   E++ N +VRRLYLG+ F  
Sbjct: 230 NRGIGVLITDHNVRETLEIVDRACIIYGGQVLFAGNPTELVANTEVRRLYLGENFQL 286


>gi|121606597|ref|YP_983926.1| ABC transporter-like protein [Polaromonas naphthalenivorans CJ2]
 gi|120595566|gb|ABM39005.1| ABC transporter related protein [Polaromonas naphthalenivorans CJ2]
          Length = 265

 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 141/248 (56%), Positives = 177/248 (71%), Gaps = 6/248 (2%)

Query: 19  RASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICAD 78
           RA   S L A  L K Y S  VV+ V L V+ GE+VGLLGPNGAGKTT FYM+ GL+ AD
Sbjct: 16  RAEPPSSLVAQGLRKSYGSRLVVQDVSLSVQKGEVVGLLGPNGAGKTTSFYMIVGLVRAD 75

Query: 79  SGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR--- 135
           +G+I IDG  +  MP+++RARLG+SYLPQEASIFR LTV+EN+ AVLE+      K    
Sbjct: 76  AGAISIDGQPVEHMPIHKRARLGLSYLPQEASIFRKLTVQENVRAVLELQRDASGKPLGR 135

Query: 136 ---HEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPV 192
                +LD+LLK+  +   R   AP LSGG+RRR+EIAR+L + P +ILLDEPFAG+DP+
Sbjct: 136 DALESRLDALLKDLRVDHLRDSPAPSLSGGERRRVEIARALATQPRFILLDEPFAGIDPI 195

Query: 193 AISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVR 252
           A+ +I  +I  L SRGIG+LITDHNV E L + D AYII  G VLA+GT  EI++N DVR
Sbjct: 196 AVIEIQRIIGFLKSRGIGVLITDHNVRETLGICDHAYIISDGHVLANGTPAEIVNNADVR 255

Query: 253 RLYLGDRF 260
           R+YLG+ F
Sbjct: 256 RVYLGEHF 263


>gi|68249697|ref|YP_248809.1| ABC transporter ATP-binding protein [Haemophilus influenzae
           86-028NP]
 gi|68057896|gb|AAX88149.1| probable ABC transporter ATP-binding protein [Haemophilus
           influenzae 86-028NP]
          Length = 241

 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 136/241 (56%), Positives = 180/241 (74%), Gaps = 3/241 (1%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L+A +L K Y S  VV  V L V   EIVGLLGPNGAGKTT FYM+ GL+  D G I 
Sbjct: 2   SILTAENLAKSYKSRKVVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMVVGLVRQDQGKIV 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD--KKKRHEKLDS 141
           IDG DI+ +PM+ RA+ GI YLPQEASIFR LTV EN++AVLE+  KD   ++R EK D 
Sbjct: 62  IDGEDISLLPMHNRAQRGIGYLPQEASIFRRLTVYENLMAVLEI-RKDLTPQQRREKADE 120

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           L++EFNI+  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++SDI  +I
Sbjct: 121 LIEEFNISHIRDNLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVSDIKKII 180

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
            DL +RG+G+LITDHNV E L + +RAYI+ AG ++A GT  ++++++ V+R+YLG++F 
Sbjct: 181 TDLRNRGLGVLITDHNVRETLDVCERAYIVGAGKIIATGTPAQVMNDEQVKRVYLGEQFK 240

Query: 262 F 262
            
Sbjct: 241 L 241


>gi|332526871|ref|ZP_08402964.1| putative ATP-binding ABC transporter protein [Rubrivivax
           benzoatilyticus JA2]
 gi|332111313|gb|EGJ11297.1| putative ATP-binding ABC transporter protein [Rubrivivax
           benzoatilyticus JA2]
          Length = 252

 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 141/247 (57%), Positives = 176/247 (71%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L A +L K Y    VVK V L V  GE+VGLLGPNGAGKTT FYM+ GL+ AD+
Sbjct: 4   AVAGSRLEAENLQKSYGQRRVVKDVHLSVAAGEVVGLLGPNGAGKTTTFYMVVGLVRADA 63

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR---- 135
           G I+IDG  + ++P+++R+RLG+SYLPQEASIFR LTVEENI AVLE+ +    +     
Sbjct: 64  GQIRIDGRPVERLPIHQRSRLGLSYLPQEASIFRKLTVEENIRAVLELQQGPDGRPLKPA 123

Query: 136 --HEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
              E LD LL + +I K R   AP LSGG+RRR+EIARSL + P +ILLDEPFAGVDP+A
Sbjct: 124 QIQELLDKLLHDLSIEKLRDSPAPALSGGERRRVEIARSLATQPRFILLDEPFAGVDPIA 183

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +I  L SRGIG+LITDHNV E L + DRAYII  G VL  GT Q I++N +VR+
Sbjct: 184 VIEIQRIIAFLKSRGIGVLITDHNVRETLGICDRAYIISEGSVLTEGTPQAIVENAEVRK 243

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 244 VYLGEHF 250


>gi|194337531|ref|YP_002019325.1| ABC transporter related [Pelodictyon phaeoclathratiforme BU-1]
 gi|194310008|gb|ACF44708.1| ABC transporter related [Pelodictyon phaeoclathratiforme BU-1]
          Length = 244

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 131/239 (54%), Positives = 169/239 (70%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + LS   L K YN   VVK   + VK GEIVGLLGPNGAGKTT FYM+ GL+  D G + 
Sbjct: 3   ATLSCNKLKKIYNKREVVKSSSIEVKQGEIVGLLGPNGAGKTTTFYMIVGLVRPDGGDVF 62

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +D  +IT++PMY+RARLGI YLPQEAS+FR +TVE+NIL+VLE     K +R E+   +L
Sbjct: 63  LDSANITQLPMYKRARLGIGYLPQEASVFRNMTVEQNILSVLEFTSLSKAERKERTSIML 122

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +E NIT  R  +   LSGG+RRR EIAR+L   P +ILLDEPFAGVDP+A+ DI  ++  
Sbjct: 123 EELNITAIRKSMGYALSGGERRRTEIARALALNPKFILLDEPFAGVDPIAVEDIQQIVEG 182

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           LA R IG+LITDHNVHE L++   AY++  G +  HGT +EI  N +VR++YLG++F  
Sbjct: 183 LAKRDIGVLITDHNVHETLSITHHAYLLFDGSIFMHGTPEEIASNPEVRKMYLGEKFTL 241


>gi|56695008|ref|YP_165353.1| ABC transporter, ATP-binding protein [Ruegeria pomeroyi DSS-3]
 gi|56676745|gb|AAV93411.1| ABC transporter, ATP-binding protein [Ruegeria pomeroyi DSS-3]
          Length = 252

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 126/230 (54%), Positives = 173/230 (75%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K Y    V++ V + +   E+V LLGPNG+GKTT FY + GL+  ++G + IDG ++T
Sbjct: 20  LRKSYRKKTVIRDVTMTLGRSEVVALLGPNGSGKTTTFYSVAGLVFPEAGKVSIDGQNVT 79

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITK 150
            +PMYRRAR+GI YLPQE SIFRGL+VE+NIL+VL++ +K   KR E+L+ LL +F+I  
Sbjct: 80  TLPMYRRARMGIGYLPQEMSIFRGLSVEDNILSVLDITQKHAHKRRERLEELLSDFSIEH 139

Query: 151 WRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIG 210
            R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+++ DI  L+ DL +RGIG
Sbjct: 140 LRRAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDPISVGDIRHLVSDLRNRGIG 199

Query: 211 ILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +LITDHNV E L ++DRAYI+H G VL  G+ +E+++N++VRR+YLG+ F
Sbjct: 200 VLITDHNVRETLEIVDRAYILHDGQVLMSGSPEEVVENENVRRVYLGENF 249


>gi|225075756|ref|ZP_03718955.1| hypothetical protein NEIFLAOT_00772 [Neisseria flavescens
           NRL30031/H210]
 gi|241760788|ref|ZP_04758879.1| ABC transporter, ATP-binding protein [Neisseria flavescens SK114]
 gi|261379303|ref|ZP_05983876.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           subflava NJ9703]
 gi|224952922|gb|EEG34131.1| hypothetical protein NEIFLAOT_00772 [Neisseria flavescens
           NRL30031/H210]
 gi|241318685|gb|EER55237.1| ABC transporter, ATP-binding protein [Neisseria flavescens SK114]
 gi|284797743|gb|EFC53090.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           subflava NJ9703]
          Length = 244

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 131/243 (53%), Positives = 177/243 (72%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           ++ +S L   +L K +    VVK   L ++ GE++GLLGPNGAGKTT FYM+ GLI AD+
Sbjct: 2   SANNSRLVVQNLQKSFKKRQVVKSFSLEIESGEVIGLLGPNGAGKTTSFYMIVGLIAADA 61

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           GS+ +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +L
Sbjct: 62  GSVMLDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEISMKDKSRIDAEL 121

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL + NI + R+  AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  
Sbjct: 122 EKLLADLNIERLRNNPAPSLSGGERRRVEIARVLAMQPRFILLDEPFAGVDPIAVIDIQK 181

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           +I  L SRGIG+LITDHNV E L++ DRAYII  G VLA G   ++++N+ VR +YLG+ 
Sbjct: 182 IIEFLKSRGIGVLITDHNVRETLSICDRAYIISDGTVLASGKPDDLVNNEQVRSVYLGEN 241

Query: 260 FAF 262
           F +
Sbjct: 242 FKY 244


>gi|145633122|ref|ZP_01788854.1| ABC transporter ATP-binding protein [Haemophilus influenzae 3655]
 gi|148828307|ref|YP_001293060.1| ABC transporter ATP-binding protein [Haemophilus influenzae PittGG]
 gi|229844897|ref|ZP_04465035.1| ABC transporter ATP-binding protein [Haemophilus influenzae 6P18H1]
 gi|329124124|ref|ZP_08252671.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Haemophilus aegyptius ATCC
           11116]
 gi|144986348|gb|EDJ92927.1| ABC transporter ATP-binding protein [Haemophilus influenzae 3655]
 gi|148719549|gb|ABR00677.1| ABC transporter ATP-binding protein [Haemophilus influenzae PittGG]
 gi|229812278|gb|EEP47969.1| ABC transporter ATP-binding protein [Haemophilus influenzae 6P18H1]
 gi|327467549|gb|EGF13047.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Haemophilus aegyptius ATCC
           11116]
          Length = 241

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 136/241 (56%), Positives = 180/241 (74%), Gaps = 3/241 (1%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L+A +L K Y S  VV  V L V   EIVGLLGPNGAGKTT FYM+ GL+  D G I 
Sbjct: 2   SILTAENLAKSYKSRKVVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMVVGLVRQDQGKIV 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD--KKKRHEKLDS 141
           IDG DI+ +PM+ RA+ GI YLPQEASIFR LTV EN++AVLE+  KD   ++R EK D 
Sbjct: 62  IDGEDISLLPMHNRAQRGIGYLPQEASIFRRLTVYENLMAVLEI-RKDLTPQQRREKADE 120

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           L++EFNI   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++SDI  +I
Sbjct: 121 LIEEFNIGHIRDNLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVSDIKKII 180

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
            DL +RG+G+LITDHNV E L + +RAYI+ AG ++A GT +++++++ V+R+YLG++F 
Sbjct: 181 TDLRNRGLGVLITDHNVRETLDVCERAYIVGAGKIIATGTPEQVMNDEQVKRVYLGEQFK 240

Query: 262 F 262
            
Sbjct: 241 L 241


>gi|110597822|ref|ZP_01386105.1| ABC transporter related [Chlorobium ferrooxidans DSM 13031]
 gi|110340547|gb|EAT59030.1| ABC transporter related [Chlorobium ferrooxidans DSM 13031]
          Length = 244

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 170/239 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + LS   L K YN   VVK   + VK G+IVGLLGPNGAGKTT FYM+ GL+  D G + 
Sbjct: 3   ATLSCNRLKKIYNKREVVKSSSIEVKQGQIVGLLGPNGAGKTTTFYMIVGLVRPDGGDVF 62

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +D  +IT++PMY+RARLGI YLPQEAS+FR LTVEENIL+VLE     K +R EK D +L
Sbjct: 63  LDSLNITRIPMYKRARLGIGYLPQEASVFRNLTVEENILSVLEFTSLSKPERQEKTDRML 122

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           ++ NIT  R  +   LSGG+RRR EIAR+L   P +ILLDEPFAGVDP+A+ DI  ++  
Sbjct: 123 EDLNITAIRKNMGYTLSGGERRRTEIARALALDPKFILLDEPFAGVDPIAVEDIQQIVEG 182

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  R IG+LITDHNVHE L++   AY++  G +   GT +EI DN +VR++YLG++F+ 
Sbjct: 183 LVRRDIGVLITDHNVHETLSITSHAYLLFDGSIFMQGTPEEIADNPEVRKMYLGEKFSL 241


>gi|291612908|ref|YP_003523065.1| ABC transporter [Sideroxydans lithotrophicus ES-1]
 gi|291583020|gb|ADE10678.1| ABC transporter related protein [Sideroxydans lithotrophicus ES-1]
          Length = 240

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 175/237 (73%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   SL K+Y +  VV+ V L VK GE+VGLLGPNGAGKTT FYM+ GL+ AD G I 
Sbjct: 2   SELRTVSLKKRYRARTVVQDVSLSVKSGEVVGLLGPNGAGKTTSFYMIVGLVAADGGEIF 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           ID  DIT +P++RRARLG++YLPQEASIFR LTV ENI AVLE+      +   +L++LL
Sbjct: 62  IDDQDITHLPIHRRARLGLAYLPQEASIFRRLTVTENIKAVLELQGYAPAEMDARLEALL 121

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + +IT  R   A  LSGG+RRR+EIARSL + P +ILLDEPFAGVDP+A+ DI  +IR 
Sbjct: 122 NDLHITHIRDNPAISLSGGERRRVEIARSLATDPRFILLDEPFAGVDPIAVLDIQKIIRF 181

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L + DRAYII+AG V+A G  +EII N+ VR++YLG+ F
Sbjct: 182 LKERGIGVLITDHNVRETLGICDRAYIINAGSVMAEGKPEEIIYNEGVRKVYLGEHF 238


>gi|88861163|ref|ZP_01135797.1| putative transport protein (ABC superfamily, atp-binding protein)
           [Pseudoalteromonas tunicata D2]
 gi|88816885|gb|EAR26706.1| putative transport protein (ABC superfamily, atp-binding protein)
           [Pseudoalteromonas tunicata D2]
          Length = 241

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 136/240 (56%), Positives = 177/240 (73%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L+A  L K YN   VVK V + VK G IVGLLGPNGAGKTT FYM+ GL+ +D G I 
Sbjct: 2   TTLTATQLAKSYNGRQVVKNVGIEVKAGSIVGLLGPNGAGKTTTFYMIVGLVPSDKGLIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DIT +PM+ RARLGI YLPQE+SIFR LTV +NI+A+LE  +  +K +R E+LD+L
Sbjct: 62  IDDLDITLLPMHSRARLGIGYLPQESSIFRKLTVYQNIMAILETRKGLNKTQREEQLDNL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EFNI   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +IR
Sbjct: 122 LEEFNICHIRDSQGMALSGGERRRVEIARALAAEPKFILLDEPFAGVDPISVIDIKKIIR 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L  RGIG+LITDHNV E L + ++AYI+  G ++A GT +E+++NQ VR +YLG++F  
Sbjct: 182 HLKKRGIGVLITDHNVRETLDVCEKAYIVSHGELIATGTPKEVLENQKVRDVYLGEQFKL 241


>gi|306839604|ref|ZP_07472408.1| ABC transporter ATP-binding protein [Brucella sp. NF 2653]
 gi|306844425|ref|ZP_07477015.1| ABC transporter ATP-binding protein [Brucella sp. BO1]
 gi|306275238|gb|EFM56988.1| ABC transporter ATP-binding protein [Brucella sp. BO1]
 gi|306405302|gb|EFM61577.1| ABC transporter ATP-binding protein [Brucella sp. NF 2653]
          Length = 193

 Score =  272 bits (696), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 157/193 (81%)

Query: 70  MMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYE 129
           M+TGL+ ADSGSI+IDG D+T MPMYRR+RLGI YLPQEASIFRGL+VE NI AVLEV E
Sbjct: 1   MVTGLVPADSGSIEIDGFDVTSMPMYRRSRLGIGYLPQEASIFRGLSVENNIKAVLEVVE 60

Query: 130 KDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGV 189
           KD+ +R  +LD+LL+EF+I   R   A  LSGG+RRRLEIAR+L S P+++LLDEPFAGV
Sbjct: 61  KDRARRASELDALLEEFHIAHLRKAPAISLSGGERRRLEIARALASRPNFMLLDEPFAGV 120

Query: 190 DPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQ 249
           DP+A+SDI  L+R L SRGIG+LITDHNV E L LIDRAYIIHAG VL HG   EI+ N 
Sbjct: 121 DPIAVSDIQQLVRHLTSRGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRPAEIVANP 180

Query: 250 DVRRLYLGDRFAF 262
           DVRRLYLGD+F  
Sbjct: 181 DVRRLYLGDQFTL 193


>gi|332187884|ref|ZP_08389617.1| ABC transporter family protein [Sphingomonas sp. S17]
 gi|332012045|gb|EGI54117.1| ABC transporter family protein [Sphingomonas sp. S17]
          Length = 266

 Score =  272 bits (696), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 174/237 (73%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L   S+ K Y+   V+  V + V  GE++GLLGPNGAGKTT FY + GL+  DSG I +D
Sbjct: 30  LQVVSIAKSYDKRVVLTDVSVSVGRGEVIGLLGPNGAGKTTCFYSVMGLVKPDSGRIMLD 89

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DIT +PMYRRA LG+ YLPQE SIFRGL++E+NI  VLE+ E D  +R  KLD LL+E
Sbjct: 90  GEDITGLPMYRRAILGLGYLPQETSIFRGLSIEKNISTVLELAEPDPAERARKLDRLLEE 149

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T+ R   A  LSGG+RRR EIAR+L + PS +LLDEPFAG+DP++I+DI  L++DL 
Sbjct: 150 FGLTRLRAAPAMALSGGERRRAEIARALAADPSIMLLDEPFAGIDPISIADIRDLVKDLK 209

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            R IG+LITDHNV E L ++DRAYII+ G VL  G+ +E++ + +VRRLYLG+ F+ 
Sbjct: 210 RRDIGVLITDHNVRETLDIVDRAYIIYDGRVLFTGSPEELVADANVRRLYLGEGFSL 266


>gi|126734477|ref|ZP_01750224.1| ABC transporter, ATP-binding protein [Roseobacter sp. CCS2]
 gi|126717343|gb|EBA14207.1| ABC transporter, ATP-binding protein [Roseobacter sp. CCS2]
          Length = 254

 Score =  272 bits (695), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 173/238 (72%)

Query: 23  DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSI 82
           D  L   +L K Y    V++ V + +  GE+V LLGPNG+GKTT FY + GL+  + G +
Sbjct: 14  DVGLHIVNLRKSYRKRPVIRDVSIDLARGEVVALLGPNGSGKTTCFYSIAGLVTPEGGRV 73

Query: 83  KIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSL 142
            IDG D+T +PMYRRA+LGI YLPQE SIFRG++VE+NI+++LE+      +R E+L+ L
Sbjct: 74  IIDGRDVTTLPMYRRAQLGIGYLPQEMSIFRGMSVEDNIMSILEISVSSSHRRRERLEKL 133

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EF+I   R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+A+ +I  L+ 
Sbjct: 134 LSEFSIEHLRRASAMALSGGERRRVEIARCLAAGPKYVLLDEPFAGVDPIAVGEIRHLVA 193

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           DL +RGIG+LITDHNV E L ++DRAYI+H G VL  GT  E+I++++VRR+YLG+ F
Sbjct: 194 DLKNRGIGVLITDHNVQETLQIVDRAYILHDGKVLMSGTTSEVIEDENVRRVYLGNNF 251


>gi|124265342|ref|YP_001019346.1| putative ATP-binding ABC transporter protein [Methylibium
           petroleiphilum PM1]
 gi|124258117|gb|ABM93111.1| putative ATP-binding ABC transporter protein [Methylibium
           petroleiphilum PM1]
          Length = 251

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 141/243 (58%), Positives = 178/243 (73%), Gaps = 6/243 (2%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A  L K Y +  VVK V L V  GE+VGLLGPNGAGKTT FYM+ GL+ AD+G I+
Sbjct: 7   SRLEARGLQKSYGARKVVKDVHLAVAAGEVVGLLGPNGAGKTTSFYMIVGLVRADAGEIR 66

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK----- 138
           IDG  I ++P+++R+RLG+SYLPQEASIFR LTVEENI AVLE+   ++ K + K     
Sbjct: 67  IDGAPIERLPIHQRSRLGLSYLPQEASIFRKLTVEENIRAVLELQFDERGKAYTKARIDE 126

Query: 139 -LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDI 197
            LD LL + +I K R   AP LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+A+ +I
Sbjct: 127 LLDGLLHDLSIDKLRDSPAPALSGGERRRVEIARALATQPRFILLDEPFAGVDPIAVIEI 186

Query: 198 HVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLG 257
             +I  L SRGIG+LITDHNV E L +  RAYII  G VLA GT ++I++N DVR++YLG
Sbjct: 187 QRIIGFLKSRGIGVLITDHNVRETLGICHRAYIISEGRVLAEGTPEQIVENADVRKVYLG 246

Query: 258 DRF 260
           + F
Sbjct: 247 EHF 249


>gi|91215232|ref|ZP_01252204.1| ABC transporter ATP-binding protein [Psychroflexus torquis ATCC
           700755]
 gi|91186837|gb|EAS73208.1| ABC transporter ATP-binding protein [Psychroflexus torquis ATCC
           700755]
          Length = 251

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 133/243 (54%), Positives = 177/243 (72%), Gaps = 4/243 (1%)

Query: 18  NRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICA 77
           NRA+    L A +L K Y  V VVKG+ + V  GEIVGLLGPNGAGKTT FYM+ GLI  
Sbjct: 4   NRAT----LRAENLVKAYKGVKVVKGISVEVTQGEIVGLLGPNGAGKTTSFYMIVGLIKP 59

Query: 78  DSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHE 137
           ++G I +D  +ITK PMY+RA+ GI YL QEASIFR L++E+NI++VLE+ + +KK+R E
Sbjct: 60  NAGHIYLDKTNITKFPMYKRAQNGIGYLAQEASIFRKLSIEDNIMSVLELTDLNKKEREE 119

Query: 138 KLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDI 197
           K++SL+ EF +   R     LLSGG+RRR EIAR+L + P +ILLDEPFAGVDPVA+ DI
Sbjct: 120 KMESLISEFGLNHIRTNRGDLLSGGERRRTEIARALATDPKFILLDEPFAGVDPVAVEDI 179

Query: 198 HVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLG 257
             ++  L ++ IGILITDHNV E L + DR Y++  GG+L HG  +E+ +++ VR++YLG
Sbjct: 180 QKIVAQLKNKNIGILITDHNVQETLAITDRTYLMFEGGILKHGEPEELANDEMVRKVYLG 239

Query: 258 DRF 260
             F
Sbjct: 240 QNF 242


>gi|149185452|ref|ZP_01863768.1| ABC-type transport system ATPase component [Erythrobacter sp.
           SD-21]
 gi|148830672|gb|EDL49107.1| ABC-type transport system ATPase component [Erythrobacter sp.
           SD-21]
          Length = 261

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 132/237 (55%), Positives = 173/237 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L   S+ K Y+   V+  + L V  GE++GLLGPNGAGKTT FY + GL+  D+G I +D
Sbjct: 25  LEVISIAKSYDKRQVLTDISLTVGKGEVLGLLGPNGAGKTTCFYSIMGLVRPDAGRILMD 84

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G D+TK+PMYRRA LG+ YLPQE SIFRG+TVE+NI  VLE+ E +K  R  +LD LL E
Sbjct: 85  GEDVTKLPMYRRAILGLGYLPQETSIFRGMTVEQNINCVLEMVEPNKDTRAAELDRLLDE 144

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T+ R   A  LSGG+RRR EIAR+L + PS +LLDEPFAG+DP++ISDI  L++DL 
Sbjct: 145 FGLTRLRESPAMALSGGERRRAEIARALAAKPSIMLLDEPFAGIDPLSISDIRDLVKDLK 204

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           +RGIG+LITDHNV E L ++DRA II+ G VL  GT   ++ +++V+RLYLG+ F  
Sbjct: 205 TRGIGVLITDHNVRETLEIVDRACIIYGGQVLFAGTPAALVADENVKRLYLGENFTL 261


>gi|83855390|ref|ZP_00948920.1| ABC transporter, ATP-binding protein [Sulfitobacter sp. NAS-14.1]
 gi|83941914|ref|ZP_00954376.1| ABC transporter, ATP-binding protein [Sulfitobacter sp. EE-36]
 gi|83843233|gb|EAP82400.1| ABC transporter, ATP-binding protein [Sulfitobacter sp. NAS-14.1]
 gi|83847734|gb|EAP85609.1| ABC transporter, ATP-binding protein [Sulfitobacter sp. EE-36]
          Length = 252

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 126/230 (54%), Positives = 170/230 (73%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K Y    V++   + +  GE+V LLGPNG+GKTT FY + GL+  + G++ IDG ++T
Sbjct: 20  LRKSYRKKTVIRDFSMELNRGEVVALLGPNGSGKTTTFYAVAGLVMPEGGTVTIDGKNVT 79

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITK 150
            +PMYRRA+LGI YLPQE SIFRGL+V++NI A+L++   D + R E+L++LL EF+I  
Sbjct: 80  TLPMYRRAQLGIGYLPQEMSIFRGLSVQDNISAILDISISDARGRRERLEALLSEFSIEH 139

Query: 151 WRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIG 210
            R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+++ DI  L+ DL  RGIG
Sbjct: 140 LRRAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDPISVDDIRHLVADLKKRGIG 199

Query: 211 ILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +LITDHNV E L ++DRAYI+H G VL  GT +E++ N++VRR+YLGD F
Sbjct: 200 VLITDHNVRETLDIVDRAYILHEGTVLMSGTPEEVVQNENVRRVYLGDNF 249


>gi|332140246|ref|YP_004425984.1| ABC-type transport system ATPase component [Alteromonas macleodii
           str. 'Deep ecotype']
 gi|327550268|gb|AEA96986.1| ABC-type transport system ATPase component [Alteromonas macleodii
           str. 'Deep ecotype']
          Length = 241

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 176/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + LSA +L K Y S  VV+ V L V  G+IVGLLGPNGAGKTT FYM+ GL+  D G I+
Sbjct: 2   ATLSATNLAKAYKSRQVVRDVSLSVSTGQIVGLLGPNGAGKTTTFYMIVGLVNLDKGKIE 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID N++T  PM+ RAR GI YLPQEASIFR LTV ENI+A+L+  +  + +++ E+ D+L
Sbjct: 62  IDDNELTHQPMHERARRGIGYLPQEASIFRKLTVHENIMAILQTRKDLNSQQQEEEADAL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EFNI   R+     LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP++++DI  +I+
Sbjct: 122 LDEFNINHIRNSTGMSLSGGERRRVEIARALAANPQFILLDEPFAGVDPISVNDIKKIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIGILITDHNV E L + ++AYI+  G ++A GT ++++ NQ VR +YLG++F
Sbjct: 182 HLRDRGIGILITDHNVRETLDVCEKAYIVSHGELIAQGTAEQVLSNQKVRDVYLGEQF 239


>gi|331005066|ref|ZP_08328470.1| Lipopolysaccharide ABC transporter, ATP-binding protein LptB [gamma
           proteobacterium IMCC1989]
 gi|330421121|gb|EGG95383.1| Lipopolysaccharide ABC transporter, ATP-binding protein LptB [gamma
           proteobacterium IMCC1989]
          Length = 241

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 175/238 (73%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y    VV  V + V  G+IVGLLGPNGAGKTT FYM+ GL+ AD G+I ID
Sbjct: 4   LHAAHLAKSYKKRPVVIDVSISVNSGQIVGLLGPNGAGKTTCFYMIAGLVPADKGTISID 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
            +DI+ +PM+ RAR GI YLPQEAS+FR LTV +NILA+LE  E+ ++ +R EKL++LL+
Sbjct: 64  EDDISHLPMHGRARAGIGYLPQEASVFRKLTVSDNILAILETREELNRAQRLEKLETLLQ 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EFNIT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP++++DI  +I  L
Sbjct: 124 EFNITHIRDSLGMALSGGERRRVEIARALATEPKFILLDEPFAGVDPISVNDIKQIITHL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             RGIG+LITDHNV E LT+ ++AYI+  G ++A G+  E++ N+ V+ +YLG+ F  
Sbjct: 184 QQRGIGVLITDHNVRETLTICEKAYIVSEGHIIAQGSADEVLQNKQVKDVYLGNNFTL 241


>gi|255066042|ref|ZP_05317897.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           sicca ATCC 29256]
 gi|255049587|gb|EET45051.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           sicca ATCC 29256]
          Length = 244

 Score =  271 bits (693), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 131/239 (54%), Positives = 173/239 (72%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE++GLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 6   SRLVVQNLQKSFKKRQVVKSFSLEIESGEVIGLLGPNGAGKTTSFYMIVGLIAADAGSVT 65

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 66  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEISTKDKSRIDSEVEKLL 125

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI   RH  AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 126 ADLNIGHLRHNPAPSLSGGERRRVEIARVLAMQPRFILLDEPFAGVDPIAVIDIQKIIDF 185

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   ++++N+ VR +YLG+ F +
Sbjct: 186 LKSRGIGVLITDHNVRETLSICDRAYIISDGTVLASGKPDDLVNNEQVRSVYLGENFKY 244


>gi|91774497|ref|YP_544253.1| ABC transporter related [Methylobacillus flagellatus KT]
 gi|91708484|gb|ABE48412.1| ABC transporter related protein [Methylobacillus flagellatus KT]
          Length = 240

 Score =  271 bits (693), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 129/231 (55%), Positives = 174/231 (75%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           SL K+Y S  VV+ + L +  GE+VGLLGPNGAGKTT FYMM GL+  D G I ++G D+
Sbjct: 8   SLRKQYKSRTVVQDISLQLNSGEVVGLLGPNGAGKTTSFYMMVGLVPLDGGRILLNGKDL 67

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           ++MP+++RAR+G++YLPQE SIFR +TV ENI A+LE+ E   ++++E+L+SLL+E +IT
Sbjct: 68  SRMPIHQRARMGLAYLPQEPSIFRKMTVTENIQAILELQEMTAEQQNEQLESLLQELHIT 127

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             R+ +A  LSGG+RRR+EIAR L + PS+ILLDEPFAG+DP+A+ DI  ++R L  R I
Sbjct: 128 HIRNSMAVSLSGGERRRVEIARCLATNPSFILLDEPFAGIDPIAVLDIQKIVRFLTERNI 187

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           G+LITDHNV E L + DRAYI++ G V A G   EII N+ VR +YLG  F
Sbjct: 188 GVLITDHNVRETLGICDRAYIVNEGRVFASGKPSEIIHNESVREVYLGKDF 238


>gi|284049008|ref|YP_003399347.1| ABC transporter related protein [Acidaminococcus fermentans DSM
           20731]
 gi|283953229|gb|ADB48032.1| ABC transporter related protein [Acidaminococcus fermentans DSM
           20731]
          Length = 239

 Score =  271 bits (693), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 131/235 (55%), Positives = 171/235 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           + A  L K+Y    VV  V L V+ G IVGLLGPNGAGKTT FYM+ GL   D+G + +D
Sbjct: 3   IRAEKLVKEYAGRRVVNEVSLEVEQGTIVGLLGPNGAGKTTSFYMIVGLEHPDTGHVYLD 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             D+T +PMY+RA  GI YLPQEASIFR LTVEENI+A+LE  E DK KR +K++ L++E
Sbjct: 63  DEDVTHLPMYKRALKGIGYLPQEASIFRKLTVEENIMAILEEIEPDKAKRQQKMEDLIQE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F+I   R      LSGG+RRR+EIAR+L + P +ILLDEPFAG+DP+A++DI V++  LA
Sbjct: 123 FHIDHIRKSKGSALSGGERRRVEIARALATDPGFILLDEPFAGIDPIAVADIQVMVAHLA 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            RGIG+LITDHNV E L++++RAYI+ AG +L  GT Q++  +   R+ YLGD F
Sbjct: 183 RRGIGVLITDHNVRETLSIVNRAYILSAGKILVEGTSQQVAGDPVARKFYLGDNF 237


>gi|145219168|ref|YP_001129877.1| ABC transporter related [Prosthecochloris vibrioformis DSM 265]
 gi|145205332|gb|ABP36375.1| ABC transporter related protein [Chlorobium phaeovibrioides DSM
           265]
          Length = 247

 Score =  271 bits (693), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 127/240 (52%), Positives = 174/240 (72%)

Query: 23  DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSI 82
           +S+LS   L K YN   VVKG  + V+ GEIVGLLGPNGAGKTT FYM+ GL+  D G +
Sbjct: 5   NSILSCSGLQKAYNRHLVVKGSSIEVRQGEIVGLLGPNGAGKTTTFYMIVGLVKPDGGDV 64

Query: 83  KIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSL 142
            +D  +IT++PMY+RARLGI YLPQEAS+FR +TVEENIL+VLE  +  + ++ E+ + +
Sbjct: 65  FLDSTNITEVPMYKRARLGIGYLPQEASVFRNMTVEENILSVLEFTDLTRPQQLERTEMM 124

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L++ +I   R  +   LSGG+RRR EIAR+L   P +ILLDEPFAGVDP+A+ DI  ++ 
Sbjct: 125 LEDLSIKNIRKSMGYALSGGERRRTEIARALALNPKFILLDEPFAGVDPIAVEDIQQIVE 184

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L  R IG+LITDHNVHE L++   AY++  G +  HGT +EI +N +VR++YLG++F+ 
Sbjct: 185 GLVRRNIGVLITDHNVHETLSITSHAYLLFDGSLFMHGTPEEIANNPEVRKMYLGEKFSL 244


>gi|319940819|ref|ZP_08015158.1| HAAT family ABC-type transporter [Sutterella wadsworthensis
           3_1_45B]
 gi|319805701|gb|EFW02482.1| HAAT family ABC-type transporter [Sutterella wadsworthensis
           3_1_45B]
          Length = 258

 Score =  271 bits (692), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 141/253 (55%), Positives = 178/253 (70%), Gaps = 7/253 (2%)

Query: 17  ENRASKDS-LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLI 75
           ++RA K +  L+A  L K Y S  VVKGVDL VK GE+VGLLGPNGAGKTT FYM+ GL+
Sbjct: 6   DDRAHKHTHTLAARGLKKNYGSRQVVKGVDLSVKSGEVVGLLGPNGAGKTTTFYMVVGLV 65

Query: 76  CADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK----- 130
            AD G I++DG  I ++P+Y+RARLG+SYLPQEAS+FR L+VE+NI A+LE+        
Sbjct: 66  VADGGDIELDGRSIARLPIYKRARLGVSYLPQEASVFRKLSVEDNIRAILEMQVDENGRA 125

Query: 131 -DKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGV 189
            D  +   +L+ LL E  I   R   A  LSGG+RRR EIAR+L + P +ILLDEPFAGV
Sbjct: 126 LDTSEIEHRLEMLLDELQIKHLRTNAALSLSGGERRRTEIARALAANPRFILLDEPFAGV 185

Query: 190 DPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQ 249
           DP+A+ +I  ++R L  R IG+LITDHNV E L + D AYII+ G VLA G  Q+II+N 
Sbjct: 186 DPIAVIEIQRIVRFLRDRNIGVLITDHNVRETLAICDHAYIINEGRVLASGDPQDIINNP 245

Query: 250 DVRRLYLGDRFAF 262
           DVR  YLGD F+ 
Sbjct: 246 DVRAFYLGDNFSM 258


>gi|119713540|gb|ABL97592.1| ABC transporter ATP-binding protein [uncultured marine bacterium
           EB0_39F01]
          Length = 222

 Score =  271 bits (692), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 130/217 (59%), Positives = 163/217 (75%)

Query: 44  VDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYRRARLGIS 103
           VDL ++ GE+V LLGPNGAGKTT FY + GLI  D GS+ +DG D T +PMYRRA+LG+ 
Sbjct: 4   VDLKLQKGEVVALLGPNGAGKTTCFYSIAGLISPDKGSVTVDGFDATNLPMYRRAQLGLG 63

Query: 104 YLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQ 163
           YLPQEASIFRGL VE+NI AV E++   K +  E+++ LL EF+I+  R   A  LSGG+
Sbjct: 64  YLPQEASIFRGLNVEQNISAVSELWANSKAESKERVEELLNEFSISHIRKSPAISLSGGE 123

Query: 164 RRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIGILITDHNVHEILT 223
           RRR+EIAR L + P YILLDEPFAGVDP+A+ DI  L+  L  + IG+LITDHNV E L 
Sbjct: 124 RRRVEIARCLAANPKYILLDEPFAGVDPIAVGDIRFLVAQLKEKEIGVLITDHNVRETLE 183

Query: 224 LIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +IDRAYI+H G VL  GT +++I+N DVRR+YLGD F
Sbjct: 184 IIDRAYILHDGKVLMSGTPEQVIENNDVRRVYLGDDF 220


>gi|260431732|ref|ZP_05785703.1| ABC transporter, ATP-binding protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415560|gb|EEX08819.1| ABC transporter, ATP-binding protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 252

 Score =  271 bits (692), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 129/241 (53%), Positives = 173/241 (71%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L    L K Y    V++ V + +   E+V LLGPNG+GKTT FY + GL+  ++
Sbjct: 9   ADGSSGLKIQKLRKSYRKKTVIRDVSMTLDRSEVVALLGPNGSGKTTTFYSVAGLVFPEA 68

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G++ IDG ++T +PMYRRAR+GI YLPQE SIFRGL+VE+NI AVL+V  +   +R E+L
Sbjct: 69  GTVSIDGQNVTTLPMYRRARMGIGYLPQEMSIFRGLSVEDNIAAVLDVTVRHAHRRKERL 128

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL +F+I   R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+++ DI  
Sbjct: 129 EELLSDFSIEHLRRAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDPISVGDIRH 188

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L+ DL  RGIG+LITDHNV E L ++DRAYI+H G VL  GT  E+++N++VRR+YLG+ 
Sbjct: 189 LVADLKKRGIGVLITDHNVRETLEIVDRAYILHDGQVLMSGTPDEVVENENVRRVYLGEN 248

Query: 260 F 260
           F
Sbjct: 249 F 249


>gi|239996754|ref|ZP_04717278.1| Unclassified ABC-type transport system, ATPase component
           [Alteromonas macleodii ATCC 27126]
          Length = 241

 Score =  271 bits (692), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 176/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + LSA +L K Y S  VV+ V L V  G+IVGLLGPNGAGKTT FYM+ GL+  D G I+
Sbjct: 2   ATLSAKNLAKAYKSRQVVRDVSLSVSTGQIVGLLGPNGAGKTTTFYMIVGLVNLDKGKIE 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID N++T  PM+ RAR GI YLPQEASIFR LTV ENI+A+L+  +  + +++ E+ D+L
Sbjct: 62  IDDNELTHQPMHERARRGIGYLPQEASIFRKLTVHENIMAILQTRKDLNSQQQEEEADAL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EFNI   R+     LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP++++DI  +I+
Sbjct: 122 LDEFNINHIRNSTGMSLSGGERRRVEIARALAAKPQFILLDEPFAGVDPISVNDIKKIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIGILITDHNV E L + ++AYI+  G ++A GT ++++ NQ VR +YLG++F
Sbjct: 182 HLRDRGIGILITDHNVRETLDVCEKAYIVSHGELIAQGTAEQVLSNQKVRDVYLGEQF 239


>gi|329117984|ref|ZP_08246697.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327465872|gb|EGF12144.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 244

 Score =  271 bits (692), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 173/239 (72%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A +L K +    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GLI AD+GSI 
Sbjct: 6   SRLIARNLQKSFKKRQVVKDFSLDIESGEVVGLLGPNGAGKTTSFYMIVGLIAADAGSIT 65

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +L+ LL
Sbjct: 66  LDGRELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEISIKDKGRIEAELERLL 125

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI + R   AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 126 SDLNIERLRRSPAPALSGGERRRVEIARVLAMQPRFILLDEPFAGVDPIAVIDIQKIIGF 185

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  RGIG+LITDHNV E L + DRA+II  G VLA G  +E++DN+ VR +YLG+ F +
Sbjct: 186 LKERGIGVLITDHNVRETLRICDRAFIISDGAVLATGRPEELVDNEQVRAVYLGENFNY 244


>gi|87198321|ref|YP_495578.1| ABC transporter related [Novosphingobium aromaticivorans DSM 12444]
 gi|87134002|gb|ABD24744.1| ABC transporter related protein [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 267

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 134/237 (56%), Positives = 171/237 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L   S+ K Y+   V+  + L V  GE++GLLGPNGAGKTT FY + GL+  DSG I +D
Sbjct: 31  LEVVSIAKSYDKRAVLTDISLSVGKGEVLGLLGPNGAGKTTCFYSIMGLVRPDSGRILLD 90

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DITK+PMYRRA LG+ YLPQE SIFRG+TVE+NI  VLE+ E DK  R  +L+ LL E
Sbjct: 91  GVDITKLPMYRRAILGLGYLPQETSIFRGMTVEQNISTVLELIEPDKATREAELERLLDE 150

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F + + R   A  LSGG+RRR EIAR+L + PS ILLDEPFAG+DP++ISDI  L++DL 
Sbjct: 151 FGLARLRSSPAMALSGGERRRCEIARALAARPSIILLDEPFAGIDPLSISDIRHLVKDLK 210

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIG+LITDHNV E L ++DRA II+ G VL  G+ + ++ + +VRRLYLG+ F  
Sbjct: 211 GRGIGVLITDHNVRETLDIVDRACIIYGGQVLFAGSPEALVADANVRRLYLGEGFTL 267


>gi|149925776|ref|ZP_01914040.1| ABC transporter related protein [Limnobacter sp. MED105]
 gi|149825893|gb|EDM85101.1| ABC transporter related protein [Limnobacter sp. MED105]
          Length = 251

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 136/235 (57%), Positives = 172/235 (73%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A SL K Y S  V++ V L+V  GE+VGLLGPNGAGKTT FYM+ GL+ AD G+I ++
Sbjct: 15  LQALSLRKAYRSKRVIEDVSLHVDTGEVVGLLGPNGAGKTTCFYMIVGLVSADEGNICLE 74

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DIT  P++ RAR G+SYLPQEAS+FR LTVE+NI AVLE+     K   + ++ LL +
Sbjct: 75  GRDITLQPIHERARAGLSYLPQEASVFRKLTVEDNIRAVLEINPPRDKTVDQAVEDLLND 134

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
             I   R  LA  LSGG+RRRLEIAR+L S P +ILLDEPFAGVDP+A+ +I  ++  L 
Sbjct: 135 LQIAHIRTSLAASLSGGERRRLEIARALGSQPRFILLDEPFAGVDPIAVLEIQRIVAFLK 194

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           S+GIG+LITDHNV E L + DRAYII AG VLA G+ ++I+ N DVRR+YLG+ F
Sbjct: 195 SKGIGVLITDHNVRETLGICDRAYIISAGRVLASGSPEQIVKNDDVRRVYLGEHF 249


>gi|261365377|ref|ZP_05978260.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           mucosa ATCC 25996]
 gi|288566173|gb|EFC87733.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           mucosa ATCC 25996]
          Length = 244

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 131/239 (54%), Positives = 173/239 (72%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE++GLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 6   SRLVVQNLQKSFKKRQVVKSFSLEIESGEVIGLLGPNGAGKTTSFYMIVGLIAADAGSVT 65

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 66  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEISTKDKNRIDGEVEKLL 125

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI   RH  AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 126 ADLNIGHLRHNPAPSLSGGERRRVEIARVLAMKPRFILLDEPFAGVDPIAVIDIQKIIDF 185

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   ++++N+ VR +YLG+ F +
Sbjct: 186 LKSRGIGVLITDHNVRETLSICDRAYIISDGTVLASGKPDDLVNNEQVRSVYLGENFKY 244


>gi|326386595|ref|ZP_08208217.1| ABC transporter related protein [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208910|gb|EGD59705.1| ABC transporter related protein [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 263

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 171/237 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L   S+ K Y+   ++  + L V  GE+VGLLGPNGAGKTT FY + GL+  DSG I +D
Sbjct: 27  LEVVSIAKSYDKRAILTDISLSVGKGEVVGLLGPNGAGKTTCFYSIMGLVKPDSGRILLD 86

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DIT++PMYRRA LG+ YLPQE SIFRGLTVE+NI  VLE+ E D+  R  +L+ LL E
Sbjct: 87  GVDITRLPMYRRAILGLGYLPQETSIFRGLTVEQNIATVLELIEPDRPTREAELERLLDE 146

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F + + R   A  LSGG+RRR EIAR+L + PS ILLDEPFAG+DP++ISDI  L++DL 
Sbjct: 147 FGLARLRASPAMALSGGERRRCEIARALAARPSIILLDEPFAGIDPLSISDIRHLVKDLK 206

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIG+LITDHNV E L ++DRA II+ G VL  G+ + ++ + +VRRLYLG+ F  
Sbjct: 207 RRGIGVLITDHNVRETLDIVDRACIIYGGQVLFAGSPEALVADPNVRRLYLGEGFTL 263


>gi|262038166|ref|ZP_06011563.1| lipopolysaccharide export system ATP-binding protein LptB
           [Leptotrichia goodfellowii F0264]
 gi|261747814|gb|EEY35256.1| lipopolysaccharide export system ATP-binding protein LptB
           [Leptotrichia goodfellowii F0264]
          Length = 244

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 173/237 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           + A +L K Y +  VVK V L ++ GE+VGLLGPNGAGKTT FYM+TG+I  ++G +  +
Sbjct: 7   IEADNLKKIYRNREVVKNVSLSMEKGEVVGLLGPNGAGKTTTFYMITGIIKPNNGRVTYN 66

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DIT  PMY+RARLG+ YLPQEAS+FR LTVEENI++VLE+    KK+R  K+ SL++E
Sbjct: 67  GEDITNFPMYKRARLGLGYLPQEASVFRNLTVEENIISVLEMRGIPKKERIAKMSSLIEE 126

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T     L   LSGG+RRR+EIAR++ + P +ILLDEPFAGVDP+A+ DI  +I  L 
Sbjct: 127 FKLTHVAKSLGYALSGGERRRVEIARTISTNPDFILLDEPFAGVDPIAVEDIQNIIMQLK 186

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RG+GILITDHNV E L + +RAYI+  G +L  GT +EI +N+  R++YLGD F  
Sbjct: 187 KRGLGILITDHNVRETLRITERAYIMAEGTILISGTGEEIANNETARKVYLGDNFKL 243


>gi|194334736|ref|YP_002016596.1| ABC transporter-like protein [Prosthecochloris aestuarii DSM 271]
 gi|194312554|gb|ACF46949.1| ABC transporter related [Prosthecochloris aestuarii DSM 271]
          Length = 244

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 129/240 (53%), Positives = 171/240 (71%)

Query: 23  DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSI 82
           +S LS   L K YN   VVK   + V+ GEIVGLLGPNGAGKTT FYM+ GL+  D G +
Sbjct: 2   NSTLSCHKLKKIYNKREVVKNSTIEVRQGEIVGLLGPNGAGKTTTFYMIVGLVRPDGGDV 61

Query: 83  KIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSL 142
            +D  +IT +PM+RRARLGI YLPQEAS+FR +TVE+NI +VLE     + ++HE+ + +
Sbjct: 62  FLDSTEITPLPMFRRARLGIGYLPQEASVFRKMTVEDNIRSVLEFSPLTRDQQHERTEQM 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L++FNIT  R  +   LSGG+RRR EIAR+L   P +ILLDEPFAGVDP+A+ DI  ++R
Sbjct: 122 LEDFNITHIRKNMGYSLSGGERRRTEIARALALNPKFILLDEPFAGVDPIAVEDIQEIVR 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           +L  R IGILITDHNVHE L++   AY++  G +   GT  EI D+ + R+LYLG++F+ 
Sbjct: 182 NLVKRNIGILITDHNVHETLSITSHAYLMFDGAIFMQGTPAEIADDPEARKLYLGEKFSL 241


>gi|52841072|ref|YP_094871.1| ABC transporter, ATP binding protein [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54293811|ref|YP_126226.1| hypothetical protein lpl0867 [Legionella pneumophila str. Lens]
 gi|54296857|ref|YP_123226.1| hypothetical protein lpp0898 [Legionella pneumophila str. Paris]
 gi|148360518|ref|YP_001251725.1| ABC transporter ATP binding protein [Legionella pneumophila str.
           Corby]
 gi|296106415|ref|YP_003618115.1| ABC-type transport system protein involved in lipoprotein release,
           ATPase compnent [Legionella pneumophila 2300/99 Alcoy]
 gi|52628183|gb|AAU26924.1| ABC transporter, ATP binding protein [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53750642|emb|CAH12049.1| hypothetical protein lpp0898 [Legionella pneumophila str. Paris]
 gi|53753643|emb|CAH15101.1| hypothetical protein lpl0867 [Legionella pneumophila str. Lens]
 gi|148282291|gb|ABQ56379.1| ABC transporter, ATP binding protein [Legionella pneumophila str.
           Corby]
 gi|295648316|gb|ADG24163.1| ABC-type transport system protein involved in lipoprotein release,
           ATPase compnent [Legionella pneumophila 2300/99 Alcoy]
 gi|307609628|emb|CBW99132.1| hypothetical protein LPW_09171 [Legionella pneumophila 130b]
          Length = 241

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 136/240 (56%), Positives = 174/240 (72%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           SLL A  L K +    VV GV +++K GE VGLLGPNGAGKTT FYM+ GL   D G I 
Sbjct: 2   SLLEAKQLKKSFKGRTVVNGVSIHIKQGECVGLLGPNGAGKTTCFYMIVGLQSCDEGHII 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ++G DIT+  M+ RAR GISYLPQEAS+FR LTV ENI+A+LE+ +  D +KR EKLD L
Sbjct: 62  LNGTDITQDAMHLRARHGISYLPQEASVFRKLTVAENIMAILELRKDLDDQKREEKLDLL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I+   + L   LSGG+RRR+EIAR+L   PS+ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHISHIENSLGMALSGGERRRVEIARALAIEPSFILLDEPFAGVDPISVIDIKKIIL 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L  +GIG+LITDHNV E L + +RAYI+  G +L  GT + I+ NQ VR++YLG+ FA 
Sbjct: 182 HLCDKGIGVLITDHNVRETLDICERAYIVSQGKILCEGTPKAILANQQVRQVYLGEEFAL 241


>gi|319791176|ref|YP_004152816.1| ABC transporter [Variovorax paradoxus EPS]
 gi|315593639|gb|ADU34705.1| ABC transporter related protein [Variovorax paradoxus EPS]
          Length = 264

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 143/261 (54%), Positives = 175/261 (67%), Gaps = 10/261 (3%)

Query: 10  IEMPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFY 69
           IE    QE      S L A  L K Y S  VVK V L V+ GE+VGLLGPNGAGKTT FY
Sbjct: 2   IETAGIQEANTVPGSRLVARGLQKSYGSRTVVKDVSLDVQKGEVVGLLGPNGAGKTTSFY 61

Query: 70  MMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYE 129
           M+ GL+ AD+G I IDG  I  MP++RRAR+G+SYLPQEASIFR LTVEEN+ AVLE+  
Sbjct: 62  MIVGLVRADAGEITIDGEPIAHMPIHRRARMGLSYLPQEASIFRKLTVEENVRAVLELQR 121

Query: 130 K----------DKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSY 179
           +           KK   E+L  LL +  +   R   A  LSGG+RRR+EIAR+L + P +
Sbjct: 122 EPDENGKVVALSKKHIEERLSELLTDLRVDHLRDSPALALSGGERRRVEIARALATQPRF 181

Query: 180 ILLDEPFAGVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAH 239
           ILLDEPFAG+DP+A+ +I  +I  L  RGIG+LITDHNV E L + D A+II  G VLA 
Sbjct: 182 ILLDEPFAGIDPIAVIEIQRIISFLKERGIGVLITDHNVRETLGICDHAFIISDGHVLAQ 241

Query: 240 GTVQEIIDNQDVRRLYLGDRF 260
           GT  EI+DN +VRR+YLG+ F
Sbjct: 242 GTPSEIVDNAEVRRVYLGEHF 262


>gi|262273851|ref|ZP_06051664.1| lipopolysaccharide ABC transporter ATP-binding protein LptB
           [Grimontia hollisae CIP 101886]
 gi|262222266|gb|EEY73578.1| lipopolysaccharide ABC transporter ATP-binding protein LptB
           [Grimontia hollisae CIP 101886]
          Length = 241

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 178/238 (74%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L+A +L K YN   VV  V L VK GEIVGLLGPNGAGKTT FYM+ GL+  D G+IK
Sbjct: 2   AILTAQNLAKSYNGRKVVTDVSLEVKSGEIVGLLGPNGAGKTTSFYMIVGLVARDEGTIK 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID  DI+  PM+ R+RLGI YLPQEASIFR L+V +N++AVL+   E  K++R +K + L
Sbjct: 62  IDDLDISIQPMHNRSRLGIGYLPQEASIFRKLSVYDNLMAVLQTRSELTKEERQDKAEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EFNI   R+ +   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LDEFNIQHIRNSMGMALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L++ + AYI+  G ++AHGT  E+++++ V+R+YLGD+F
Sbjct: 182 HLRDRGLGVLITDHNVRETLSVCEHAYIVSQGHLIAHGTPDEVLNDEHVKRVYLGDQF 239


>gi|268316164|ref|YP_003289883.1| ABC transporter-like protein [Rhodothermus marinus DSM 4252]
 gi|262333698|gb|ACY47495.1| ABC transporter related protein [Rhodothermus marinus DSM 4252]
          Length = 249

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 126/243 (51%), Positives = 175/243 (72%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A + + L A  L K+Y   +VV+ V L V+ GEIVGLLGPNGAGKTT FYM+ G++  ++
Sbjct: 3   APETTELRAEGLFKRYRKRFVVQDVSLRVRQGEIVGLLGPNGAGKTTTFYMIVGMVRPNA 62

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G I +   +IT +PMYRRARLG+ YL QEASIFR LTVEEN+ AVLE     + +R  ++
Sbjct: 63  GKIFLGDREITHLPMYRRARLGVGYLAQEASIFRQLTVEENLEAVLEFQPLSRAERRARV 122

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL+EF + + R     +LSGG+RRR EIAR+L + P ++LLDEPFAG+DP+A+ ++  
Sbjct: 123 EQLLQEFGLERVRRSKGYMLSGGERRRTEIARALATRPRFLLLDEPFAGIDPIAVEELMA 182

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L+ DL +RGIG+LITDHNVHE L + DRAY+++ G +  HGT +E+  + +VRR YLG++
Sbjct: 183 LVADLRARGIGVLITDHNVHETLAITDRAYLLYEGHIFQHGTAEELAADPEVRRRYLGEK 242

Query: 260 FAF 262
           F  
Sbjct: 243 FTL 245


>gi|260914443|ref|ZP_05920912.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Pasteurella dagmatis ATCC
           43325]
 gi|260631544|gb|EEX49726.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Pasteurella dagmatis ATCC
           43325]
          Length = 241

 Score =  269 bits (688), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 179/240 (74%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L A +L K Y S  VV  V L V   EIVGLLGPNGAGKTT FYM+ GL+  D G+I+
Sbjct: 2   SILHAENLAKSYKSRQVVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMVVGLVNHDHGTIR 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +PM+ RA+ GI YLPQEASIFR LTV EN++AVLE+ +  ++++R  + D L
Sbjct: 62  IDDEDISLLPMHNRAQRGIGYLPQEASIFRRLTVYENLMAVLEIRKDLNQEQRRARADEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EFNI   R+ L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 IEEFNIGHIRNSLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIM 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           DL  RG+G+LITDHNV E L + +RAYI+ AG ++A GT +EI++N+ V+R+YLG++F  
Sbjct: 182 DLRDRGLGVLITDHNVRETLDVCERAYIVSAGKMIATGTPEEILNNEHVKRVYLGEQFKL 241


>gi|78186176|ref|YP_374219.1| ATPase [Chlorobium luteolum DSM 273]
 gi|78166078|gb|ABB23176.1| ATPase [Chlorobium luteolum DSM 273]
          Length = 244

 Score =  269 bits (688), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 128/239 (53%), Positives = 169/239 (70%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + LS   L K YN   VV+  ++ V  GEIVGLLGPNGAGKTT FYM+ GL+  D G + 
Sbjct: 3   ATLSCTGLQKSYNKHLVVRDSNIAVSQGEIVGLLGPNGAGKTTTFYMIVGLVRPDRGDVF 62

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +D  +ITK PMY+RARLGI YLPQEAS+FR +TVEENILAVLE  +  K ++ EK D +L
Sbjct: 63  LDSRNITKEPMYKRARLGIGYLPQEASVFRNMTVEENILAVLEFTDMPKARQQEKTDMML 122

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           ++  I+  R  +   LSGG+RRR EIAR+L   P +IL DEPFAGVDP+A+ DI  ++  
Sbjct: 123 EDLGISAIRKSMGYALSGGERRRTEIARALALDPKFILFDEPFAGVDPIAVEDIQQIVEG 182

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  R IG+LITDHNVHE L++ + AY++  G +  HGT +EI  + +VRR+YLG++F+ 
Sbjct: 183 LVKRNIGVLITDHNVHETLSITNHAYLLFDGSLFMHGTPEEIASHPEVRRMYLGEKFSL 241


>gi|254303691|ref|ZP_04971049.1| ABC superfamily ATP binding cassette transporter ABC protein
           [Fusobacterium nucleatum subsp. polymorphum ATCC 10953]
 gi|148323883|gb|EDK89133.1| ABC superfamily ATP binding cassette transporter ABC protein
           [Fusobacterium nucleatum subsp. polymorphum ATCC 10953]
          Length = 241

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 133/235 (56%), Positives = 170/235 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LSA +L K Y    VV  V L V  GEIVGLLGPNGAGKTT FYM+TG++  DSG +   
Sbjct: 4   LSADNLVKAYKKRKVVDKVSLEVNKGEIVGLLGPNGAGKTTTFYMITGIVKPDSGEVMCA 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             +IT +PMY+RA +GI YL QE S+FR LTVEENI  VLE+    KK++ E +D LL+E
Sbjct: 64  EQNITNLPMYKRADMGIGYLAQEPSVFRNLTVEENIEVVLEMKNISKKEQRETVDRLLEE 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T  R  L   LSGG+RRR+EIAR++ + PS+ILLDEPFAGVDP+A+ DI  +IR L 
Sbjct: 124 FKLTHVRDSLGYSLSGGERRRIEIARTIANNPSFILLDEPFAGVDPIAVEDIQNIIRHLK 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            RG+GILITDHNV E L++ D++YI+  G VL  GT +EI +N + RR+YLG++F
Sbjct: 184 KRGLGILITDHNVRETLSITDKSYIMAKGKVLIEGTPREIANNPEARRIYLGEKF 238


>gi|325205432|gb|ADZ00885.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           meningitidis M04-240196]
          Length = 244

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 131/239 (54%), Positives = 173/239 (72%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 6   SRLVVQNLQKSFKKRQVVKSFSLEIESGEVVGLLGPNGAGKTTSFYMIVGLIAADAGSVT 65

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 66  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEIRTKDKNQIDREIEKLL 125

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI + R+  AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 126 ADLNIERLRNNPAPSLSGGERRRVEIARVLAMKPHFILLDEPFAGVDPIAVIDIQKIIGF 185

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   +++ N+ VR +YLG+ F +
Sbjct: 186 LKSRGIGVLITDHNVRETLSICDRAYIISDGTVLASGKPDDLVGNEQVRSVYLGENFKY 244


>gi|237748919|ref|ZP_04579399.1| ABC transporter ATP-binding protein [Oxalobacter formigenes OXCC13]
 gi|229380281|gb|EEO30372.1| ABC transporter ATP-binding protein [Oxalobacter formigenes OXCC13]
          Length = 247

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 139/243 (57%), Positives = 176/243 (72%), Gaps = 5/243 (2%)

Query: 23  DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSI 82
           +S L    L K Y    VV  V L V  GE+VGLLGPNGAGKTT FYM+ GL+ AD GSI
Sbjct: 3   NSKLVVRHLQKTYGKRTVVSNVSLDVASGEVVGLLGPNGAGKTTSFYMIVGLVPADDGSI 62

Query: 83  KIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD-----KKKRHE 137
            +DG D+T++P+++RA +G+SYLPQEAS+FR L VE+NI AVLE+ +KD     K++   
Sbjct: 63  DLDGVDLTRLPIHKRASMGLSYLPQEASVFRKLNVEDNIRAVLELQKKDGKPLSKEEIEA 122

Query: 138 KLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDI 197
           KLDSLL E  I K R   A  LSGG+RRR+EIAR+L S P +ILLDEPFAG+DP+A+ +I
Sbjct: 123 KLDSLLAELQIEKLRTNSAMSLSGGERRRVEIARALASDPRFILLDEPFAGIDPIAVIEI 182

Query: 198 HVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLG 257
             ++R L  RGIG+LITDHNV E L + D AYII+ G VLA G  +EII+N+ VRR+YLG
Sbjct: 183 QRIVRFLKDRGIGVLITDHNVRETLGICDHAYIINQGTVLASGHPEEIIENESVRRVYLG 242

Query: 258 DRF 260
           + F
Sbjct: 243 EHF 245


>gi|19704030|ref|NP_603592.1| ABC transporter ATP-binding protein [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
 gi|19714222|gb|AAL94891.1| ABC transporter ATP-binding protein [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
          Length = 241

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 134/237 (56%), Positives = 168/237 (70%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LSA SL K Y    VV  V L V  GEIVGLLGPNGAGKTT FYM+TG++  DSG +   
Sbjct: 4   LSADSLVKTYKKRKVVDKVSLEVNKGEIVGLLGPNGAGKTTTFYMITGIVKPDSGQVMCA 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             DIT +PMY+RA +GI YL QE S+FR LTVEENI  VLE+    KK + E +D LL+E
Sbjct: 64  DQDITNLPMYKRADMGIGYLAQEPSVFRNLTVEENIEVVLEMKNISKKMQRETVDRLLEE 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T  R  L   LSGG+RRR+EIAR++ + PS+ILLDEPFAGVDP+A+ DI  +IR L 
Sbjct: 124 FKLTHVRDSLGYSLSGGERRRIEIARTIANNPSFILLDEPFAGVDPIAVEDIQNIIRHLK 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            R +GILITDHNV E L++ D++YI+  G VL  GT +EI +N + RR+YLG++F  
Sbjct: 184 KRDLGILITDHNVRETLSITDKSYIMAKGKVLIEGTPREIANNPEARRIYLGEKFKL 240


>gi|296313582|ref|ZP_06863523.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           polysaccharea ATCC 43768]
 gi|296839815|gb|EFH23753.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           polysaccharea ATCC 43768]
          Length = 254

 Score =  269 bits (687), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 131/239 (54%), Positives = 174/239 (72%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 16  SRLVVQNLQKSFKKRQVVKSFSLEIESGEVVGLLGPNGAGKTTSFYMIVGLIAADAGSVM 75

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 76  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEISTKDKSRIDGEVEKLL 135

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI + R+  AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 136 ADLNIERLRNNPAPSLSGGERRRVEIARVLAMKPHFILLDEPFAGVDPIAVIDIQKIIGF 195

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   ++++N+ VR +YLG+ F +
Sbjct: 196 LKSRGIGVLITDHNVRETLSICDRAYIISDGTVLASGKPDDLVENEQVRSVYLGENFKY 254


>gi|327402851|ref|YP_004343689.1| Fe(3+)-transporting ATPase [Fluviicola taffensis DSM 16823]
 gi|327318359|gb|AEA42851.1| Fe(3+)-transporting ATPase [Fluviicola taffensis DSM 16823]
          Length = 244

 Score =  269 bits (687), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 169/237 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L    + K Y    VVKGV + V  GEIVGLLGPNGAGKTT FYMM GL+  D G + +D
Sbjct: 3   LHTHDIKKTYKGRNVVKGVSIEVSQGEIVGLLGPNGAGKTTSFYMMVGLVKPDEGKVFLD 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             +IT  PMY+R++LGI YLPQE S+FR LTVE+NIL++LE+    K +R EK++ LL+E
Sbjct: 63  DLEITHYPMYKRSQLGIGYLPQEVSVFRKLTVEDNILSILELTNLSKVERVEKMEQLLEE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F++TK R  L   LSGG++RR EIAR+L + P ++LLDEPFAGVDP+A+ DI  ++ DL 
Sbjct: 123 FSLTKVRKNLGNRLSGGEKRRTEIARALATNPKFVLLDEPFAGVDPIAVEDIQSIVSDLR 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            R IGILITDHNV E L++ DRAY++  G +L  GT +E+  ++ VR++YLG  F  
Sbjct: 183 KRNIGILITDHNVQETLSITDRAYLLFEGSILKSGTAEELASDEQVRKVYLGQNFVL 239


>gi|301167869|emb|CBW27454.1| ABC transporter, ATP-binding protein [Bacteriovorax marinus SJ]
          Length = 243

 Score =  269 bits (687), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 174/237 (73%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A +L K Y+   VVK V L V+ GE+VGLLGPNGAGKTT FYM+ GL+ AD G I+
Sbjct: 5   SFLEATNLKKTYSGRTVVKDVSLRVEQGEVVGLLGPNGAGKTTSFYMIVGLVRADEGRIE 64

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           + G+++T+ P++ RA  G+ YLPQEAS+FR LTVEENI AVLE  +  K KR   L+SLL
Sbjct: 65  LSGDELTEFPIHVRALKGVGYLPQEASVFRDLTVEENIYAVLENRKLPKVKRQNLLESLL 124

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           ++F +   R  L   LSGG+RRR+EIAR+L   P ++LLDEPFAGVDP+A+SDI  +IR 
Sbjct: 125 EDFGLGHIRKSLGSALSGGERRRVEIARALALEPRFVLLDEPFAGVDPLAVSDIQGVIRS 184

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L +R IG+LITDHNV E L ++DRAYI+++G +L  GT  EI++N+  R+ YLGD F
Sbjct: 185 LKNRNIGVLITDHNVRETLGIVDRAYIMNSGELLVSGTPDEIVNNERARKFYLGDEF 241


>gi|187927371|ref|YP_001897858.1| ABC transporter-like protein [Ralstonia pickettii 12J]
 gi|241661910|ref|YP_002980270.1| ABC transporter-like protein [Ralstonia pickettii 12D]
 gi|309779928|ref|ZP_07674682.1| lipopolysaccharide ABC transporter, ATP-binding protein [Ralstonia
           sp. 5_7_47FAA]
 gi|187724261|gb|ACD25426.1| ABC transporter related [Ralstonia pickettii 12J]
 gi|240863937|gb|ACS61598.1| ABC transporter related [Ralstonia pickettii 12D]
 gi|308921287|gb|EFP66930.1| lipopolysaccharide ABC transporter, ATP-binding protein [Ralstonia
           sp. 5_7_47FAA]
          Length = 262

 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 136/253 (53%), Positives = 179/253 (70%), Gaps = 5/253 (1%)

Query: 13  PEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMT 72
           P+    +A+  S L    L K+Y +  VVK V L VK GE+VGLLGPNGAGKTT FYM+ 
Sbjct: 8   PKTAAPQATTSSTLVVRHLKKRYGTRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIV 67

Query: 73  GLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDK 132
           GL+  D+G I +DG  I+++P+++RAR+G+SYLPQEAS+FR L V+ENI AVLE+ E++ 
Sbjct: 68  GLVALDAGDIVLDGEHISRLPIHQRARMGLSYLPQEASVFRKLNVQENIRAVLELQEQNG 127

Query: 133 KKRHE-----KLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFA 187
           KK  +     +LD LL +  I   R   A  LSGG+RRR+EIAR+L S P +ILLDEPFA
Sbjct: 128 KKLSQDEVNRRLDGLLDDLQIAHLRDNPALSLSGGERRRVEIARALASSPRFILLDEPFA 187

Query: 188 GVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIID 247
           GVDP+A+ +I  ++  L  R IG+LITDHNV E L + D AYII  G VLA G  ++II+
Sbjct: 188 GVDPIAVGEIQRIVSFLKDRNIGVLITDHNVRETLGICDHAYIISEGTVLAAGMPEQIIE 247

Query: 248 NQDVRRLYLGDRF 260
           N+DVR++YLGD F
Sbjct: 248 NEDVRKVYLGDNF 260


>gi|260779441|ref|ZP_05888332.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260604531|gb|EEX30831.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 241

 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 129/236 (54%), Positives = 176/236 (74%), Gaps = 1/236 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y +  VV  V L V  G+IVGLLGPNGAGKTT FYM+ GL+  D GSI ID
Sbjct: 4   LKAEHLAKTYGNRKVVTDVSLEVTSGQIVGLLGPNGAGKTTSFYMIVGLVARDEGSITID 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
           G DI+ +PM+ R+R+GI YLPQEASIFR L+VE NI+AVLE  E+  +++R +KL+ LL+
Sbjct: 64  GQDISILPMHSRSRMGIGYLPQEASIFRKLSVEHNIMAVLETREELTREQRQDKLEDLLE 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+I   RH     LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I  L
Sbjct: 124 EFHIQHIRHSAGMALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIEHL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             RG+G+LITDHNV E L + ++AYI+  G ++A GT +++++N+ V+++YLG++F
Sbjct: 184 RDRGLGVLITDHNVRETLDVCEKAYIVSQGHLIAEGTPEQVLNNEQVKQVYLGEQF 239


>gi|114764079|ref|ZP_01443318.1| ABC transporter, ATP-binding protein [Pelagibaca bermudensis
           HTCC2601]
 gi|114543437|gb|EAU46452.1| ABC transporter, ATP-binding protein [Roseovarius sp. HTCC2601]
          Length = 252

 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 176/238 (73%)

Query: 23  DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSI 82
           DS L   +L K Y    V++ V L +  GE+V LLGPNG+GKTT FY + GL+  + G +
Sbjct: 12  DSGLRVRNLRKSYKKRVVIRDVTLDLDRGEVVALLGPNGSGKTTTFYAVAGLVNPEGGKV 71

Query: 83  KIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSL 142
            IDG D T MPMYRRARLGI YLPQE SIFRGL+VE+NI AVL++ E D+ +R E+L+ L
Sbjct: 72  TIDGRDATWMPMYRRARLGIGYLPQEMSIFRGLSVEDNITAVLDIAESDRHRRRERLEEL 131

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EF+I   R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP++++DI +L+ 
Sbjct: 132 LGEFSIEHLRRAPALALSGGERRRVEIARCLAASPKYLLLDEPFAGVDPISVNDIRMLVS 191

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           DL +RGIG+LITDHNV E L ++DRAYI+H G VL  GT  E++ N++VRR+YLG+ F
Sbjct: 192 DLKTRGIGVLITDHNVRETLEIVDRAYILHDGKVLMSGTPAEVVQNENVRRVYLGENF 249


>gi|325578771|ref|ZP_08148818.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Haemophilus parainfluenzae
           ATCC 33392]
 gi|301155933|emb|CBW15403.1| predicted transporter subunit: ATP-binding component of ABC
           superfamily [Haemophilus parainfluenzae T3T1]
 gi|325159595|gb|EGC71727.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 241

 Score =  268 bits (686), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 135/241 (56%), Positives = 177/241 (73%), Gaps = 3/241 (1%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L A  L K Y S  VV  V L V   EIVGLLGPNGAGKTT FYM+ GL+  D G I 
Sbjct: 2   SVLQAEFLAKSYKSRKVVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMVVGLVRHDQGKIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD--KKKRHEKLDS 141
           IDG+DI+ +PM+ RAR GI YLPQEASIFR LTV EN++AVLE+  KD   ++R E+ D 
Sbjct: 62  IDGDDISVLPMHERARRGIGYLPQEASIFRRLTVYENLMAVLEI-RKDLTAEQRRERADE 120

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           L+ EFNI   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP++++DI  +I
Sbjct: 121 LIDEFNIGHIRDSLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVTDIKKII 180

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
            DL +RG+G+LITDHNV E L + +RAYI+  G ++A GT +E+++++ V+R+YLG++F 
Sbjct: 181 TDLRNRGLGVLITDHNVRETLDVCERAYIVGEGKIIATGTPEEVMNDEHVKRVYLGEQFK 240

Query: 262 F 262
            
Sbjct: 241 L 241


>gi|254670190|emb|CBA05303.1| ABC transporter [Neisseria meningitidis alpha153]
          Length = 254

 Score =  268 bits (686), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 171/239 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 16  SRLVVQNLQKSFKKRQVVKSFSLEIESGEVVGLLGPNGAGKTTSFYMIVGLIAADAGSVT 75

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 76  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEIRTKDKNQIDREIEKLL 135

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI   R   AP LSGG+RRR+EIAR LV  P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 136 ADLNIGHLRRSPAPSLSGGERRRVEIARVLVMKPHFILLDEPFAGVDPIAVIDIQKIIGF 195

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   +++ N+ VR +YLG  F +
Sbjct: 196 LKSRGIGVLITDHNVRETLSICDRAYIISDGAVLASGKPDDLVGNEQVRSVYLGKNFKY 254


>gi|325130885|gb|EGC53615.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           meningitidis OX99.30304]
          Length = 244

 Score =  268 bits (686), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 173/239 (72%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE++GLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 6   SRLVVQNLQKSFKKRQVVKSFSLEIESGEVIGLLGPNGAGKTTSFYMIVGLIAADAGSVM 65

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 66  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEIRTKDKNQIDREIEKLL 125

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI + R+  AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 126 ADLNIERLRNNPAPSLSGGERRRVEIARVLAMKPHFILLDEPFAGVDPIAVIDIQKIIGF 185

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   +++ N+ VR +YLG+ F +
Sbjct: 186 LKSRGIGVLITDHNVRETLSICDRAYIISDGTVLASGKPDDLVGNEQVRSVYLGENFKY 244


>gi|332529262|ref|ZP_08405225.1| ABC transporter-like protein [Hylemonella gracilis ATCC 19624]
 gi|332041272|gb|EGI77635.1| ABC transporter-like protein [Hylemonella gracilis ATCC 19624]
          Length = 278

 Score =  268 bits (685), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 139/258 (53%), Positives = 182/258 (70%), Gaps = 9/258 (3%)

Query: 9   GIEMPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFF 68
           G+   EF   +AS+   L A +L K Y S   VK V L V+ GE+VGLLGPNGAGKTT F
Sbjct: 22  GVSHAEFDPAQASR---LEARNLKKFYGSREAVKDVSLAVRRGEVVGLLGPNGAGKTTSF 78

Query: 69  YMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY 128
           YM+ GL+ A +G+I+IDG  +  MP+++RAR+G+SYLPQEASIFR L VE+N+ AVLE+ 
Sbjct: 79  YMIVGLVRASAGAIEIDGQRVEHMPIHQRARMGLSYLPQEASIFRKLNVEDNVRAVLELQ 138

Query: 129 EKDKKKR------HEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILL 182
             DK KR        +L SLL++  + K R   +  LSGG+RRR+EIAR+L + P +ILL
Sbjct: 139 HDDKGKRLKRDEIEHRLTSLLQDLRVEKLRLSPSLALSGGERRRVEIARALATQPRFILL 198

Query: 183 DEPFAGVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTV 242
           DEPFAG+DP+A+ +I  +I  L SRG+G+LITDHNV E L + D AYII  G VLA GT 
Sbjct: 199 DEPFAGIDPIAVIEIQRIISFLKSRGLGVLITDHNVRETLGICDHAYIISEGRVLAEGTP 258

Query: 243 QEIIDNQDVRRLYLGDRF 260
            +I++N DVRR+YLG+ F
Sbjct: 259 ADIVNNADVRRVYLGENF 276


>gi|261378334|ref|ZP_05982907.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           cinerea ATCC 14685]
 gi|269145439|gb|EEZ71857.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           cinerea ATCC 14685]
          Length = 254

 Score =  268 bits (685), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 131/239 (54%), Positives = 173/239 (72%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 16  SRLVVQNLQKSFKKRQVVKSFSLEIESGEVVGLLGPNGAGKTTSFYMIVGLIAADAGSVM 75

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 76  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEISTKDKSRIDGEVEKLL 135

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI + R+  AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 136 ADLNIERLRNNPAPSLSGGERRRVEIARVLAMKPHFILLDEPFAGVDPIAVIDIQKIIGF 195

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   +++ N+ VR +YLG+ F +
Sbjct: 196 LKSRGIGVLITDHNVRETLSICDRAYIISEGTVLASGKPDDLVGNEQVRSVYLGENFKY 254


>gi|308388564|gb|ADO30884.1| putative ABC transporter ATP-binding protein [Neisseria
           meningitidis alpha710]
 gi|325136930|gb|EGC59527.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           meningitidis M0579]
          Length = 254

 Score =  268 bits (685), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 173/239 (72%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE++GLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 16  SRLVVQNLQKSFKKRQVVKSFSLEIESGEVIGLLGPNGAGKTTSFYMIVGLIAADAGSVM 75

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 76  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEIRTKDKNQIDREIEKLL 135

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI + R+  AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 136 ADLNIERLRNNPAPSLSGGERRRVEIARVLAMKPHFILLDEPFAGVDPIAVIDIQKIIGF 195

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   +++ N+ VR +YLG+ F +
Sbjct: 196 LKSRGIGVLITDHNVRETLSICDRAYIISDGTVLASGKPDDLVGNEQVRSVYLGENFKY 254


>gi|189502725|ref|YP_001958442.1| hypothetical protein Aasi_1421 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|189498166|gb|ACE06713.1| hypothetical protein Aasi_1421 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 243

 Score =  268 bits (685), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 171/235 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L K+Y    VV      V  GEIVGLLGPNGAGKTT FYM+ GL+  D+G + +D
Sbjct: 3   LRAENLVKQYRKRLVVNHAYAAVSQGEIVGLLGPNGAGKTTTFYMLVGLVKPDAGEVYLD 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
              ITK+PMY+RA+LGISYLPQEASIFR LTVEEN++A+LE      ++R EK++SLL+E
Sbjct: 63  DQPITKLPMYKRAQLGISYLPQEASIFRNLTVEENLMAILEHTNLSPQERKEKMESLLEE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F+IT  R     +LSGG+RRR EIAR+L   P ++LLDEPFAGVDP+A+ +I  L+  L 
Sbjct: 123 FSITHIRKNQGKVLSGGERRRTEIARALTIDPKFVLLDEPFAGVDPIAVEEIQHLVAKLK 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            + IGILITDHNV+E L++ DRAY++  G +L  GT +E+ +++ VRR+YLG  F
Sbjct: 183 DKNIGILITDHNVNETLSITDRAYLMFEGKLLKSGTAEELAEDEQVRRVYLGKHF 237


>gi|225025293|ref|ZP_03714485.1| hypothetical protein EIKCOROL_02191 [Eikenella corrodens ATCC
           23834]
 gi|224941911|gb|EEG23120.1| hypothetical protein EIKCOROL_02191 [Eikenella corrodens ATCC
           23834]
          Length = 244

 Score =  268 bits (684), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 131/239 (54%), Positives = 173/239 (72%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S LS   L K +    VV+   L ++ GE+VGLLGPNGAGKTT FYM+ GL+ AD G+I+
Sbjct: 6   SRLSVKQLRKSFKQRQVVQDFSLDIESGEVVGLLGPNGAGKTTSFYMIVGLVAADHGTIR 65

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +D +++  M +Y+RARLG+ YLPQEASIFR +TVEENI A+L+++E D+     +L+ LL
Sbjct: 66  LDEHELRHMTVYQRARLGLGYLPQEASIFRKMTVEENIRAILQLHETDRHTIESRLNDLL 125

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NIT  R   AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 126 GDLNITHLRQSPAPALSGGERRRVEIARVLAMSPRFILLDEPFAGVDPIAVIDIQNIINF 185

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  RGIG+LITDHNV E L + DRAYII+ G VLA G  +E++ N++VR +YLG+ F +
Sbjct: 186 LKQRGIGVLITDHNVRETLRICDRAYIINNGAVLASGRPEELVGNEEVRAVYLGENFDY 244


>gi|311745445|ref|ZP_07719230.1| ABC transporter, ATP-binding protein [Algoriphagus sp. PR1]
 gi|126577996|gb|EAZ82216.1| ABC transporter, ATP-binding protein [Algoriphagus sp. PR1]
          Length = 245

 Score =  268 bits (684), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 127/236 (53%), Positives = 177/236 (75%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           LL A +L K Y    VV  + + V+ GEIVGLLGPNGAGKTT FYM+ GL+  + G I +
Sbjct: 2   LLKADNLVKIYKGRRVVNDISVEVEQGEIVGLLGPNGAGKTTSFYMIVGLVQPNEGKIYL 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           D ++IT +PMY+RA+LGI YL QEAS+FR L+VEENI+AVLE+ +  K++R EK++SLL+
Sbjct: 62  DKDNITSLPMYKRAKLGIGYLAQEASVFRKLSVEENIMAVLEMTKMPKQERKEKVESLLE 121

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF++T  R  L  +LSGG+RRR EIAR+L   P ++LLDEPFAGVDP+A+ +I  ++  L
Sbjct: 122 EFSLTHVRKNLGMVLSGGERRRTEIARALAVDPKFVLLDEPFAGVDPIAVEEIQTIVAKL 181

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            ++ IGILITDHNV+E L++ DRAY++  G +L  GT +E+  ++ VR++YLG +F
Sbjct: 182 KNKNIGILITDHNVNETLSITDRAYLMFEGKLLKAGTAEELAADEQVRKVYLGSQF 237


>gi|262066713|ref|ZP_06026325.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Fusobacterium periodonticum ATCC 33693]
 gi|291379512|gb|EFE87030.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Fusobacterium periodonticum ATCC 33693]
          Length = 241

 Score =  268 bits (684), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 132/237 (55%), Positives = 171/237 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LSA +L K Y    VV  V L V  GEIVGLLGPNGAGKTT FYM+TG++  D G +   
Sbjct: 4   LSAENLIKAYKGRKVVDRVSLEVNKGEIVGLLGPNGAGKTTTFYMITGIVRPDDGEVLCA 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             DIT++PMY+RA +GI YL QE S+FR LTVEENI  VLE+ +  KK++ E ++ LL+E
Sbjct: 64  EEDITRLPMYKRADMGIGYLAQEPSVFRNLTVEENIEVVLEMKDMSKKEQKETVNRLLEE 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T  R  L   LSGG+RRR+EIAR++ + PS+ILLDEPFAGVDP+A+ DI  +IR L 
Sbjct: 124 FKLTHVRDSLGYALSGGERRRIEIARTIANNPSFILLDEPFAGVDPIAVEDIQNIIRHLK 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RG+GILITDHNV E L++ DR+YI+  G VL  GT +EI +N + R++YLG++F  
Sbjct: 184 KRGLGILITDHNVRETLSITDRSYIMAKGKVLIEGTPREIANNPEARKIYLGEKFKL 240


>gi|253997530|ref|YP_003049594.1| ABC transporter-like protein [Methylotenera mobilis JLW8]
 gi|253984209|gb|ACT49067.1| ABC transporter related [Methylotenera mobilis JLW8]
          Length = 240

 Score =  268 bits (684), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 175/237 (73%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L+  SL K Y +  VV+ + L +K GE+VGLLGPNGAGKTT FYM+ GL+  D+G I 
Sbjct: 2   SELTVESLRKSYGARTVVQDISLTIKSGEVVGLLGPNGAGKTTSFYMIVGLVALDAGRIA 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG +++ +P++ RAR+G+SYLPQEASIFR LTV ENILA+L++ +  + +   +L+SLL
Sbjct: 62  LDGTELSHLPIHMRARMGLSYLPQEASIFRKLTVSENILAILQLQDIPEDEMSARLESLL 121

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +E +IT  R   A  LSGG+RRR+EIAR L S PS+ILLDEPFAG+DP+A+ DI  +IR 
Sbjct: 122 EELHITHIRDSAAVSLSGGERRRVEIARCLASDPSFILLDEPFAGIDPIAVIDIQQIIRF 181

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L++R IG+LITDHNV E L + DRAYI++ G V A G   EI+ N+ VR +YLG  F
Sbjct: 182 LSARNIGVLITDHNVRETLGICDRAYIVNQGHVFASGVPSEIVANESVREVYLGKDF 238


>gi|91225585|ref|ZP_01260659.1| ABC transporter, ATP-binding protein [Vibrio alginolyticus 12G01]
 gi|269968004|ref|ZP_06182042.1| ABC transporter ATP-binding protein [Vibrio alginolyticus 40B]
 gi|91189705|gb|EAS75979.1| ABC transporter, ATP-binding protein [Vibrio alginolyticus 12G01]
 gi|269827361|gb|EEZ81657.1| ABC transporter ATP-binding protein [Vibrio alginolyticus 40B]
          Length = 241

 Score =  268 bits (684), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 130/238 (54%), Positives = 179/238 (75%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++LSA +L K Y    VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G+I 
Sbjct: 2   AVLSAKNLAKSYKKRKVVTDVSLEVESGQIVGLLGPNGAGKTTSFYMIVGLVPRDEGTIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID NDI+ +PM+ R+RLGI YLPQEASIFR L+VE+NI+AVLE   E  +++R +KL+ L
Sbjct: 62  IDDNDISILPMHSRSRLGIGYLPQEASIFRKLSVEDNIMAVLETRQEMTREERQDKLEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP++++DI  +I 
Sbjct: 122 LEEFHIQHIRTSAGMALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVNDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A GT  E+++N+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGHLIASGTPAEVLNNEQVKQVYLGEQF 239


>gi|253997916|ref|YP_003049979.1| ABC transporter-like protein [Methylovorus sp. SIP3-4]
 gi|313199981|ref|YP_004038639.1| lipopolysaccharide export system ATP-binding protein [Methylovorus
           sp. MP688]
 gi|253984595|gb|ACT49452.1| ABC transporter related [Methylovorus sp. SIP3-4]
 gi|312439297|gb|ADQ83403.1| lipopolysaccharide export system ATP-binding protein [Methylovorus
           sp. MP688]
          Length = 240

 Score =  268 bits (684), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 130/230 (56%), Positives = 170/230 (73%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L KKY S  VV+ + L +  GE+VGLLGPNGAGKTT FYMM GL+  D G I +DG D++
Sbjct: 9   LRKKYKSRTVVQDISLQLNSGEVVGLLGPNGAGKTTSFYMMVGLVALDDGRILLDGKDLS 68

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITK 150
           ++P++RRARLG++YLPQE SIFR +TV ENI+A+LE+ +   ++   +L+SLL+E +IT 
Sbjct: 69  RLPIHRRARLGLAYLPQEPSIFRKMTVAENIMAILELQKLAPEQMENQLESLLQELHITH 128

Query: 151 WRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIG 210
            R+ +A  LSGG+RRR+EIAR L + PS+ILLDEPFAG+DP+A+ DI  +IR L  R IG
Sbjct: 129 IRNSMAVSLSGGERRRVEIARCLATNPSFILLDEPFAGIDPIAVLDIQKIIRFLTERNIG 188

Query: 211 ILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +LITDHNV E L + DRAYI++ G V A G   EII N  VR +YLG  F
Sbjct: 189 VLITDHNVRETLGICDRAYIVNEGRVFAAGKPSEIIHNDSVREVYLGKDF 238


>gi|332974673|gb|EGK11590.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Kingella kingae ATCC 23330]
          Length = 256

 Score =  267 bits (683), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 173/248 (69%)

Query: 15  FQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGL 74
           F   R +  S L    L K +    VVK   L +  GE++GLLGPNGAGKTT FYM+ GL
Sbjct: 9   FCNKRFTMTSHLHVKGLQKTFKKRQVVKDFSLDIASGEVIGLLGPNGAGKTTSFYMVVGL 68

Query: 75  ICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKK 134
           I ADSG+I +DG ++   P+++RA+ GI YLPQE SIFR +TVEENI A+LE+  +DK +
Sbjct: 69  IAADSGTISLDGKELRHSPIHQRAQAGIGYLPQEPSIFRKMTVEENIRAILEIRLRDKHQ 128

Query: 135 RHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAI 194
             ++L+ LL + NI + RH  AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+
Sbjct: 129 IEQQLNKLLADLNIERLRHSPAPALSGGERRRVEIARVLAMQPRFILLDEPFAGVDPIAV 188

Query: 195 SDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRL 254
            DI  +I  L  RGIG+LITDHNV E L + DRAYII  G VLA G   ++++N+ VR++
Sbjct: 189 IDIQKIIEFLKQRGIGVLITDHNVRETLRICDRAYIISDGTVLASGKPDDLVNNEQVRQV 248

Query: 255 YLGDRFAF 262
           YLG+ F +
Sbjct: 249 YLGENFDY 256


>gi|298209035|ref|YP_003717214.1| ABC transporter, ATP-binding protein [Croceibacter atlanticus
           HTCC2559]
 gi|83848962|gb|EAP86831.1| ABC transporter, ATP-binding protein [Croceibacter atlanticus
           HTCC2559]
          Length = 246

 Score =  267 bits (683), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 173/237 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L K Y    VVKG+ + V  GEIVGLLGPNGAGKTT FYM+ GLI  + GSI +D
Sbjct: 3   LRADNLMKAYKGRKVVKGISVEVNQGEIVGLLGPNGAGKTTSFYMIVGLIKPNGGSIHLD 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             DITK PMY+RA+ GI YL QEAS+FR L++E+NI++VL++ + +K++R EK++SL+ E
Sbjct: 63  QQDITKYPMYKRAQHGIGYLAQEASVFRKLSIEDNIMSVLQLTKLNKQQREEKMESLIDE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F++   R     LLSGG+RRR EIAR+L + PS+ILLDEPFAGVDPVA+ DI  ++  L 
Sbjct: 123 FSLNHIRTNRGDLLSGGERRRTEIARALATDPSFILLDEPFAGVDPVAVEDIQRIVAQLK 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           ++ IGILITDHNV E L + DR Y++  G +L HG  +E+ +++ VR++YLG  F  
Sbjct: 183 NKNIGILITDHNVQETLAITDRTYLMFEGSILKHGEPEELAEDEMVRKVYLGQNFEL 239


>gi|110640035|ref|YP_680245.1| ABC transporter ATP-binding protein [Cytophaga hutchinsonii ATCC
           33406]
 gi|110282716|gb|ABG60902.1| ABC transporter, ATP-binding protein [Cytophaga hutchinsonii ATCC
           33406]
          Length = 245

 Score =  267 bits (683), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 176/238 (73%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A +L KKY S  VV  V + VK GEIVGLLGPNGAGKTT FYM+ GLI  ++G + +
Sbjct: 2   ILGADNLIKKYKSRLVVNDVSVNVKQGEIVGLLGPNGAGKTTSFYMIVGLIKPNTGRVYL 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           D  DIT +PMY+RAR G+ YL QEAS+FR L+VE+NI AVLE+    K ++ EK++SL++
Sbjct: 62  DDEDITDLPMYQRARKGLGYLAQEASVFRELSVEDNIGAVLEMTGMPKSQQKEKIESLME 121

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF++T  R  L  +LSGG+RRR EIAR+L   P ++LLDEPFAGVDP+A+ +I  ++  L
Sbjct: 122 EFSLTHVRKNLGKVLSGGERRRTEIARALAVDPKFVLLDEPFAGVDPIAVEEIQTIVARL 181

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            ++ IGILITDHNV+E L++ DRAY++  G +L  GT +E+ +++ VRR+YLG  F F
Sbjct: 182 KNKNIGILITDHNVNETLSITDRAYLLFEGKILRSGTAEELAEDETVRRVYLGQHFQF 239


>gi|294341473|emb|CAZ89890.1| putative sulfate transporting ATPase [Thiomonas sp. 3As]
          Length = 257

 Score =  267 bits (683), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 134/255 (52%), Positives = 175/255 (68%), Gaps = 6/255 (2%)

Query: 12  MPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMM 71
           MP    +RA+    L    L K+Y    VV+ V   V+ GE+VGLLGPNGAGKTT FYM+
Sbjct: 1   MPSTPSSRAATGPELDVQHLQKRYAGRQVVRDVSFSVRCGEVVGLLGPNGAGKTTSFYMI 60

Query: 72  TGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD 131
            GL+  D+G I IDG D++  PM+RRAR+G+SYLPQEASIFR +TV EN+ AVLE+    
Sbjct: 61  VGLVRPDAGRIHIDGQDVSDSPMHRRARMGLSYLPQEASIFRRMTVAENVRAVLELQRDA 120

Query: 132 KKKR------HEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEP 185
           + +R       E+ D LL+E ++   R   AP LSGG+RRR+EIAR+L + P +ILLDEP
Sbjct: 121 QGRRLGRAEIREREDHLLRELHVEHLRDSPAPALSGGERRRVEIARALATQPRFILLDEP 180

Query: 186 FAGVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEI 245
           FAG+DP+A+ +I  +++ L  +GIG+LITDHNV E L + DRA II  G VLA G  Q I
Sbjct: 181 FAGIDPIAVIEIQRIVQFLKEQGIGVLITDHNVRETLGICDRACIISEGQVLAQGDPQSI 240

Query: 246 IDNQDVRRLYLGDRF 260
           IDN  VR++YLG+ F
Sbjct: 241 IDNPAVRKVYLGENF 255


>gi|255533565|ref|YP_003093937.1| ABC transporter [Pedobacter heparinus DSM 2366]
 gi|255346549|gb|ACU05875.1| ABC transporter related [Pedobacter heparinus DSM 2366]
          Length = 244

 Score =  267 bits (683), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 130/238 (54%), Positives = 171/238 (71%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L KKY    VV  V   V  GEIVGLLGPNGAGKTT FYM+ GLI  + G+I +
Sbjct: 2   ILRAEHLIKKYKQRTVVNDVSFSVSQGEIVGLLGPNGAGKTTSFYMIVGLIKPNEGTIFL 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           D  DITK PMYRRA+ GI YL QEAS+FR L+VE+NI+A+LE+ + ++++RHEKL+ L+ 
Sbjct: 62  DEQDITKDPMYRRAQKGIGYLAQEASVFRKLSVEDNIMAILEMTKMNREERHEKLEELIT 121

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF++ K R     LLSGG+RRR EIAR+L + P++ILLDEPFAGVDP+A+ +I  ++  L
Sbjct: 122 EFSLHKVRKNRGDLLSGGERRRTEIARALAASPNFILLDEPFAGVDPIAVEEIQTIVAKL 181

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             + IGILITDHNV E L++ DRAY++  G +L  GT + +  N+ VRR+YLG  F  
Sbjct: 182 KQKNIGILITDHNVQETLSITDRAYLLFEGKILESGTPEVLAANEMVRRVYLGSNFVL 239


>gi|330720920|gb|EGG99097.1| Lipopolysaccharide ABC transporter2C ATP-binding protein LptB
           [gamma proteobacterium IMCC2047]
          Length = 241

 Score =  267 bits (683), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 130/238 (54%), Positives = 176/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A  L K Y   ++V+ V + ++PG++VGLLGPNGAGKTT FYM+ GLI AD G I 
Sbjct: 2   SNLQALHLAKSYKHRHIVEDVSVTIEPGQVVGLLGPNGAGKTTCFYMIIGLIPADQGKIL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           IDG DIT +PM+ RAR GI YLPQE+SIFR LTV +NILA+LE  +  +++++ EKL+ L
Sbjct: 62  IDGQDITSLPMHGRARKGIGYLPQESSIFRKLTVSQNILAILETRKDLNREQQREKLELL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+IT  R  L   LSGG+RRR+EIAR+L   P+YILLDEPFAGVDP++++DI  +I 
Sbjct: 122 LQEFHITHIRDSLGMALSGGERRRVEIARALAMEPAYILLDEPFAGVDPISVADIKQIIT 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  R IG+LITDHNV E L + ++AYI+  G +++ G  + ++ NQ VR +YLG++F
Sbjct: 182 HLKERNIGVLITDHNVRETLDICEKAYIVSEGHIISEGNAETVLSNQRVRDVYLGEQF 239


>gi|238022119|ref|ZP_04602545.1| hypothetical protein GCWU000324_02025 [Kingella oralis ATCC 51147]
 gi|237866733|gb|EEP67775.1| hypothetical protein GCWU000324_02025 [Kingella oralis ATCC 51147]
          Length = 244

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 130/242 (53%), Positives = 172/242 (71%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
            K + L    L K +    VVK   L ++ GE++GLLGPNGAGKTT FYM+ GLI AD+G
Sbjct: 3   QKTAHLHVSGLQKAFKKRQVVKNFSLDIQSGEVIGLLGPNGAGKTTSFYMIVGLIAADAG 62

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLD 140
           SI ++G ++   P+++RA+ GI YLPQEASIFR +TVE+NI A+LE+  +DK +   +L+
Sbjct: 63  SITLNGEELRHSPIHQRAQAGIGYLPQEASIFRKMTVEQNIRAILEIRLRDKHQIETQLN 122

Query: 141 SLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVL 200
            LL + NI + RH  AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +
Sbjct: 123 KLLADLNIERLRHSPAPALSGGERRRVEIARVLAMQPRFILLDEPFAGVDPIAVIDIQKI 182

Query: 201 IRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           I  L  RGIG+LITDHNV E L + DRAYII  G VLA G  +E+++N+ VR +YLG+ F
Sbjct: 183 IEFLKERGIGVLITDHNVRETLRICDRAYIISDGTVLATGKPEELVNNEQVRAVYLGENF 242

Query: 261 AF 262
            +
Sbjct: 243 DY 244


>gi|304386604|ref|ZP_07368892.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Neisseria meningitidis ATCC 13091]
 gi|304339433|gb|EFM05505.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Neisseria meningitidis ATCC 13091]
          Length = 254

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 131/239 (54%), Positives = 170/239 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 16  SRLVVQNLQKSFKKRQVVKSFSLEIESGEVVGLLGPNGAGKTTSFYMIVGLIAADTGSVT 75

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 76  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEIRTKDKNQIDREIEKLL 135

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI   R   AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 136 ADLNIGHLRRSPAPSLSGGERRRVEIARVLAMKPHFILLDEPFAGVDPIAVIDIQKIIGF 195

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   +++ N+ VR +YLG  F +
Sbjct: 196 LKSRGIGVLITDHNVRETLSICDRAYIISDGAVLASGKPDDLVGNEQVRSVYLGKNFKY 254


>gi|260772158|ref|ZP_05881075.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           metschnikovii CIP 69.14]
 gi|260613025|gb|EEX38227.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           metschnikovii CIP 69.14]
          Length = 241

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 130/238 (54%), Positives = 176/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L A  L K Y    VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D GSI 
Sbjct: 2   SILKAEHLAKSYKKRKVVSDVSLQVESGQIVGLLGPNGAGKTTSFYMIVGLVARDEGSIM 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +PM+ R+RLGI YLPQEASIFR L+VE+NI+AVL+  E+   ++R +KL+ L
Sbjct: 62  IDDKDISILPMHSRSRLGIGYLPQEASIFRKLSVEDNIMAVLQTREEMTHEERQDKLEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   RH     LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LEEFHIQHIRHSAGMALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A GT  E+++N+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGRLIAEGTPHEVLNNEQVKQVYLGEQF 239


>gi|161870713|ref|YP_001599886.1| ABC transporter, ATP-binding protein [Neisseria meningitidis
           053442]
 gi|254805608|ref|YP_003083829.1| putative ABC transporter, ATP-binding protein [Neisseria
           meningitidis alpha14]
 gi|161596266|gb|ABX73926.1| ABC transporter, ATP-binding protein [Neisseria meningitidis
           053442]
 gi|254669150|emb|CBA07828.1| putative ABC transporter, ATP-binding protein [Neisseria
           meningitidis alpha14]
 gi|319411109|emb|CBY91513.1| putative ABC transporter ATP-binding protein [Neisseria
           meningitidis WUE 2594]
 gi|325134937|gb|EGC57569.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           meningitidis M13399]
 gi|325138895|gb|EGC61445.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           meningitidis ES14902]
          Length = 244

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 131/239 (54%), Positives = 172/239 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 6   SRLVVQNLQKSFKKRQVVKSFSLEIESGEVVGLLGPNGAGKTTSFYMIVGLIAADAGSVM 65

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 66  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEISTKDKSRIDGEVEKLL 125

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI + R+  AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 126 ADLNIERLRNNPAPSLSGGERRRVEIARVLAMKPHFILLDEPFAGVDPIAVIDIQKIIGF 185

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   +++ N+ VR +YLG  F +
Sbjct: 186 LKSRGIGVLITDHNVRETLSICDRAYIISDGTVLASGKPDDLVGNEQVRSVYLGKNFKY 244


>gi|254673981|emb|CBA09765.1| ABC transporter [Neisseria meningitidis alpha275]
          Length = 254

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 131/239 (54%), Positives = 170/239 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 16  SRLVVQNLQKSFKKRQVVKSFSLEIESGEVVGLLGPNGAGKTTSFYMIVGLIAADAGSVT 75

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 76  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEIRTKDKNQIDREIEKLL 135

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI   R   AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 136 ADLNIGHLRRSPAPSLSGGERRRVEIARVLAMKPHFILLDEPFAGVDPIAVIDIQKIIGF 195

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   +++ N+ VR +YLG  F +
Sbjct: 196 LKSRGIGVLITDHNVRETLSICDRAYIISDGAVLASGKPDDLVGNEQVRSVYLGKNFKY 254


>gi|59801933|ref|YP_208645.1| putative ABC transporter, ATP-binding protein [Neisseria
           gonorrhoeae FA 1090]
 gi|194099431|ref|YP_002002533.1| putative ABC transporter, ATP-binding protein [Neisseria
           gonorrhoeae NCCP11945]
 gi|239999669|ref|ZP_04719593.1| putative ABC transporter, ATP-binding protein [Neisseria
           gonorrhoeae 35/02]
 gi|240014846|ref|ZP_04721759.1| putative ABC transporter, ATP-binding protein [Neisseria
           gonorrhoeae DGI18]
 gi|240017292|ref|ZP_04723832.1| putative ABC transporter, ATP-binding protein [Neisseria
           gonorrhoeae FA6140]
 gi|240081068|ref|ZP_04725611.1| putative ABC transporter, ATP-binding protein [Neisseria
           gonorrhoeae FA19]
 gi|240113278|ref|ZP_04727768.1| putative ABC transporter, ATP-binding protein [Neisseria
           gonorrhoeae MS11]
 gi|240116368|ref|ZP_04730430.1| putative ABC transporter, ATP-binding protein [Neisseria
           gonorrhoeae PID18]
 gi|240118656|ref|ZP_04732718.1| putative ABC transporter, ATP-binding protein [Neisseria
           gonorrhoeae PID1]
 gi|240121365|ref|ZP_04734327.1| putative ABC transporter, ATP-binding protein [Neisseria
           gonorrhoeae PID24-1]
 gi|240124200|ref|ZP_04737156.1| putative ABC transporter, ATP-binding protein [Neisseria
           gonorrhoeae PID332]
 gi|240126402|ref|ZP_04739288.1| putative ABC transporter, ATP-binding protein [Neisseria
           gonorrhoeae SK-92-679]
 gi|240128867|ref|ZP_04741528.1| putative ABC transporter, ATP-binding protein [Neisseria
           gonorrhoeae SK-93-1035]
 gi|254494385|ref|ZP_05107556.1| ABC transporter ATP-binding protein [Neisseria gonorrhoeae 1291]
 gi|260439813|ref|ZP_05793629.1| putative ABC transporter, ATP-binding protein [Neisseria
           gonorrhoeae DGI2]
 gi|268595482|ref|ZP_06129649.1| ABC transporter [Neisseria gonorrhoeae 35/02]
 gi|268597179|ref|ZP_06131346.1| ABC transporter [Neisseria gonorrhoeae FA19]
 gi|268599358|ref|ZP_06133525.1| ABC transporter ATP-binding protein [Neisseria gonorrhoeae MS11]
 gi|268602035|ref|ZP_06136202.1| ABC transporter ATP-binding protein [Neisseria gonorrhoeae PID18]
 gi|268604369|ref|ZP_06138536.1| ABC transporter ATP-binding protein [Neisseria gonorrhoeae PID1]
 gi|268682826|ref|ZP_06149688.1| ABC transporter ATP-binding protein [Neisseria gonorrhoeae PID332]
 gi|268684987|ref|ZP_06151849.1| ABC transporter ATP-binding protein [Neisseria gonorrhoeae
           SK-92-679]
 gi|268687249|ref|ZP_06154111.1| ABC transporter ATP-binding protein [Neisseria gonorrhoeae
           SK-93-1035]
 gi|291043083|ref|ZP_06568806.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|293398421|ref|ZP_06642599.1| ABC transporter, ATP-binding protein [Neisseria gonorrhoeae F62]
 gi|59718828|gb|AAW90233.1| putative ABC transporter, ATP-binding protein [Neisseria
           gonorrhoeae FA 1090]
 gi|193934721|gb|ACF30545.1| putative ABC transporter, ATP-binding protein [Neisseria
           gonorrhoeae NCCP11945]
 gi|226513425|gb|EEH62770.1| ABC transporter ATP-binding protein [Neisseria gonorrhoeae 1291]
 gi|268548871|gb|EEZ44289.1| ABC transporter [Neisseria gonorrhoeae 35/02]
 gi|268550967|gb|EEZ45986.1| ABC transporter [Neisseria gonorrhoeae FA19]
 gi|268583489|gb|EEZ48165.1| ABC transporter ATP-binding protein [Neisseria gonorrhoeae MS11]
 gi|268586166|gb|EEZ50842.1| ABC transporter ATP-binding protein [Neisseria gonorrhoeae PID18]
 gi|268588500|gb|EEZ53176.1| ABC transporter ATP-binding protein [Neisseria gonorrhoeae PID1]
 gi|268623110|gb|EEZ55510.1| ABC transporter ATP-binding protein [Neisseria gonorrhoeae PID332]
 gi|268625271|gb|EEZ57671.1| ABC transporter ATP-binding protein [Neisseria gonorrhoeae
           SK-92-679]
 gi|268627533|gb|EEZ59933.1| ABC transporter ATP-binding protein [Neisseria gonorrhoeae
           SK-93-1035]
 gi|291012689|gb|EFE04672.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|291610892|gb|EFF39989.1| ABC transporter, ATP-binding protein [Neisseria gonorrhoeae F62]
 gi|317164932|gb|ADV08473.1| putative ABC transporter, ATP-binding protein [Neisseria
           gonorrhoeae TCDC-NG08107]
          Length = 244

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 174/243 (71%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           ++ +S L   +L K +    VVK   L ++ GE++GLLGPNGAGKTT FYM+ GLI AD+
Sbjct: 2   SANNSRLVVQNLQKSFKKRQVVKSFSLEIESGEVIGLLGPNGAGKTTGFYMIVGLIAADA 61

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           GS+ +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   ++
Sbjct: 62  GSVMLDGRELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEIRTKDKNQIDREI 121

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL + NI   R   AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  
Sbjct: 122 EKLLADLNIGHLRRNPAPSLSGGERRRVEIARVLAMKPRFILLDEPFAGVDPIAVIDIQK 181

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           +I  L SRGIG+LITDHNV E L++ DRAYII  G VLA G   +++ N+ VR +YLG+ 
Sbjct: 182 IIGFLKSRGIGVLITDHNVRETLSICDRAYIISDGAVLASGKPDDLVGNEQVRAVYLGEN 241

Query: 260 FAF 262
           F +
Sbjct: 242 FKY 244


>gi|254511271|ref|ZP_05123338.1| ABC transporter, ATP-binding protein [Rhodobacteraceae bacterium
           KLH11]
 gi|221534982|gb|EEE37970.1| ABC transporter, ATP-binding protein [Rhodobacteraceae bacterium
           KLH11]
          Length = 252

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/241 (52%), Positives = 172/241 (71%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L    L K Y    V++ V + +   E+V LLGPNG+GKTT FY + GL+  ++
Sbjct: 9   AEGSSGLKIEKLRKSYRKKTVIRDVSMTLGRSEVVALLGPNGSGKTTTFYSVAGLVFPEA 68

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G++ IDG ++T +PMYRRARLGI YLPQE SIFRG++VE+NI +VL++  K   +R E+L
Sbjct: 69  GTVTIDGQNVTTLPMYRRARLGIGYLPQEMSIFRGMSVEDNIASVLDITVKHAHRRKERL 128

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL +F+I   R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+++ DI  
Sbjct: 129 EELLSDFSIEHLRRAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDPISVGDIRH 188

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L+ DL  RGIG+LITDHNV E L ++DRAYI+H G VL  GT   +++N++VRR+YLG+ 
Sbjct: 189 LVADLKKRGIGVLITDHNVRETLEIVDRAYILHDGQVLMSGTPDAVVENENVRRVYLGEN 248

Query: 260 F 260
           F
Sbjct: 249 F 249


>gi|296327902|ref|ZP_06870438.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Fusobacterium nucleatum subsp. nucleatum ATCC 23726]
 gi|296155036|gb|EFG95817.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Fusobacterium nucleatum subsp. nucleatum ATCC 23726]
          Length = 241

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 167/237 (70%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LSA SL K Y    VV  V L V  GEIVGLLGPNGAGKTT FYM+TG++  DSG +   
Sbjct: 4   LSADSLVKTYKKRKVVDKVSLEVNKGEIVGLLGPNGAGKTTTFYMITGIVKPDSGQVMCA 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             DIT +PMY+RA +GI YL QE S+FR LTVEENI  VLE+    KK + E +D LL+E
Sbjct: 64  DQDITNLPMYKRADMGIGYLAQEPSVFRNLTVEENIEVVLEMKNISKKMQRETVDRLLEE 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T  R  L   LSGG+RRR+EIAR++ + PS+ILLDEPFAGVDP+A+ DI  +IR L 
Sbjct: 124 FKLTHVRDSLGYSLSGGERRRIEIARTIANNPSFILLDEPFAGVDPIAVEDIQNIIRHLK 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            R +GILITDHNV E L++ D++YI+  G VL  G  +EI +N + RR+YLG++F  
Sbjct: 184 KRDLGILITDHNVRETLSITDKSYIMAKGKVLIEGAPREIANNPEARRIYLGEKFKL 240


>gi|261391881|emb|CAX49340.1| putative ABC transporter ATP-binding protein [Neisseria
           meningitidis 8013]
          Length = 254

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 131/239 (54%), Positives = 172/239 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 16  SRLVVQNLQKSFKKRQVVKSFSLEIESGEVVGLLGPNGAGKTTSFYMIVGLIAADAGSVT 75

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 76  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEISTKDKSRIDGEVEKLL 135

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI + R+  AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 136 ADLNIERLRNNPAPSLSGGERRRVEIARVLAMKPHFILLDEPFAGVDPIAVIDIQKIIGF 195

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   +++ N+ VR +YLG  F +
Sbjct: 196 LKSRGIGVLITDHNVRETLSICDRAYIISDGTVLASGKPDDLVGNEQVRSVYLGKNFKY 254


>gi|121607572|ref|YP_995379.1| ABC transporter-like protein [Verminephrobacter eiseniae EF01-2]
 gi|121552212|gb|ABM56361.1| ABC transporter related [Verminephrobacter eiseniae EF01-2]
          Length = 256

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 133/244 (54%), Positives = 175/244 (71%), Gaps = 6/244 (2%)

Query: 23  DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSI 82
           +S L A  L K Y +  VVK V L V+ GE+VGLLGPNGAGKTT FYM+ GL+ +D+G I
Sbjct: 11  ESRLEAWHLAKSYGNRKVVKDVSLVVQKGEVVGLLGPNGAGKTTSFYMLVGLVRSDAGDI 70

Query: 83  KIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD------KKKRH 136
           +IDG  + +MP++RR+RLG+SYLPQEASIFR L+VEEN+ AVLE+          ++   
Sbjct: 71  RIDGQSVARMPIHRRSRLGLSYLPQEASIFRKLSVEENVRAVLELQRAADGQPLARETIE 130

Query: 137 EKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISD 196
           E+L  LL+E  +   R   A  LSGG+RRR+EIAR+L + P +ILLDEPFAG+DP+A+ +
Sbjct: 131 ERLTELLQELRVAPLRASAALALSGGERRRVEIARALATQPRFILLDEPFAGIDPIAVIE 190

Query: 197 IHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYL 256
           I  +I  L +RGIG+LITDHNV E L + D A+II  G VLA GT  +I+DN +VRR+YL
Sbjct: 191 IQRIIGFLKARGIGVLITDHNVRETLGICDHAFIISDGRVLAQGTPSQIVDNAEVRRVYL 250

Query: 257 GDRF 260
           G+ F
Sbjct: 251 GEHF 254


>gi|323140934|ref|ZP_08075847.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Phascolarctobacterium sp. YIT 12067]
 gi|322414672|gb|EFY05478.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Phascolarctobacterium sp. YIT 12067]
          Length = 239

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 174/238 (73%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +++  +L K YN+ +VV GV + V+ G +VGLLGPNGAGKTT FYM+ G+   D+G++ +
Sbjct: 2   VITTDNLVKIYNTRHVVDGVSISVEQGSVVGLLGPNGAGKTTTFYMIVGIEKPDAGTVML 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           DG DI+ MPMY RAR GI YLPQEASIF  +TVE+NI+A+LE  + +  +R  K+++LL 
Sbjct: 62  DGKDISSMPMYERARAGIGYLPQEASIFSKMTVEDNIMAILETTDLNASEREAKMNALLD 121

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF +   R      LSGG+RRR+EIAR+L + P++ILLDEPFAG+DP+A++DI  +I  L
Sbjct: 122 EFRLNHVRKSEGKALSGGERRRVEIARALATDPAFILLDEPFAGIDPIAVADIQGMIAHL 181

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           A RGIG+LITDHNV E L+++D+AYI+  G +L HG  + I ++   R+ YLGD F+ 
Sbjct: 182 AQRGIGVLITDHNVRETLSIVDKAYILAEGHILLHGDSETIANDPVARKYYLGDNFSM 239


>gi|237739612|ref|ZP_04570093.1| ABC transporter ATP-binding protein [Fusobacterium sp. 2_1_31]
 gi|229423220|gb|EEO38267.1| ABC transporter ATP-binding protein [Fusobacterium sp. 2_1_31]
          Length = 241

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 132/237 (55%), Positives = 169/237 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LSA +L K Y    VV  V L V  GEIVGLLGPNGAGKTT FYM+TG++  D G +   
Sbjct: 4   LSADNLVKAYKGRKVVDRVSLEVNKGEIVGLLGPNGAGKTTTFYMITGIVRPDDGEVLCA 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             DIT +PMY+RA +GI YL QE S+FR LTVEENI  VLE+ +  KK++ E +  LL+E
Sbjct: 64  EEDITNLPMYKRADMGIGYLAQEPSVFRNLTVEENIEVVLEMKDMSKKEQKETVHRLLEE 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T  +  L   LSGG+RRR+EIAR++ + PS+ILLDEPFAGVDP+A+ DI  +IR L 
Sbjct: 124 FKLTHVKDSLGYALSGGERRRIEIARTIANNPSFILLDEPFAGVDPIAVEDIQNIIRHLK 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RG+GILITDHNV E L++ DR+YI+  G VL  GT +EI +N + RR+YLG++F  
Sbjct: 184 KRGLGILITDHNVRETLSITDRSYIMAKGKVLIEGTAREIANNPEARRIYLGEKFKL 240


>gi|121635508|ref|YP_975753.1| putative ABC transporter ATP-binding protein [Neisseria
           meningitidis FAM18]
 gi|120867214|emb|CAM10983.1| putative ABC transporter ATP-binding protein [Neisseria
           meningitidis FAM18]
 gi|325132910|gb|EGC55587.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           meningitidis M6190]
 gi|325145151|gb|EGC67433.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           meningitidis M01-240013]
          Length = 254

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 131/239 (54%), Positives = 172/239 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 16  SRLVVQNLQKSFKKRQVVKSFSLEIESGEVVGLLGPNGAGKTTSFYMIVGLIAADAGSVM 75

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 76  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEISTKDKSRIDGEVEKLL 135

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI + R+  AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 136 ADLNIERLRNNPAPSLSGGERRRVEIARVLAMKPHFILLDEPFAGVDPIAVIDIQKIIGF 195

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   +++ N+ VR +YLG  F +
Sbjct: 196 LKSRGIGVLITDHNVRETLSICDRAYIISDGTVLASGKPDDLVGNEQVRSVYLGKNFKY 254


>gi|325128941|gb|EGC51795.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           meningitidis N1568]
 gi|325203468|gb|ADY98921.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           meningitidis M01-240355]
          Length = 244

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 131/239 (54%), Positives = 170/239 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 6   SRLVVQNLQKSFKKRQVVKSFSLEIESGEVVGLLGPNGAGKTTSFYMIVGLIAADAGSVT 65

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 66  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEIRTKDKNQIDREIEKLL 125

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI   R   AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 126 ADLNIGHLRRSPAPSLSGGERRRVEIARVLAMKPHFILLDEPFAGVDPIAVIDIQKIIGF 185

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   +++ N+ VR +YLG  F +
Sbjct: 186 LKSRGIGVLITDHNVRETLSICDRAYIISDGAVLASGKPDDLVGNEQVRSVYLGKNFKY 244


>gi|300692616|ref|YP_003753611.1| ABC transport protein, atp_binding component [Ralstonia
           solanacearum PSI07]
 gi|299079676|emb|CBJ52353.1| putative ABC transport protein, atp_binding component [Ralstonia
           solanacearum PSI07]
          Length = 262

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 178/247 (72%), Gaps = 5/247 (2%)

Query: 19  RASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICAD 78
           +A+  S L    L K+Y +  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D
Sbjct: 14  QAATSSTLVVRHLKKRYGTRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVALD 73

Query: 79  SGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKK----- 133
           +G I +DG  I+++P+++RAR+G+SYLPQEAS+FR L V+ENI AVLE+ E+D K     
Sbjct: 74  AGDIVLDGQHISRLPIHQRARMGLSYLPQEASVFRKLNVQENIRAVLELQEQDGKPLSAA 133

Query: 134 KRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
           + + +LD+LL +  I   R   A  LSGG+RRR+EIAR+L S P +ILLDEPFAGVDP+A
Sbjct: 134 EVNRRLDALLDDLQIAHLRDNPALSLSGGERRRVEIARALASSPRFILLDEPFAGVDPIA 193

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  ++  L  R IG+LITDHNV E L + D AYII  G VLA G  ++I++N+DVR+
Sbjct: 194 VGEIQRIVSFLKDRNIGVLITDHNVRETLGICDHAYIISEGTVLAAGMPEQIVENEDVRK 253

Query: 254 LYLGDRF 260
           +YLGD F
Sbjct: 254 VYLGDNF 260


>gi|254429951|ref|ZP_05043658.1| ABC transporter, ATP-binding protein, putative [Alcanivorax sp.
           DG881]
 gi|196196120|gb|EDX91079.1| ABC transporter, ATP-binding protein, putative [Alcanivorax sp.
           DG881]
          Length = 241

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 138/238 (57%), Positives = 173/238 (72%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A  L K Y    V++ V L V+ G+IVGLLGPNGAGKTT FYM+ GL+ AD+G I+
Sbjct: 2   SHLRAHHLAKSYKGRRVIEDVSLDVEAGQIVGLLGPNGAGKTTCFYMIVGLVEADAGRIE 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           I+ +DIT +PM+ RA+ GI YLPQEASIFR LTVEENI+A+LE   E  K +RHE+++SL
Sbjct: 62  INDSDITHLPMHGRAQRGIGYLPQEASIFRRLTVEENIMAILETRKELSKAERHERMESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           LKEF+I   R  L   LSGG+RRR EIAR L + P +ILLDEPFAGVDP++++DI  +IR
Sbjct: 122 LKEFHIGHIRDSLGMSLSGGERRRAEIARGLATDPDFILLDEPFAGVDPISVNDIKGIIR 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIG+LITDHNV E L + D AYI+ AG ++A G    I+ NQ VR +YLG  F
Sbjct: 182 HLKDRGIGVLITDHNVRETLDICDTAYIVSAGHIIASGDADIILANQQVRDVYLGADF 239


>gi|17545128|ref|NP_518530.1| ABC transporter ATP-binding protein [Ralstonia solanacearum
           GMI1000]
 gi|17427419|emb|CAD13937.1| probable atp-binding abc transporter protein [Ralstonia
           solanacearum GMI1000]
          Length = 262

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 178/247 (72%), Gaps = 5/247 (2%)

Query: 19  RASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICAD 78
           +A+  S L    L K+Y +  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D
Sbjct: 14  QAATSSTLVVRHLKKRYGTRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVALD 73

Query: 79  SGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKK----- 133
           +G I +DG  I+++P+++RAR+G+SYLPQEAS+FR L V+ENI AVLE+ E+D K     
Sbjct: 74  AGDIVLDGQHISRLPIHQRARMGLSYLPQEASVFRKLNVQENIRAVLELQEQDGKPLSST 133

Query: 134 KRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
           + + +LD+LL +  I   R   A  LSGG+RRR+EIAR+L S P +ILLDEPFAGVDP+A
Sbjct: 134 EVNRRLDALLDDLQIAHLRDNPALSLSGGERRRVEIARALASSPRFILLDEPFAGVDPIA 193

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  ++  L  R IG+LITDHNV E L + D AYII  G VLA G  ++I++N+DVR+
Sbjct: 194 VGEIQRIVSFLKDRNIGVLITDHNVRETLGICDHAYIISEGTVLAAGMPEQIVENEDVRK 253

Query: 254 LYLGDRF 260
           +YLGD F
Sbjct: 254 VYLGDNF 260


>gi|27364148|ref|NP_759676.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           vulnificus CMCP6]
 gi|37678633|ref|NP_933242.1| ABC-type transport system, ATPase component [Vibrio vulnificus
           YJ016]
 gi|320157533|ref|YP_004189912.1| lipopolysaccharide ABC transporterATP-binding protein LptB [Vibrio
           vulnificus MO6-24/O]
 gi|27360266|gb|AAO09203.1| Lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Vibrio vulnificus CMCP6]
 gi|37197373|dbj|BAC93213.1| ABC-type transport system, ATPase component [Vibrio vulnificus
           YJ016]
 gi|319932845|gb|ADV87709.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Vibrio vulnificus MO6-24/O]
          Length = 241

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 179/238 (75%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++LSA  L K Y    VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D GSIK
Sbjct: 2   AVLSAKHLAKSYKKRKVVTDVSLQVESGQIVGLLGPNGAGKTTSFYMIVGLVPRDEGSIK 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           ID  DI+ +PM+ R++LGI YLPQEASIFR L+VE+NI+AVL+   E  +++R +KL+ L
Sbjct: 62  IDDRDISILPMHSRSKLGIGYLPQEASIFRKLSVEDNIMAVLQTRNELTREERQDKLEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   RH     LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LEEFHIQHIRHSAGMALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A GT +++++N+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGRLIAEGTPEQVLNNEQVKQVYLGEQF 239


>gi|254362690|ref|ZP_04978777.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Mannheimia haemolytica PHL213]
 gi|261493295|ref|ZP_05989821.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261496561|ref|ZP_05992941.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|153094309|gb|EDN75173.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Mannheimia haemolytica PHL213]
 gi|261307764|gb|EEY09087.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261310939|gb|EEY12116.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 241

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 131/240 (54%), Positives = 179/240 (74%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L A  L K Y    VVK V L VK GEIVGLLGPNGAGKTT FYM+ GL+  D G+I+
Sbjct: 2   SVLYAEHLAKSYKQRQVVKDVSLNVKSGEIVGLLGPNGAGKTTTFYMVVGLVRHDHGTIR 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +PM+ RA+ GI YLPQEASIFR L+V +N+++VL+V +  + K+R E+ + L
Sbjct: 62  IDDQDISTLPMHDRAKQGIGYLPQEASIFRRLSVYDNLMSVLQVRKNINDKQRKERAEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           + EF+I   R+ L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 ITEFHIEHIRNSLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIV 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           +L  RG+G+LITDHNV E L + +RAYI+ +G ++A GT Q++++N DV+R+YLGD+F  
Sbjct: 182 NLKERGLGVLITDHNVRETLDVCERAYIVGSGEMIASGTPQQVLENPDVKRVYLGDQFKL 241


>gi|296137175|ref|YP_003644417.1| ABC transporter related protein [Thiomonas intermedia K12]
 gi|295797297|gb|ADG32087.1| ABC transporter related protein [Thiomonas intermedia K12]
          Length = 284

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 175/255 (68%), Gaps = 6/255 (2%)

Query: 12  MPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMM 71
           +P    +RA+    L    L K+Y    VV+ V   V+ GE+VGLLGPNGAGKTT FYM+
Sbjct: 28  VPSTPSSRAATGPELDVQHLQKRYAGRQVVRDVSFSVRCGEVVGLLGPNGAGKTTSFYMI 87

Query: 72  TGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD 131
            GL+  D+G I IDG D++  PM+RRAR+G+SYLPQEASIFR +TV EN+ AVLE+    
Sbjct: 88  VGLVRPDAGRIHIDGQDVSDSPMHRRARMGLSYLPQEASIFRRMTVAENVRAVLELQRDA 147

Query: 132 KKKR------HEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEP 185
           + +R       E+ D LL+E ++   R   AP LSGG+RRR+EIAR+L + P +ILLDEP
Sbjct: 148 QGRRLGKAEIREREDHLLRELHVEHLRDSPAPALSGGERRRVEIARALATQPRFILLDEP 207

Query: 186 FAGVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEI 245
           FAG+DP+A+ +I  +++ L  +GIG+LITDHNV E L + DRA II  G VLA G  Q I
Sbjct: 208 FAGIDPIAVIEIQRIVQFLKEQGIGVLITDHNVRETLGICDRACIISEGQVLAQGDPQSI 267

Query: 246 IDNQDVRRLYLGDRF 260
           IDN  VR++YLG+ F
Sbjct: 268 IDNPAVRKVYLGENF 282


>gi|300705237|ref|YP_003746840.1| ABC transport protein, ATP-binding protein [Ralstonia solanacearum
           CFBP2957]
 gi|299072901|emb|CBJ44257.1| putative ABC transport protein, atp_binding component [Ralstonia
           solanacearum CFBP2957]
          Length = 262

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 134/242 (55%), Positives = 176/242 (72%), Gaps = 5/242 (2%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L    L K+Y +  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+G I 
Sbjct: 19  STLVVRHLKKRYGTRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVALDAGDIV 78

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKK-----KRHEK 138
           +DG  I+++P+++RAR+G+SYLPQEAS+FR L V+ENI AVLE+ E+D K     + + +
Sbjct: 79  LDGQHISRLPIHQRARMGLSYLPQEASVFRKLNVQENIRAVLELQEQDGKPLSAAEVNRR 138

Query: 139 LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIH 198
           LD+LL +  IT  R   A  LSGG+RRR+EIAR+L S P +ILLDEPFAGVDP+A+ +I 
Sbjct: 139 LDALLNDLQITHLRDNPALSLSGGERRRVEIARALASAPRFILLDEPFAGVDPIAVGEIQ 198

Query: 199 VLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGD 258
            ++  L  R IG+LITDHNV E L + D AYII  G VLA G  ++I++N+DVR++YLGD
Sbjct: 199 RIVSFLKDRNIGVLITDHNVRETLGICDHAYIISEGTVLAAGMPEQIVENEDVRKVYLGD 258

Query: 259 RF 260
            F
Sbjct: 259 NF 260


>gi|114321378|ref|YP_743061.1| ABC transporter related [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227772|gb|ABI57571.1| ABC transporter related protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 241

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 171/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A SL K+Y    VV+   L V  GEIVGLLGPNGAGKTT FYM+ GL+ AD G I 
Sbjct: 2   SRLEAKSLVKRYRGRTVVEEASLTVDAGEIVGLLGPNGAGKTTCFYMVVGLVRADGGQIL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           ++G DIT +PM+ RAR GI YLPQEAS+FR +TV +NI+A+LE   + D++ R E+L  L
Sbjct: 62  LNGEDITALPMHARARKGIGYLPQEASVFRKMTVAQNIMAILETRPDLDRRARREQLQQL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EF++          LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +IR
Sbjct: 122 LDEFHVPHLADQSGISLSGGERRRVEIARALAANPQFILLDEPFAGVDPISVVDIQHIIR 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIG+LITDHNV E L +++RAYI+  G V+A G+ +E++ NQ VR +YLG+ F
Sbjct: 182 QLTERGIGVLITDHNVRETLGIVERAYILSQGRVIARGSAEEVLANQAVREVYLGEHF 239


>gi|326315297|ref|YP_004232969.1| sulfate-transporting ATPase [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323372133|gb|ADX44402.1| Sulfate-transporting ATPase [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 263

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 174/243 (71%), Gaps = 6/243 (2%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A  L K Y +  VVK V + V+ GE+VGLLGPNGAGKTT FYM+ GL+ +D G I+
Sbjct: 19  SRLEAMHLEKSYGTRKVVKDVSMVVQKGEVVGLLGPNGAGKTTSFYMIVGLVRSDGGDIR 78

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD------KKKRHE 137
           IDG  +  MP++RR+RLG+SYLPQEASIFR L+VEEN+ AVLE+   D      + +  E
Sbjct: 79  IDGQSVANMPIHRRSRLGLSYLPQEASIFRKLSVEENVRAVLELQRGDDGRPLSRAEIEE 138

Query: 138 KLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDI 197
           +L +LL+E  +   R   A  LSGG+RRR+EIAR+L + P +ILLDEPFAG+DP+A+ +I
Sbjct: 139 RLTALLQELRVDHLRASPALALSGGERRRVEIARALATQPRFILLDEPFAGIDPIAVIEI 198

Query: 198 HVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLG 257
             +I  L +RGIG+LITDHNV E L + D A+II  G VLA GT  EI+DN +VRR+YLG
Sbjct: 199 QRIIGFLKARGIGVLITDHNVRETLGICDHAFIISDGRVLAQGTPSEIVDNAEVRRVYLG 258

Query: 258 DRF 260
           + F
Sbjct: 259 EHF 261


>gi|325208818|gb|ADZ04270.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           meningitidis NZ-05/33]
          Length = 254

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 170/239 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE++GLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 16  SRLVVQNLQKSFKKRQVVKSFSLEIESGEVIGLLGPNGAGKTTSFYMIVGLIAADAGSVM 75

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 76  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEIRTKDKNQIDREIEKLL 135

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI   R   AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 136 ADLNIGHLRRSPAPSLSGGERRRVEIARVLAMKPHFILLDEPFAGVDPIAVIDIQKIIGF 195

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   +++ N+ VR +YLG  F +
Sbjct: 196 LKSRGIGVLITDHNVRETLSICDRAYIISDGAVLASGKPDDLVGNEQVRSVYLGKNFKY 254


>gi|91790318|ref|YP_551270.1| ABC transporter-like protein [Polaromonas sp. JS666]
 gi|91699543|gb|ABE46372.1| ABC transporter related protein [Polaromonas sp. JS666]
          Length = 268

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 138/243 (56%), Positives = 171/243 (70%), Gaps = 6/243 (2%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A  L K Y S  VV+ V L V+ GE+VGLLGPNGAGKTT FYM+ GL+ AD+G I 
Sbjct: 24  SRLVAQGLQKSYGSRKVVQDVSLSVQKGEVVGLLGPNGAGKTTSFYMIVGLVRADAGEIS 83

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR------HE 137
           IDG  +  MP++ RARLG+SYLPQEASIFR LTVEEN+ AVLE+      K         
Sbjct: 84  IDGQSVEHMPIHLRARLGLSYLPQEASIFRKLTVEENVRAVLELQRDATGKPLRRADLEA 143

Query: 138 KLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDI 197
           +LD+LL++  +   R   AP LSGG+RRR+EIAR+L + P +ILLDEPFAG+DP+A+ +I
Sbjct: 144 RLDALLQDLRVDHLRDSPAPALSGGERRRVEIARALATQPRFILLDEPFAGIDPIAVIEI 203

Query: 198 HVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLG 257
             +I  L SRGIG+LITDHNV E L + D AYII  G VLA G   EI++N DVRR+YLG
Sbjct: 204 QRIIGFLKSRGIGVLITDHNVRETLGICDHAYIISDGHVLAAGAPSEIVNNADVRRVYLG 263

Query: 258 DRF 260
           + F
Sbjct: 264 EHF 266


>gi|28899443|ref|NP_799048.1| ABC transporter ATP-binding protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153840278|ref|ZP_01992945.1| ABC transporter, ATP-binding protein [Vibrio parahaemolyticus
           AQ3810]
 gi|260363388|ref|ZP_05776240.1| ABC transporter, ATP-binding protein [Vibrio parahaemolyticus
           K5030]
 gi|260879323|ref|ZP_05891678.1| ABC transporter, ATP-binding protein [Vibrio parahaemolyticus
           AN-5034]
 gi|260895718|ref|ZP_05904214.1| ABC transporter, ATP-binding protein [Vibrio parahaemolyticus
           Peru-466]
 gi|260900291|ref|ZP_05908686.1| ABC transporter, ATP-binding protein [Vibrio parahaemolyticus
           AQ4037]
 gi|28807679|dbj|BAC60932.1| ABC transporter, ATP-binding protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149746057|gb|EDM57187.1| ABC transporter, ATP-binding protein [Vibrio parahaemolyticus
           AQ3810]
 gi|308087394|gb|EFO37089.1| ABC transporter, ATP-binding protein [Vibrio parahaemolyticus
           Peru-466]
 gi|308093092|gb|EFO42787.1| ABC transporter, ATP-binding protein [Vibrio parahaemolyticus
           AN-5034]
 gi|308107593|gb|EFO45133.1| ABC transporter, ATP-binding protein [Vibrio parahaemolyticus
           AQ4037]
 gi|308111174|gb|EFO48714.1| ABC transporter, ATP-binding protein [Vibrio parahaemolyticus
           K5030]
 gi|328471420|gb|EGF42315.1| ABC transporter ATP-binding protein [Vibrio parahaemolyticus 10329]
          Length = 241

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 179/238 (75%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++LSA +L K Y    VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G+I 
Sbjct: 2   AVLSAKNLAKSYKKRKVVTDVSLEVESGQIVGLLGPNGAGKTTSFYMIVGLVPRDEGTIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID  DI+ +PM+ R+R+GI YLPQEASIFR L+VE+NI+AVLE   E  +++R +KL+ L
Sbjct: 62  IDDKDISILPMHSRSRMGIGYLPQEASIFRKLSVEDNIMAVLETRQEMTREERQDKLEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP++++DI  +I 
Sbjct: 122 LEEFHIQHIRTSAGMALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVNDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A GT +E+++N+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGHLIASGTPEEVLNNEQVKQVYLGEQF 239


>gi|325143041|gb|EGC65393.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           meningitidis 961-5945]
 gi|325198955|gb|ADY94411.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           meningitidis G2136]
          Length = 244

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 131/239 (54%), Positives = 170/239 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 6   SRLVVQNLQKSFKKRQVVKSFSLEIESGEVVGLLGPNGAGKTTSFYMIVGLIAADAGSVT 65

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 66  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEIRTKDKNQIDREIEKLL 125

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI   R   AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 126 ADLNIGHLRRSPAPSLSGGERRRVEIARVLAMKPHFILLDEPFAGVDPIAVIDIQKIIGF 185

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   +++ N+ VR +YLG  F +
Sbjct: 186 LKSRGIGVLITDHNVRETLSICDRAYIISDGTVLASGKPDDLVGNEQVRSVYLGKNFKY 244


>gi|325202825|gb|ADY98279.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           meningitidis M01-240149]
          Length = 244

 Score =  266 bits (679), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 170/239 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE++GLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 6   SRLVVQNLQKSFKKRQVVKSFSLEIESGEVIGLLGPNGAGKTTSFYMIVGLIAADAGSVM 65

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 66  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEIRTKDKNQIDREIEKLL 125

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI   R   AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 126 ADLNIGHLRRSPAPSLSGGERRRVEIARVLAMKPHFILLDEPFAGVDPIAVIDIQKIIGF 185

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   +++ N+ VR +YLG  F +
Sbjct: 186 LKSRGIGVLITDHNVRETLSICDRAYIISDGAVLASGKPDDLVGNEQVRSVYLGKNFKY 244


>gi|83746569|ref|ZP_00943619.1| ABC transporter ATP-binding protein [Ralstonia solanacearum UW551]
 gi|207727850|ref|YP_002256244.1| atp-binding protein [Ralstonia solanacearum MolK2]
 gi|207742255|ref|YP_002258647.1| atp-binding protein [Ralstonia solanacearum IPO1609]
 gi|83726703|gb|EAP73831.1| ABC transporter ATP-binding protein [Ralstonia solanacearum UW551]
 gi|206591091|emb|CAQ56703.1| atp-binding protein [Ralstonia solanacearum MolK2]
 gi|206593643|emb|CAQ60570.1| atp-binding protein [Ralstonia solanacearum IPO1609]
          Length = 262

 Score =  266 bits (679), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 134/242 (55%), Positives = 176/242 (72%), Gaps = 5/242 (2%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L    L K+Y +  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+G I 
Sbjct: 19  STLVVRHLKKRYGTRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVALDAGDIV 78

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKK-----KRHEK 138
           +DG  I+++P+++RAR+G+SYLPQEAS+FR L V+ENI AVLE+ E+D K     + + +
Sbjct: 79  LDGQHISRLPIHQRARMGLSYLPQEASVFRKLNVQENIRAVLELQEQDGKPLSAAEVNRR 138

Query: 139 LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIH 198
           LD+LL +  IT  R   A  LSGG+RRR+EIAR+L S P +ILLDEPFAGVDP+A+ +I 
Sbjct: 139 LDALLDDLQITHLRDNPALSLSGGERRRVEIARALASAPRFILLDEPFAGVDPIAVGEIQ 198

Query: 199 VLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGD 258
            ++  L  R IG+LITDHNV E L + D AYII  G VLA G  ++I++N+DVR++YLGD
Sbjct: 199 RIVSFLKDRNIGVLITDHNVRETLGICDHAYIISEGTVLAAGMPEQIVENEDVRKVYLGD 258

Query: 259 RF 260
            F
Sbjct: 259 NF 260


>gi|15602036|ref|NP_245108.1| hypothetical protein PM0171 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720390|gb|AAK02255.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 241

 Score =  266 bits (679), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 134/241 (55%), Positives = 175/241 (72%), Gaps = 3/241 (1%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L A  L K Y S  VV  V L V   EIVGLLGPNGAGKTT FYM+ GL+  D G I+
Sbjct: 2   SILYAEHLAKSYKSRQVVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMVVGLVQHDQGKIR 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD--KKKRHEKLDS 141
           ID  DI+ +PM+ RA+ GI YLPQEASIFR L+V +N++AVLE+  KD   ++R E+ D 
Sbjct: 62  IDDEDISLLPMHNRAQRGIGYLPQEASIFRRLSVYDNLMAVLEI-RKDLTPEQRRERADE 120

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           L+ EFNI   RH L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I
Sbjct: 121 LINEFNIDHIRHNLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKII 180

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
            DL  RG+G+LITDHNV E L + +RAYI+ AG ++A GT ++I++N+ V+R+YLG+ F 
Sbjct: 181 MDLRDRGLGVLITDHNVRETLDVCERAYIVSAGKMIATGTPEQILNNEQVKRVYLGEEFK 240

Query: 262 F 262
            
Sbjct: 241 L 241


>gi|121534981|ref|ZP_01666799.1| ABC transporter related [Thermosinus carboxydivorans Nor1]
 gi|121306394|gb|EAX47318.1| ABC transporter related [Thermosinus carboxydivorans Nor1]
          Length = 239

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 130/237 (54%), Positives = 170/237 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           +    L K Y    VV GV L V  G+IVGLLGPNGAGKTT FYM+ GL   + G+I ++
Sbjct: 3   IETKELVKTYKGRNVVNGVSLRVDRGQIVGLLGPNGAGKTTTFYMIVGLEKPNRGAIFVN 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G D+T MPMYRR+R GI YLPQEASIFR LTVEEN+LA+LE       +R +K++SLL+E
Sbjct: 63  GEDVTAMPMYRRSRYGIGYLPQEASIFRKLTVEENLLAILETTNLTPVERRDKMESLLEE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F++T  RH     LSGG+RRR+EIAR+L + PS+ILLDEPFAGVDP+A++DI  +I  L 
Sbjct: 123 FHVTHVRHRKGSELSGGERRRVEIARALATDPSFILLDEPFAGVDPIAVADIQEIIGYLK 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIG+LITDHNV E L+++D AYI++ G +L  G    I +++  R+ YLG++F  
Sbjct: 183 ERGIGVLITDHNVRETLSIVDTAYILNEGQILISGDADTIANSEIARKFYLGEKFTL 239


>gi|258622780|ref|ZP_05717798.1| ABC transporter ATP-binding protein [Vibrio mimicus VM573]
 gi|258625806|ref|ZP_05720685.1| ABC transporter ATP-binding protein [Vibrio mimicus VM603]
 gi|262166555|ref|ZP_06034292.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           mimicus VM223]
 gi|262170532|ref|ZP_06038210.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           mimicus MB-451]
 gi|262401817|ref|ZP_06078382.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           sp. RC586]
 gi|258582044|gb|EEW06914.1| ABC transporter ATP-binding protein [Vibrio mimicus VM603]
 gi|258584968|gb|EEW09699.1| ABC transporter ATP-binding protein [Vibrio mimicus VM573]
 gi|261891608|gb|EEY37594.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           mimicus MB-451]
 gi|262026271|gb|EEY44939.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           mimicus VM223]
 gi|262351789|gb|EEZ00920.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           sp. RC586]
          Length = 241

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 177/238 (74%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K Y    VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G+I 
Sbjct: 2   AILKAQHLAKSYKKRKVVSDVSLQVESGQIVGLLGPNGAGKTTSFYMIVGLVARDEGTIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID NDI+ +PM+ R+R+GI YLPQEASIFR L+VE+NI+AVL+  E+   ++R +KL+ L
Sbjct: 62  IDDNDISILPMHSRSRMGIGYLPQEASIFRKLSVEDNIMAVLQTREELSHEERQDKLEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LEEFHIQHIRKSAGMALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A GT Q++++N+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGRLIAEGTPQDVLNNEQVKQVYLGEQF 239


>gi|156975897|ref|YP_001446804.1| hypothetical protein VIBHAR_03663 [Vibrio harveyi ATCC BAA-1116]
 gi|156527491|gb|ABU72577.1| hypothetical protein VIBHAR_03663 [Vibrio harveyi ATCC BAA-1116]
          Length = 241

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 179/238 (75%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++LSA +L K Y    VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G+I 
Sbjct: 2   AVLSAKNLAKSYKKRKVVTDVSLEVESGQIVGLLGPNGAGKTTSFYMIVGLVPRDEGTIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +PM+ R+RLGI YLPQEASIFR L+VE+NI+AVLE  ++  +++R +KL+ L
Sbjct: 62  IDNQDISILPMHNRSRLGIGYLPQEASIFRKLSVEDNIMAVLETRQELTREERQDKLEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP++++DI  +I 
Sbjct: 122 LEEFHIQHIRTSAGMALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVNDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A GT  E+++N+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGHLIASGTPDEVLNNEQVKQVYLGEQF 239


>gi|332289511|ref|YP_004420363.1| putative ABC transporter ATP-binding protein YhbG [Gallibacterium
           anatis UMN179]
 gi|330432407|gb|AEC17466.1| putative ABC transporter ATP-binding protein YhbG [Gallibacterium
           anatis UMN179]
          Length = 241

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 180/240 (75%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+LSA  L+K Y    VV GV L +  GEIVGLLGPNGAGKTT FYM+ GLI  D G I 
Sbjct: 2   SVLSAEQLSKSYKGRPVVNGVSLTINSGEIVGLLGPNGAGKTTTFYMVVGLISHDQGKIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+++PM++RA+ GI YLPQEASIFR L+V +N++AVLE+ +   K++R ++L+ L
Sbjct: 62  IDNQDISRLPMHQRAKQGIGYLPQEASIFRRLSVYDNLMAVLEIRKDLSKEQRVDELERL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+IT  +  +   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I+
Sbjct: 122 LEEFHITHIKDNIGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVLDIKNIIK 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L  RG+G+LITDHNV E L + +RAYI+ AG ++A GT Q+++ ++ V+R+YLG+ F  
Sbjct: 182 GLRDRGLGVLITDHNVRETLDVCERAYIVSAGTMIADGTPQQVLADEHVKRVYLGEHFKL 241


>gi|309378632|emb|CBX22703.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 244

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 172/239 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 6   SRLVVQNLQKSFKKRQVVKNFSLEIESGEVVGLLGPNGAGKTTGFYMIVGLIAADAGSVM 65

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++ ++P++ RARLGI YLPQE SIFR +TVE+NI A+LE+  KDKK+   +++ LL
Sbjct: 66  LDGRELRRLPIHERARLGIGYLPQENSIFRKMTVEQNIRAILEIRIKDKKQIDGEVEKLL 125

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI   R   AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 126 ADLNIGHLRRSPAPALSGGERRRVEIARVLAVKPRFILLDEPFAGVDPIAVIDIQKIIVF 185

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   +++ N+ VR +YLG+ F +
Sbjct: 186 LKSRGIGVLITDHNVRETLSICDRAYIISDGAVLASGRPDDLVGNEKVRAVYLGENFKY 244


>gi|94501785|ref|ZP_01308298.1| ABC transporter, ATP-binding protein [Oceanobacter sp. RED65]
 gi|94426093|gb|EAT11088.1| ABC transporter, ATP-binding protein [Oceanobacter sp. RED65]
          Length = 241

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 129/240 (53%), Positives = 173/240 (72%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A +L K Y    VV+ V + ++ G+IVGLLGPNGAGKTT FYM+  L+ AD G I 
Sbjct: 2   AILKAQNLAKSYGPRQVVEDVSMSIESGQIVGLLGPNGAGKTTCFYMIVNLVNADKGRIV 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DIT +PM+ RA+ GI YLPQEASIFR LTV  NILA+LE  +  + K+R EKL+SL
Sbjct: 62  IDDQDITDLPMHGRAQRGIGYLPQEASIFRKLTVANNILAILETRKDLNNKQRQEKLESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EF+I   R  L   LSGG+RRR+EIAR+L + PS+ILLDEPFAGVDP+++ DI  +++
Sbjct: 122 LDEFHIQHIRDSLGMALSGGERRRVEIARALAAEPSFILLDEPFAGVDPISVGDIKSIVK 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L  RG+G+LITDHNV E L + ++AYI+  G ++A G  ++++ NQ V+ +YLGD F  
Sbjct: 182 QLKERGLGVLITDHNVRETLDICEKAYIVGNGHIIAEGNAEQVLANQQVKDIYLGDDFKL 241


>gi|294783332|ref|ZP_06748656.1| ABC transporter, ATP-binding protein [Fusobacterium sp. 1_1_41FAA]
 gi|294480210|gb|EFG27987.1| ABC transporter, ATP-binding protein [Fusobacterium sp. 1_1_41FAA]
          Length = 241

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 133/235 (56%), Positives = 168/235 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LSA +L K Y    VV  V L V  GEIVGLLGPNGAGKTT FYM+TG++  D G +   
Sbjct: 4   LSADNLVKAYKGRKVVDRVSLEVNKGEIVGLLGPNGAGKTTTFYMITGIVRPDDGEVLCA 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             DIT +PMY+RA +GI YL QE S+FR LTVEENI  VLE+    KK++   +D LL+E
Sbjct: 64  EEDITNLPMYKRADMGIGYLAQEPSVFRNLTVEENIEVVLEMKGISKKEQRATVDKLLEE 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T  R  L   LSGG+RRR+EIAR++ + PS+ILLDEPFAGVDP+A+ DI  +IR L 
Sbjct: 124 FKLTHVRDSLGYALSGGERRRIEIARTIANNPSFILLDEPFAGVDPIAVEDIQNIIRHLK 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            RG+GILITDHNV E L++ DR+YI+  G VL  GT +EI +N + RR+YLG++F
Sbjct: 184 KRGLGILITDHNVRETLSITDRSYIMAKGKVLIEGTPREIANNPEARRIYLGEKF 238


>gi|237746786|ref|ZP_04577266.1| ABC transporter ATP-binding protein [Oxalobacter formigenes HOxBLS]
 gi|229378137|gb|EEO28228.1| ABC transporter ATP-binding protein [Oxalobacter formigenes HOxBLS]
          Length = 247

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 136/235 (57%), Positives = 173/235 (73%), Gaps = 5/235 (2%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K Y    VV  V L V  GE+VGLLGPNGAGKTT FYM+ GL+ AD G+I++DG D+T
Sbjct: 11  LQKTYGKRTVVSNVSLNVSSGEVVGLLGPNGAGKTTSFYMIVGLVPADDGTIELDGIDLT 70

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKK--KRHE---KLDSLLKE 145
           ++P+++RA +G+SYLPQEAS+FR L VE+NI AVLE+ +KD K   ++E   KLD LL E
Sbjct: 71  RLPIHKRASMGLSYLPQEASVFRKLNVEDNIRAVLELQKKDGKPLSKNEIELKLDGLLAE 130

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
             I K R   A  LSGG+RRR+EIAR+L S P +ILLDEPFAG+DP+A+ +I  ++R L 
Sbjct: 131 LQIEKLRTNSALSLSGGERRRVEIARALASDPHFILLDEPFAGIDPIAVIEIQRIVRFLK 190

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            RGIG+LITDHNV E L + D AYII+ G VLA G  +EII N+ VRR+YLG+ F
Sbjct: 191 ERGIGVLITDHNVRETLGICDHAYIINQGTVLASGHPEEIIQNESVRRVYLGEHF 245


>gi|15676271|ref|NP_273405.1| ABC transporter, ATP-binding protein [Neisseria meningitidis MC58]
 gi|7225578|gb|AAF40799.1| ABC transporter, ATP-binding protein [Neisseria meningitidis MC58]
 gi|316984362|gb|EFV63336.1| ABC transporter family protein [Neisseria meningitidis H44/76]
 gi|325141005|gb|EGC63511.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           meningitidis CU385]
          Length = 254

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 170/239 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE++GLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 16  SRLVVQNLQKSFKKRQVVKSFSLEIESGEVIGLLGPNGAGKTTSFYMIVGLIAADAGSVT 75

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 76  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEIRTKDKNQIDREIEKLL 135

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI   R   AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 136 ADLNIGHLRRSPAPSLSGGERRRVEIARVLAMKPHFILLDEPFAGVDPIAVIDIQKIIGF 195

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   +++ N+ VR +YLG  F +
Sbjct: 196 LKSRGIGVLITDHNVRETLSICDRAYIISDGTVLASGKPDDLVGNEQVRSVYLGKNFKY 254


>gi|325199550|gb|ADY95005.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           meningitidis H44/76]
          Length = 244

 Score =  265 bits (678), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 170/239 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE++GLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 6   SRLVVQNLQKSFKKRQVVKSFSLEIESGEVIGLLGPNGAGKTTSFYMIVGLIAADAGSVT 65

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 66  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEIRTKDKNQIDREIEKLL 125

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI   R   AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 126 ADLNIGHLRRSPAPSLSGGERRRVEIARVLAMKPHFILLDEPFAGVDPIAVIDIQKIIGF 185

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   +++ N+ VR +YLG  F +
Sbjct: 186 LKSRGIGVLITDHNVRETLSICDRAYIISDGTVLASGKPDDLVGNEQVRSVYLGKNFKY 244


>gi|82701220|ref|YP_410786.1| ABC transporter related [Nitrosospira multiformis ATCC 25196]
 gi|82409285|gb|ABB73394.1| ABC transporter related protein [Nitrosospira multiformis ATCC
           25196]
          Length = 268

 Score =  265 bits (678), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 139/250 (55%), Positives = 177/250 (70%)

Query: 11  EMPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYM 70
           + PE     + K S   A +L K Y S  VV  V L VK GE+VGLLGPNGAGKTT FYM
Sbjct: 17  QAPEAPLVSSGKRSEFRAENLKKSYKSRTVVHDVSLSVKSGEVVGLLGPNGAGKTTCFYM 76

Query: 71  MTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK 130
           M GL+  D GSI +D  D+++MPM+ RARLG+SYLPQEASIFR L+V +NI AVLE+   
Sbjct: 77  MVGLVPLDGGSIVLDELDLSQMPMHERARLGLSYLPQEASIFRRLSVADNIRAVLELKNH 136

Query: 131 DKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVD 190
              +  + LD+LL + +I+  R+  A  LSGG+RRR+EIAR+L + P +ILLDEPFAGVD
Sbjct: 137 GADEMQQHLDNLLHDLHISHIRNSPAISLSGGERRRVEIARALATGPHFILLDEPFAGVD 196

Query: 191 PVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQD 250
           P+A+ DI  +IR L  RGIG+LITDHNV E L + D A+II  G VLA G+  EII N++
Sbjct: 197 PIAVLDIQKIIRFLKERGIGVLITDHNVRETLGICDHAFIISDGRVLASGSPDEIIYNEN 256

Query: 251 VRRLYLGDRF 260
           VR++YLG+ F
Sbjct: 257 VRKVYLGEHF 266


>gi|284036116|ref|YP_003386046.1| ABC transporter [Spirosoma linguale DSM 74]
 gi|283815409|gb|ADB37247.1| ABC transporter related protein [Spirosoma linguale DSM 74]
          Length = 243

 Score =  265 bits (678), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 171/236 (72%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L   +L KKY S  V   V   V+ GEIVGLLGPNGAGKTT FYM  GL+  +SG + I
Sbjct: 2   ILRTENLIKKYGSRLVNNNVSYQVETGEIVGLLGPNGAGKTTSFYMAVGLVKPNSGKVFI 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           D  D+T +PMY+RARLG+ YL QEAS+FR L+VEEN+LAVLE+ +  K ++ +K++ LL+
Sbjct: 62  DDLDVTNLPMYKRARLGLGYLAQEASVFRDLSVEENVLAVLEMTDLPKAQQKQKVEELLE 121

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF++T  R     +LSGG+RRR EIAR+L   P +ILLDEPFAGVDP+A+ DI  ++  L
Sbjct: 122 EFSLTHVRKSKGKVLSGGERRRTEIARALAVDPKFILLDEPFAGVDPIAVEDIQSIVAKL 181

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             R IGILITDHNV+E L++ DRAY++  G +L  GT +E+ +++ VRR+YLG  F
Sbjct: 182 KHRNIGILITDHNVNETLSITDRAYLLFEGKILKQGTAEELANDEQVRRVYLGQHF 237


>gi|295132996|ref|YP_003583672.1| ABC-type transporter ATP-binding protein [Zunongwangia profunda
           SM-A87]
 gi|294981011|gb|ADF51476.1| ABC-type transporter ATP-binding protein [Zunongwangia profunda
           SM-A87]
          Length = 246

 Score =  265 bits (678), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 171/237 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K+Y    VVKG+ L V  GEIVGLLGPNGAGKTT FYM+ GLI  +SGSI +D
Sbjct: 3   LRADDLIKQYKGRKVVKGISLEVNQGEIVGLLGPNGAGKTTSFYMIVGLIKPNSGSIVLD 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             +IT  PMY+RA+ GI YL QEAS+FR L++E+NI++VL++ +  KK+RH K++SL++E
Sbjct: 63  KENITNFPMYKRAQHGIGYLAQEASVFRKLSIEDNIMSVLQLTKLSKKERHMKMESLIEE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +   R     LLSGG+RRR EIAR+L + P +ILLDEPFAGVDPVA+ DI  ++  L 
Sbjct: 123 FGLNHIRTNRGDLLSGGERRRTEIARALATDPKFILLDEPFAGVDPVAVEDIQRIVAQLK 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           ++ IGILITDHNV E L + DR Y++  G +L HG  +E+ +++ VR++YLG  F  
Sbjct: 183 NKNIGILITDHNVQETLAITDRTYLMFEGSILKHGIPEELAEDEMVRKVYLGQNFEL 239


>gi|189501086|ref|YP_001960556.1| ABC transporter-related protein [Chlorobium phaeobacteroides BS1]
 gi|189496527|gb|ACE05075.1| ABC transporter-related protein [Chlorobium phaeobacteroides BS1]
          Length = 244

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 128/239 (53%), Positives = 168/239 (70%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S LS  +L K YN   VV+   L V+ GEIVGLLGPNGAGKTT FYM+ GLI  + G + 
Sbjct: 3   STLSCSNLKKIYNKREVVRSSTLEVRQGEIVGLLGPNGAGKTTTFYMIVGLIRPNVGDVF 62

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +D  +IT +PMY+RARLGI YLPQE+S+FR LTVEENIL+VLE     K ++ E+ + +L
Sbjct: 63  LDERNITALPMYKRARLGIGYLPQESSVFRKLTVEENILSVLEFTSLSKAEQRERTEEML 122

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           ++ NI   R  +   LSGG+RRR EIAR+L   P +ILLDEPFAGVDP+A+ DI  ++  
Sbjct: 123 EDLNIAGIRKSMGYALSGGERRRTEIARALAIRPKFILLDEPFAGVDPIAVEDIQEIVEG 182

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  R IG+LITDHNVHE L++ + AY++  G +   GT +EI DN + R+LYLG++F  
Sbjct: 183 LVKRNIGVLITDHNVHETLSITNHAYLLFDGTIFMQGTPEEIADNPEARKLYLGEKFTL 241


>gi|302381887|ref|YP_003817710.1| ABC transporter [Brevundimonas subvibrioides ATCC 15264]
 gi|302192515|gb|ADL00087.1| ABC transporter related protein [Brevundimonas subvibrioides ATCC
           15264]
          Length = 263

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 136/236 (57%), Positives = 170/236 (72%), Gaps = 1/236 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L   ++ + + +  VV  V L V+ GE+ GLLGPNGAGKTT FYM+TGLI  DSGSI +D
Sbjct: 29  LRVQNIARAFGARQVVADVSLTVQRGEVAGLLGPNGAGKTTCFYMITGLIPPDSGSIWLD 88

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DIT  PMY+R+R+G+ YL QEASIFRG+TVE+NI +V+E+ E  K    E    LL+E
Sbjct: 89  GEDITAQPMYQRSRMGLGYLAQEASIFRGMTVEDNIKSVVELRESGKAIEVETT-RLLEE 147

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
            NI   RH  A  LSGG+RRR+EIARSL   PS++LLDEPFAG+DP+AI+DI  +IR LA
Sbjct: 148 LNIQHLRHAPATGLSGGERRRVEIARSLAGKPSFMLLDEPFAGIDPLAIADIRQVIRYLA 207

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
             GIG+LITDHNV E L +IDRA II  G VL  GT  E+I + +VRR+YLGD + 
Sbjct: 208 GEGIGVLITDHNVRETLDIIDRASIISNGAVLFEGTADEVIHDPEVRRVYLGDLYG 263


>gi|153834584|ref|ZP_01987251.1| ABC transporter, ATP-binding protein [Vibrio harveyi HY01]
 gi|163802927|ref|ZP_02196815.1| RNA polymerase sigma-54 factor [Vibrio sp. AND4]
 gi|148869027|gb|EDL68072.1| ABC transporter, ATP-binding protein [Vibrio harveyi HY01]
 gi|159173334|gb|EDP58160.1| RNA polymerase sigma-54 factor [Vibrio sp. AND4]
          Length = 241

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 179/238 (75%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++LSA +L K Y    VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G+I 
Sbjct: 2   AVLSAKNLAKSYKKRKVVTDVSLEVESGQIVGLLGPNGAGKTTSFYMIVGLVPRDEGTIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +PM+ R+RLGI YLPQEASIFR L+VE+NI+AVLE  ++  +++R +KL+ L
Sbjct: 62  IDNQDISILPMHSRSRLGIGYLPQEASIFRKLSVEDNIMAVLETRQELTREERQDKLEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP++++DI  +I 
Sbjct: 122 LEEFHIQHIRTSAGMALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVNDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A GT  E+++N+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGHLIASGTPDEVLNNEQVKQVYLGEQF 239


>gi|120609121|ref|YP_968799.1| ABC transporter-like protein [Acidovorax citrulli AAC00-1]
 gi|120587585|gb|ABM31025.1| ABC transporter-related protein [Acidovorax citrulli AAC00-1]
          Length = 263

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 173/241 (71%), Gaps = 6/241 (2%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y +  VVK V + V+ GE+VGLLGPNGAGKTT FYM+ GL+ +D G I+ID
Sbjct: 21  LEAMHLEKSYGTRKVVKDVSMVVQKGEVVGLLGPNGAGKTTSFYMIVGLVRSDGGDIRID 80

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD------KKKRHEKL 139
           G  +  MP++RR+RLG+SYLPQEASIFR L+VEEN+ AVLE+   D      + +  E+L
Sbjct: 81  GQSVANMPIHRRSRLGLSYLPQEASIFRKLSVEENVRAVLELQRDDDGRPLSRAEIEERL 140

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
            +LL+E  +   R   A  LSGG+RRR+EIAR+L + P +ILLDEPFAG+DP+A+ +I  
Sbjct: 141 TALLQELRVDHLRASPALALSGGERRRVEIARALATQPRFILLDEPFAGIDPIAVIEIQR 200

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           +I  L +RGIG+LITDHNV E L + D A+II  G VLA GT  EI+DN +VRR+YLG+ 
Sbjct: 201 IIGFLKARGIGVLITDHNVRETLGICDHAFIISDGRVLAQGTPSEIVDNAEVRRVYLGEH 260

Query: 260 F 260
           F
Sbjct: 261 F 261


>gi|254420192|ref|ZP_05033916.1| ABC transporter, ATP-binding protein [Brevundimonas sp. BAL3]
 gi|196186369|gb|EDX81345.1| ABC transporter, ATP-binding protein [Brevundimonas sp. BAL3]
          Length = 264

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 131/233 (56%), Positives = 173/233 (74%), Gaps = 3/233 (1%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           ++ + +    VV  V L V+ GE+ GLLGPNGAGKTT FYM+TGLI  DSG+I +DG DI
Sbjct: 34  NIARAFGQRQVVSDVSLTVQRGEVAGLLGPNGAGKTTCFYMITGLIPPDSGTIWLDGEDI 93

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSLLKEFNI 148
           T  PMY+R+R+G+ YL QEASIFRG+TVE+NI+AV+E+ Y +D+ +   + D LL E +I
Sbjct: 94  TSQPMYQRSRMGLGYLAQEASIFRGMTVEQNIMAVVELNYPRDQLQ--AETDRLLNELHI 151

Query: 149 TKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRG 208
              RH  A  LSGG+RRR+EIAR+L   PS+ILLDEPFAG+DP+AI+DI  +IR LA +G
Sbjct: 152 DHLRHAPATGLSGGERRRVEIARALAGRPSFILLDEPFAGIDPLAIADIRSVIRYLADQG 211

Query: 209 IGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
           IG+LITDHNV E L + DR  II  G VL  GT +E +++ +VRR+YLG+ +A
Sbjct: 212 IGVLITDHNVRETLDITDRVSIISGGSVLFEGTAEEAVNDAEVRRVYLGENYA 264


>gi|329905842|ref|ZP_08274230.1| putative transport protein (ABC superfamily, ATP bind)
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327547482|gb|EGF32298.1| putative transport protein (ABC superfamily, ATP bind)
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 261

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 174/243 (71%), Gaps = 6/243 (2%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L    L K Y    VV  V L V  GE+VGLLGPNGAGKTT FYM+ GL+ +D+G I+
Sbjct: 17  SKLIVTGLKKSYGIRQVVSDVSLDVASGEVVGLLGPNGAGKTTSFYMIVGLVPSDAGEIR 76

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR------HE 137
           +DG DI+++P++RRA LG+SYLPQEAS+FR LTVEENI AVLE+   D  K       +E
Sbjct: 77  LDGVDISRLPIHRRAVLGLSYLPQEASVFRKLTVEENIRAVLELQHDDHGKALTKSVINE 136

Query: 138 KLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDI 197
           +LD+LL++  I K R   A  LSGG+RRR+EIAR+L S P ++LLDEPFAGVDP+A+ +I
Sbjct: 137 RLDTLLQDLQIDKLRESQAMSLSGGERRRVEIARALASNPRFVLLDEPFAGVDPIAVIEI 196

Query: 198 HVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLG 257
             ++R L  RGIG+LITDHNV E L + DRAYII+ G VLA G    II N+ VR++YLG
Sbjct: 197 QRIVRFLKERGIGVLITDHNVRETLGICDRAYIINQGAVLASGRPDAIIANELVRQVYLG 256

Query: 258 DRF 260
           + F
Sbjct: 257 EHF 259


>gi|15642523|ref|NP_232156.1| ABC transporter, ATP-binding protein [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121591543|ref|ZP_01678804.1| ABC transporter, ATP-binding protein [Vibrio cholerae 2740-80]
 gi|121727444|ref|ZP_01680572.1| ABC transporter, ATP-binding protein [Vibrio cholerae V52]
 gi|147674741|ref|YP_001218024.1| ABC transporter, ATP-binding protein [Vibrio cholerae O395]
 gi|153217456|ref|ZP_01951186.1| ABC transporter, ATP-binding protein [Vibrio cholerae 1587]
 gi|153801084|ref|ZP_01955670.1| ABC transporter, ATP-binding protein [Vibrio cholerae MZO-3]
 gi|153818033|ref|ZP_01970700.1| ABC transporter, ATP-binding protein [Vibrio cholerae NCTC 8457]
 gi|153822408|ref|ZP_01975075.1| ABC transporter, ATP-binding protein [Vibrio cholerae B33]
 gi|153825818|ref|ZP_01978485.1| ABC transporter, ATP-binding protein [Vibrio cholerae MZO-2]
 gi|153829815|ref|ZP_01982482.1| ABC transporter, ATP-binding protein [Vibrio cholerae 623-39]
 gi|227082646|ref|YP_002811197.1| ABC transporter, ATP-binding protein [Vibrio cholerae M66-2]
 gi|229507416|ref|ZP_04396921.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholerae BX 330286]
 gi|229509659|ref|ZP_04399140.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholerae B33]
 gi|229513452|ref|ZP_04402916.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholerae TMA 21]
 gi|229516784|ref|ZP_04406230.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholerae RC9]
 gi|229521593|ref|ZP_04411011.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholerae TM 11079-80]
 gi|229606923|ref|YP_002877571.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholerae MJ-1236]
 gi|254225921|ref|ZP_04919523.1| ABC transporter, ATP-binding protein [Vibrio cholerae V51]
 gi|254291444|ref|ZP_04962236.1| ABC transporter, ATP-binding protein [Vibrio cholerae AM-19226]
 gi|254851071|ref|ZP_05240421.1| ABC transporter [Vibrio cholerae MO10]
 gi|255744496|ref|ZP_05418448.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholera CIRS 101]
 gi|261211088|ref|ZP_05925377.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           sp. RC341]
 gi|262154680|ref|ZP_06028806.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholerae INDRE 91/1]
 gi|262167556|ref|ZP_06035261.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholerae RC27]
 gi|297581373|ref|ZP_06943296.1| ABC transporter [Vibrio cholerae RC385]
 gi|298500644|ref|ZP_07010448.1| ABC transporter [Vibrio cholerae MAK 757]
 gi|2317737|gb|AAC46369.1| putative ABC transporter ATP-binding protein [Vibrio cholerae]
 gi|9657111|gb|AAF95669.1| ABC transporter, ATP-binding protein [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121546597|gb|EAX56791.1| ABC transporter, ATP-binding protein [Vibrio cholerae 2740-80]
 gi|121630216|gb|EAX62616.1| ABC transporter, ATP-binding protein [Vibrio cholerae V52]
 gi|124113545|gb|EAY32365.1| ABC transporter, ATP-binding protein [Vibrio cholerae 1587]
 gi|124123317|gb|EAY42060.1| ABC transporter, ATP-binding protein [Vibrio cholerae MZO-3]
 gi|125621547|gb|EAZ49879.1| ABC transporter, ATP-binding protein [Vibrio cholerae V51]
 gi|126511468|gb|EAZ74062.1| ABC transporter, ATP-binding protein [Vibrio cholerae NCTC 8457]
 gi|126520051|gb|EAZ77274.1| ABC transporter, ATP-binding protein [Vibrio cholerae B33]
 gi|146316624|gb|ABQ21163.1| ABC transporter, ATP-binding protein [Vibrio cholerae O395]
 gi|148874733|gb|EDL72868.1| ABC transporter, ATP-binding protein [Vibrio cholerae 623-39]
 gi|149740541|gb|EDM54656.1| ABC transporter, ATP-binding protein [Vibrio cholerae MZO-2]
 gi|150422634|gb|EDN14589.1| ABC transporter, ATP-binding protein [Vibrio cholerae AM-19226]
 gi|227010534|gb|ACP06746.1| ABC transporter, ATP-binding protein [Vibrio cholerae M66-2]
 gi|227014417|gb|ACP10627.1| ABC transporter, ATP-binding protein [Vibrio cholerae O395]
 gi|229341187|gb|EEO06191.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholerae TM 11079-80]
 gi|229345847|gb|EEO10819.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholerae RC9]
 gi|229349329|gb|EEO14285.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholerae TMA 21]
 gi|229353133|gb|EEO18072.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholerae B33]
 gi|229354921|gb|EEO19842.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholerae BX 330286]
 gi|229369578|gb|ACQ60001.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholerae MJ-1236]
 gi|254846776|gb|EET25190.1| ABC transporter [Vibrio cholerae MO10]
 gi|255738021|gb|EET93414.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholera CIRS 101]
 gi|260839589|gb|EEX66200.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           sp. RC341]
 gi|262024009|gb|EEY42705.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholerae RC27]
 gi|262030520|gb|EEY49158.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholerae INDRE 91/1]
 gi|297534211|gb|EFH73049.1| ABC transporter [Vibrio cholerae RC385]
 gi|297540813|gb|EFH76870.1| ABC transporter [Vibrio cholerae MAK 757]
          Length = 241

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 177/238 (74%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K Y    VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G+I 
Sbjct: 2   AILKAQHLAKSYKKRKVVSDVSLQVESGQIVGLLGPNGAGKTTSFYMIVGLVARDEGTIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID NDI+ +PM+ R+R+GI YLPQEASIFR L+VE+NI+AVL+  E+   ++R +KL+ L
Sbjct: 62  IDDNDISILPMHSRSRMGIGYLPQEASIFRKLSVEDNIMAVLQTREELTHEERQDKLEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LEEFHIQHIRKSAGMALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A GT Q++++N+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGRLIAEGTPQDVLNNEQVKQVYLGEQF 239


>gi|89093948|ref|ZP_01166893.1| ABC transporter, ATP-binding protein [Oceanospirillum sp. MED92]
 gi|89081834|gb|EAR61061.1| ABC transporter, ATP-binding protein [Oceanospirillum sp. MED92]
          Length = 241

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 174/240 (72%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A +L K+Y    VVK V L +  GEIVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   SQLEALNLAKRYKGREVVKDVSLSIDRGEIVGLLGPNGAGKTTCFYMIVGLVQADRGKVS 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           I   DIT +PM+ RAR GI YLPQEASIFR ++V++N+LA+LE  +  DK   ++K+  L
Sbjct: 62  IADCDITALPMHGRARKGIGYLPQEASIFRKMSVKDNLLAILENRKDLDKATANKKMQEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+IT  R  L   LSGG+RRR+EIAR+L + P ++LLDEPFAGVDP++++DI   +R
Sbjct: 122 LEEFHITHIRDSLGMSLSGGERRRVEIARALATEPDFVLLDEPFAGVDPISVNDIKQTVR 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L SRGIGILITDHNV E L + +RAYI+  G +LA G+ +EI+ N  V+  YLGD+F+ 
Sbjct: 182 HLQSRGIGILITDHNVRETLDICERAYIVSEGTILATGSPEEILANDAVKNAYLGDQFSL 241


>gi|149190588|ref|ZP_01868857.1| ABC transporter, ATP-binding protein [Vibrio shilonii AK1]
 gi|148835586|gb|EDL52554.1| ABC transporter, ATP-binding protein [Vibrio shilonii AK1]
          Length = 241

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 176/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           +LL A  L K Y +  VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G+I 
Sbjct: 2   ALLKATHLAKSYKNRKVVSDVSLSVESGQIVGLLGPNGAGKTTSFYMIVGLVARDEGTIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           IDG DI+ +PM+ RA++GI YLPQEASIFR L+VE NI+AVLE   E  +++R +KL+ L
Sbjct: 62  IDGEDISILPMHSRAKMGIGYLPQEASIFRKLSVENNIMAVLETRNEITQEERQDKLEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EFNI   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LDEFNIQHIRKSAGMALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A G+ +++++N+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGHLIAEGSPEDVLNNEHVKQVYLGEQF 239


>gi|302325878|gb|ADL25079.1| ABC transporter, ATP-binding protein [Fibrobacter succinogenes
           subsp. succinogenes S85]
          Length = 242

 Score =  265 bits (677), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 127/237 (53%), Positives = 171/237 (72%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S +    L K Y    VV  V + V  GEIVGLLGPNGAGKTT FYM+ G++  D+G I 
Sbjct: 3   STIRTDKLRKIYGHRQVVSDVSIQVSQGEIVGLLGPNGAGKTTTFYMIVGMVRPDAGHIF 62

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +D  ++T  PMY+RARLG+ YLPQEASIFR L+VE+NI+A+LE  +  + +R +KL+ LL
Sbjct: 63  LDDIEMTDKPMYKRARLGVGYLPQEASIFRKLSVEDNIMAILETQDMKRAERKKKLEQLL 122

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EF IT  R   +   SGG+RRRLEIAR+L S PS++LLDEPFAG+DP+A++DI  +I +
Sbjct: 123 EEFKITHIRKTKSMSCSGGERRRLEIARALASDPSFLLLDEPFAGIDPIAVADIQSIISE 182

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RG+G+LITDHNV E L++ DRAYI++   VL  G+ Q + ++ + RR+YLGD F
Sbjct: 183 LKDRGMGVLITDHNVRETLSITDRAYIMYKSQVLTEGSSQHLAEDPEARRIYLGDSF 239


>gi|261415642|ref|YP_003249325.1| ABC transporter related protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261372098|gb|ACX74843.1| ABC transporter related protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 245

 Score =  265 bits (677), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 127/237 (53%), Positives = 171/237 (72%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S +    L K Y    VV  V + V  GEIVGLLGPNGAGKTT FYM+ G++  D+G I 
Sbjct: 6   STIRTDKLRKIYGHRQVVSDVSIQVSQGEIVGLLGPNGAGKTTTFYMIVGMVRPDAGHIF 65

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +D  ++T  PMY+RARLG+ YLPQEASIFR L+VE+NI+A+LE  +  + +R +KL+ LL
Sbjct: 66  LDDIEMTDKPMYKRARLGVGYLPQEASIFRKLSVEDNIMAILETQDMKRAERKKKLEQLL 125

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EF IT  R   +   SGG+RRRLEIAR+L S PS++LLDEPFAG+DP+A++DI  +I +
Sbjct: 126 EEFKITHIRKTKSMSCSGGERRRLEIARALASDPSFLLLDEPFAGIDPIAVADIQSIISE 185

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RG+G+LITDHNV E L++ DRAYI++   VL  G+ Q + ++ + RR+YLGD F
Sbjct: 186 LKDRGMGVLITDHNVRETLSITDRAYIMYKSQVLTEGSSQHLAEDPEARRIYLGDSF 242


>gi|254229281|ref|ZP_04922699.1| ABC-type [Vibrio sp. Ex25]
 gi|262393177|ref|YP_003285031.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           sp. Ex25]
 gi|151938205|gb|EDN57045.1| ABC-type [Vibrio sp. Ex25]
 gi|262336771|gb|ACY50566.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           sp. Ex25]
          Length = 241

 Score =  265 bits (677), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 178/238 (74%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++LSA +L K Y    VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G+I 
Sbjct: 2   AVLSAKNLAKSYKKRKVVTDVSLEVESGQIVGLLGPNGAGKTTSFYMIVGLVPRDEGTIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID  DI+ +PM+ R+RLGI YLPQEASIFR L+VE+NI+AVLE   E  +++R +KL+ L
Sbjct: 62  IDDKDISILPMHSRSRLGIGYLPQEASIFRKLSVEDNIMAVLETRQEMTREERQDKLEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP++++DI  +I 
Sbjct: 122 LEEFHIQHIRTSAGMALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVNDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A GT  E+++N+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGHLIASGTPAEVLNNEQVKQVYLGEQF 239


>gi|218768868|ref|YP_002343380.1| putative ABC transporter ATP-binding protein [Neisseria
           meningitidis Z2491]
 gi|121052876|emb|CAM09228.1| putative ABC transporter ATP-binding protein [Neisseria
           meningitidis Z2491]
          Length = 254

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 169/239 (70%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GLI AD+GS+ 
Sbjct: 16  SRLVVQNLQKSFKKRQVVKSFSLEIESGEVVGLLGPNGAGKTTSFYMIVGLIAADAGSVM 75

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG ++  +P++ RARLG+ YLPQEASIFR +TVE+NI A+LE+  KDK +   +++ LL
Sbjct: 76  LDGQELRHLPIHERARLGVGYLPQEASIFRKMTVEQNIRAILEIRTKDKNQIDREIEKLL 135

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI   R    P LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 136 ADLNIGHLRRSPTPSLSGGERRRVEIARVLAMKPHFILLDEPFAGVDPIAVIDIQKIIGF 195

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SRGIG+LITDHNV E L++ DRAYII  G VLA G   +++ N+ VR +YLG  F +
Sbjct: 196 LKSRGIGVLITDHNVRETLSICDRAYIISDGAVLASGKPDDLVGNEQVRSVYLGKNFKY 254


>gi|229524510|ref|ZP_04413915.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholerae bv. albensis VL426]
 gi|229338091|gb|EEO03108.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholerae bv. albensis VL426]
          Length = 241

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 177/238 (74%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K Y    VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G+I 
Sbjct: 2   AILKAHHLAKSYKKRKVVSDVSLQVESGQIVGLLGPNGAGKTTSFYMIVGLVARDEGTIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID NDI+ +PM+ R+R+GI YLPQEASIFR L+VE+NI+AVL+  E+   ++R +KL+ L
Sbjct: 62  IDDNDISILPMHSRSRMGIGYLPQEASIFRKLSVEDNIMAVLQTREELTHEERQDKLEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LEEFHIQHIRKSAGMALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A GT Q++++N+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGRLIAEGTPQDVLNNEQVKQVYLGEQF 239


>gi|167835389|ref|ZP_02462272.1| ABC transporter, ATP-binding protein [Burkholderia thailandensis
           MSMB43]
          Length = 258

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 175/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 10  AGTSSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I ++G+ I+ MP+++RA LG+SYLPQEAS+FR LTVE+N+ AVLE+   D  KR  K 
Sbjct: 70  GDISLNGSPISLMPIHKRASLGLSYLPQEASVFRKLTVEQNVRAVLELQHDDNGKRLSKD 129

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL+E  I   R   A  LSGG+RRR+EIAR+L S PS+ILLDEPFAGVDP+A
Sbjct: 130 EIGARTEALLEELQIAHLRENPALSLSGGERRRVEIARALASNPSFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G  +EII+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLASGAPKEIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|167579776|ref|ZP_02372650.1| ABC transporter, ATP-binding protein [Burkholderia thailandensis
           TXDOH]
          Length = 258

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 175/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 10  AGTSSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I ++G+ I+ MP+++RA LG+SYLPQEAS+FR LTVE+N+ AVLE+   D  KR  K 
Sbjct: 70  GDISLNGSPISLMPIHKRASLGLSYLPQEASVFRKLTVEQNVRAVLELQHDDNGKRLAKN 129

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL+E  I   R   A  LSGG+RRR+EIAR+L S PS+ILLDEPFAGVDP+A
Sbjct: 130 EIGARTEALLEELQIAHLRENPALSLSGGERRRVEIARALASNPSFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G  +EII+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLASGAPKEIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|226227024|ref|YP_002761130.1| putative ABC transporter ATP-binding protein [Gemmatimonas
           aurantiaca T-27]
 gi|226090215|dbj|BAH38660.1| putative ABC transporter ATP-binding protein [Gemmatimonas
           aurantiaca T-27]
          Length = 280

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 135/234 (57%), Positives = 168/234 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+LSA  L K Y    VV  V L V  GEIVGLLGPNGAGKTT FYM+ GLI    G I 
Sbjct: 15  SILSAQGLVKVYRGRKVVNDVALRVAQGEIVGLLGPNGAGKTTTFYMLVGLIEPQLGRIH 74

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG DITKMPMY+RAR GI YL QE SIFR LTVEENILA+LE     K++R ++L+SLL
Sbjct: 75  LDGKDITKMPMYQRARQGIGYLSQEPSIFRKLTVEENILAILETLPLSKEERAKRLESLL 134

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            E  I   R   A  LSGG+RRRLEI R+LV+ P +++LDEPFAGVDP+A+ DI  ++ D
Sbjct: 135 DELKIKHLRKSRAYQLSGGERRRLEITRALVTEPKFMMLDEPFAGVDPIAVHDIQSIVAD 194

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLG 257
           L +RGIG+LI+DHNV + L ++DRAYI+  G V   GTV+E++ ++ V + YLG
Sbjct: 195 LRTRGIGVLISDHNVEQTLDIVDRAYIMFEGQVKVSGTVRELVFDEAVAKDYLG 248


>gi|237736818|ref|ZP_04567299.1| ABC transporter ATP-binding protein [Fusobacterium mortiferum ATCC
           9817]
 gi|229420680|gb|EEO35727.1| ABC transporter ATP-binding protein [Fusobacterium mortiferum ATCC
           9817]
          Length = 241

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 131/235 (55%), Positives = 171/235 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LSA +L K Y    VV  V L VK GEIVGLLGPNGAGKTT FYM+TG++  +SG +  D
Sbjct: 4   LSAQNLCKSYKKRKVVDNVSLEVKKGEIVGLLGPNGAGKTTTFYMITGIVKPESGKVFCD 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             ++T  PMY+RA +GI YL QE SIFR LTVEENI AVLE+    K ++ E +D LL+E
Sbjct: 64  NMEVTDYPMYKRANMGIGYLAQEPSIFRNLTVEENIAAVLEMKGISKIEQKETIDKLLEE 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T  +  L   LSGG+RRR+EIAR++ + PS+ILLDEPFAGVDP+A+ DI  +IR L 
Sbjct: 124 FKLTHVQKSLGFSLSGGERRRVEIARTIANNPSFILLDEPFAGVDPIAVEDIQQIIRYLK 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +RG+GILITDH+V E L + ++AYI+  G VL  GT +EI +N+  R++YLG++F
Sbjct: 184 NRGLGILITDHSVRETLRITEKAYIMAQGKVLISGTPEEIAENETARKIYLGEKF 238


>gi|83720803|ref|YP_441044.1| ABC transporter ATP-binding protein [Burkholderia thailandensis
           E264]
 gi|167617851|ref|ZP_02386482.1| ABC transporter, ATP-binding protein [Burkholderia thailandensis
           Bt4]
 gi|257140303|ref|ZP_05588565.1| ABC transporter, ATP-binding protein [Burkholderia thailandensis
           E264]
 gi|83654628|gb|ABC38691.1| ABC transporter, ATP-binding protein [Burkholderia thailandensis
           E264]
          Length = 258

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 175/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 10  AGTSSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I ++G+ I+ MP+++RA LG+SYLPQEAS+FR LTVE+N+ AVLE+   D  KR  K 
Sbjct: 70  GDISLNGSPISLMPIHKRASLGLSYLPQEASVFRKLTVEQNVRAVLELQHDDNGKRLAKS 129

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL+E  I   R   A  LSGG+RRR+EIAR+L S PS+ILLDEPFAGVDP+A
Sbjct: 130 EIGARTEALLEELQIAHLRENPALSLSGGERRRVEIARALASNPSFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G  +EII+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLASGAPKEIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|261401800|ref|ZP_05987925.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           lactamica ATCC 23970]
 gi|313667762|ref|YP_004048046.1| ABC transporter ATP-binding protein [Neisseria lactamica ST-640]
 gi|269208078|gb|EEZ74533.1| lipopolysaccharide ABC transporter, ATP-binding protein [Neisseria
           lactamica ATCC 23970]
 gi|313005224|emb|CBN86657.1| putative ABC transporter ATP-binding protein [Neisseria lactamica
           020-06]
          Length = 244

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 131/243 (53%), Positives = 173/243 (71%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           +   S L   +L K +    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GLI AD+
Sbjct: 2   SENTSRLVVQNLQKSFKKRQVVKNFSLEIESGEVVGLLGPNGAGKTTGFYMIVGLIAADA 61

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           GS+ +DG ++ ++P++ RARLGI YLPQE SIFR +TVE+NI A+LE+  +DKK+   ++
Sbjct: 62  GSVMLDGRELRRLPIHERARLGIGYLPQENSIFRKMTVEQNIRAILEIRIRDKKQIDGEV 121

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL + NI   R   AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  
Sbjct: 122 EKLLADLNIGHLRRSPAPALSGGERRRVEIARVLAVKPRFILLDEPFAGVDPIAVIDIQK 181

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           +I  L SRGIG+LITDHNV E L++ DRAYII  G VLA G   +++ N+ VR +YLG+ 
Sbjct: 182 IIGFLKSRGIGVLITDHNVRETLSICDRAYIISDGAVLASGRPDDLVGNEKVRAVYLGEN 241

Query: 260 FAF 262
           F +
Sbjct: 242 FKY 244


>gi|110833414|ref|YP_692273.1| ABC transporter ATP-binding protein [Alcanivorax borkumensis SK2]
 gi|110646525|emb|CAL16001.1| ABC transporter, ATP-binding protein, putative [Alcanivorax
           borkumensis SK2]
          Length = 241

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 137/238 (57%), Positives = 171/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A  L K Y    V++ V L V+ G+IVGLLGPNGAGKTT FYM+ GL+ AD+G I+
Sbjct: 2   SHLRAHHLAKSYKGRRVIEDVSLDVEAGQIVGLLGPNGAGKTTCFYMIVGLVEADAGRIE 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           I+  DIT +PM+ RA+ GI YLPQEASIFR LTVEENI+A+LE   E  K +RHE+++ L
Sbjct: 62  INDTDITHLPMHGRAQRGIGYLPQEASIFRRLTVEENIMAILETRKELSKAERHERMEGL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           LKEF+I   R  L   LSGG+RRR EIAR L + P +ILLDEPFAGVDP++++DI  +IR
Sbjct: 122 LKEFHIGHIRDSLGMSLSGGERRRAEIARGLATDPDFILLDEPFAGVDPISVNDIKGIIR 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIG+LITDHNV E L + D AYI+ AG ++A G    I+ NQ VR +YLG  F
Sbjct: 182 HLKERGIGVLITDHNVRETLDICDTAYIVSAGHIIASGDADIILANQQVRDVYLGADF 239


>gi|54310342|ref|YP_131362.1| putative ABC transporter, ATP-binding protein [Photobacterium
           profundum SS9]
 gi|46914783|emb|CAG21560.1| putative ABC transporter, ATP-binding protein [Photobacterium
           profundum SS9]
          Length = 241

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 175/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K YN   VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G I 
Sbjct: 2   AILKAEHLAKSYNGRKVVSDVSLEVESGKIVGLLGPNGAGKTTSFYMIVGLVARDEGKIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           IDG DI+  PM+ R+R+GI YLPQEASIFR L+V +N++AVL+   E  K++R +KL+ L
Sbjct: 62  IDGTDISLQPMHNRSRMGIGYLPQEASIFRRLSVHDNLMAVLQTRKEITKQQRQDKLEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EFNI   R+ L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LNEFNIQHIRNSLGMALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + + AYI+  G ++A+GT  ++++++ V+R+YLGD+F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEHAYIVSQGHLIANGTPSDVLNDEHVKRVYLGDQF 239


>gi|258591944|emb|CBE68249.1| putative lipopolysaccharide transport protein B: ATP-binding
           component of ABC superfamily [NC10 bacterium 'Dutch
           sediment']
          Length = 241

 Score =  265 bits (676), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 120/237 (50%), Positives = 175/237 (73%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L   +L K +    VV GV + ++ GE+VGLLGPNGAGKTT FYM+ GL+  D G + ++
Sbjct: 5   LRTDNLVKSFKGRTVVAGVSISLEAGEVVGLLGPNGAGKTTTFYMVLGLLKPDRGQVILN 64

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G D+T +P+Y+RAR G+ +LPQE SIFR LTVE+N++A+LE+ +  +++R ++L+SLL+E
Sbjct: 65  GEDVTDLPVYKRARKGLGFLPQEPSIFRKLTVEQNVMAILEILDLSEEERRQRLESLLQE 124

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
            ++T      A  LSGG+RRR EI R+LV+ P+++LLDEPFAG+DP+AI+DI  +I  L 
Sbjct: 125 LDLTHLAKSKAYTLSGGERRRAEITRALVTSPNFMLLDEPFAGIDPIAIADIQTIIARLK 184

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            +G+G+LITDHNV E L ++DRAY+I+ G VL  GT QE+  ++  R +YLG+RF+ 
Sbjct: 185 QKGVGVLITDHNVRETLQIVDRAYLIYEGRVLVSGTAQELASDERAREIYLGERFSL 241


>gi|114564537|ref|YP_752051.1| ABC transporter related [Shewanella frigidimarina NCIMB 400]
 gi|114335830|gb|ABI73212.1| ABC transporter related [Shewanella frigidimarina NCIMB 400]
          Length = 243

 Score =  265 bits (676), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 174/238 (73%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L+A +L K Y +  VVK V L VK G+IVGLLGPNGAGKTT FYM+ GL+ +D G I ID
Sbjct: 6   LTAENLAKSYKARQVVKDVSLTVKTGQIVGLLGPNGAGKTTTFYMVVGLVKSDKGRILID 65

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSLLK 144
            +D+T  PM+ RAR GI YLPQEASIFR LTV +NI+AVL+   E    +R E+L+ LL+
Sbjct: 66  DDDLTADPMHLRARKGIGYLPQEASIFRKLTVYDNIMAVLQTRKELSTDQRIEQLEHLLE 125

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+IT  R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I+ L
Sbjct: 126 EFHITHIRDSQGMSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIQQL 185

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            +RG+G+LITDHNV E L + +RAYI+  G ++A GT  EI+ NQ VR +YLG++F  
Sbjct: 186 KNRGLGVLITDHNVRETLDVCERAYIVSQGNLIAEGTPDEILSNQQVRAVYLGEQFKL 243


>gi|255318176|ref|ZP_05359415.1| ABC transporter, ATP-binding protein [Acinetobacter radioresistens
           SK82]
 gi|262379615|ref|ZP_06072771.1| urea ABC transporter, ATP-binding protein UrtD [Acinetobacter
           radioresistens SH164]
 gi|255304722|gb|EET83900.1| ABC transporter, ATP-binding protein [Acinetobacter radioresistens
           SK82]
 gi|262299072|gb|EEY86985.1| urea ABC transporter, ATP-binding protein UrtD [Acinetobacter
           radioresistens SH164]
          Length = 248

 Score =  265 bits (676), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 175/246 (71%), Gaps = 1/246 (0%)

Query: 17  ENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLIC 76
           E   S+   L+   L K YN  +VVK V   ++ G+IVGLLGPNGAGKTT FYM+ GL+ 
Sbjct: 2   EQSLSQPQTLTIKHLAKNYNKRWVVKDVSFSMQSGQIVGLLGPNGAGKTTSFYMVVGLVR 61

Query: 77  ADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKR 135
            D G I +D  D++ + M+ RAR GI YLPQEASIFR LT+ ENI+A+LE     +K++R
Sbjct: 62  MDKGEIHLDHLDLSDLAMHERARKGIGYLPQEASIFRKLTIAENIMAILETRRDLNKQQR 121

Query: 136 HEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAIS 195
            ++L+ LL +F IT  +  L   +SGG+RRR EIAR+L + P ++LLDEPFAGVDP+++ 
Sbjct: 122 QQRLNELLNDFKITHIKDSLGMSVSGGERRRAEIARALAADPKFMLLDEPFAGVDPISVG 181

Query: 196 DIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLY 255
           DI  +IR+L  RGIG+LITDHNV E L + ++AYI+  G V+A GT QEI++N+ VR++Y
Sbjct: 182 DIKDIIRNLKERGIGVLITDHNVRETLAICEKAYIVSEGAVIAEGTPQEILENETVRQVY 241

Query: 256 LGDRFA 261
           LG+ F 
Sbjct: 242 LGEDFT 247


>gi|90415750|ref|ZP_01223684.1| ABC transporter, ATP-binding protein [marine gamma proteobacterium
           HTCC2207]
 gi|90333073|gb|EAS48243.1| ABC transporter, ATP-binding protein [marine gamma proteobacterium
           HTCC2207]
          Length = 241

 Score =  264 bits (675), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 129/240 (53%), Positives = 173/240 (72%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A +L K Y    VVK V + VK GEIVGLLGPNGAGKTT FYM+ GL+  D G+I 
Sbjct: 2   ATLQASNLAKAYGKRPVVKDVSISVKQGEIVGLLGPNGAGKTTCFYMIIGLVAQDKGAIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           IDG+DIT +PM+ RAR G+ YLPQE S+FR L+VE+NILA+LE   E ++K+R ++ + L
Sbjct: 62  IDGDDITSLPMHGRARRGLGYLPQEPSVFRKLSVEDNILAILETRKELNRKQRVQRAEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+++         LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP++++DI  +IR
Sbjct: 122 MREFHVSHLAKSQGMSLSGGERRRVEIARALAADPQFILLDEPFAGVDPISVTDIKQIIR 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L   GIG+LITDHNV E L + + AYII  G V+A GT  +I++N  VR+ YLG+ F  
Sbjct: 182 HLRDSGIGVLITDHNVRETLDICEHAYIIGEGHVIAEGTTSDILNNTQVRKTYLGENFTL 241


>gi|90413000|ref|ZP_01220998.1| putative ABC transporter, ATP-binding protein [Photobacterium
           profundum 3TCK]
 gi|90326015|gb|EAS42454.1| putative ABC transporter, ATP-binding protein [Photobacterium
           profundum 3TCK]
          Length = 241

 Score =  264 bits (675), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 175/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K YN   VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G I 
Sbjct: 2   AILKAEHLAKSYNGRKVVSDVSLEVESGKIVGLLGPNGAGKTTSFYMIVGLVARDEGKIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           IDG DI+  PM+ R+R+GI YLPQEASIFR L+V +N++AVL+   E  K++R +KL+ L
Sbjct: 62  IDGTDISLQPMHNRSRMGIGYLPQEASIFRRLSVHDNLMAVLQTRKEITKQQRQDKLEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EFNI   R+ L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LDEFNIQHIRNSLGMALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + + AYI+  G ++A+GT  ++++++ V+R+YLGD+F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEHAYIVSQGHLIANGTPSDVLNDEHVKRVYLGDQF 239


>gi|299068032|emb|CBJ39246.1| putative ABC transport protein, atp_binding component [Ralstonia
           solanacearum CMR15]
          Length = 262

 Score =  264 bits (675), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 133/242 (54%), Positives = 175/242 (72%), Gaps = 5/242 (2%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L    L K+Y +  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+G I 
Sbjct: 19  STLVVRHLKKRYGTRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVALDAGDIV 78

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKK-----KRHEK 138
           +DG  I+++P+++RAR+G+SYLPQEAS+FR L V+ENI AVLE+ E+D K     + + +
Sbjct: 79  LDGQHISRLPIHQRARMGLSYLPQEASVFRKLNVQENIRAVLELQEQDGKPLSAAEVNRR 138

Query: 139 LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIH 198
           LD+LL +  I   R   A  LSGG+RRR+EIAR+L S P +ILLDEPFAGVDP+A+ +I 
Sbjct: 139 LDALLDDLQIAHLRDNPALSLSGGERRRVEIARALASSPRFILLDEPFAGVDPIAVGEIQ 198

Query: 199 VLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGD 258
            ++  L  R IG+LITDHNV E L + D AYII  G VLA G  ++I++N+DVR++YLGD
Sbjct: 199 RIVSFLKDRNIGVLITDHNVRETLGICDHAYIISEGTVLAAGMPEQIVENEDVRKVYLGD 258

Query: 259 RF 260
            F
Sbjct: 259 NF 260


>gi|270159887|ref|ZP_06188543.1| ABC transporter ATP binding protein [Legionella longbeachae D-4968]
 gi|289165359|ref|YP_003455497.1| lipopolysaccharide transport protein B: ATP-binding component of
           ABC superfamily [Legionella longbeachae NSW150]
 gi|269988226|gb|EEZ94481.1| ABC transporter ATP binding protein [Legionella longbeachae D-4968]
 gi|288858532|emb|CBJ12413.1| putative lipopolysaccharide transport protein B: ATP-binding
           component of ABC superfamily [Legionella longbeachae
           NSW150]
          Length = 241

 Score =  264 bits (675), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 134/240 (55%), Positives = 171/240 (71%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L A +L K + S  VV GV L++  GE VGLLGPNGAGKTT FYM+ GL   D G I 
Sbjct: 2   SILEAQNLKKSFKSRTVVDGVTLHINKGECVGLLGPNGAGKTTCFYMIVGLQACDEGKIF 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           +   DIT   M++RARLGISYLPQEAS+FR LTV ENI+A+LE+  +  ++ R EKLD L
Sbjct: 62  LSEKDITSSAMHQRARLGISYLPQEASVFRKLTVAENIMAILELRADLSEQARQEKLDLL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I+     L   LSGG+RRR+EIAR+L   PS+ILLDEPFAGVDP+++ DI  +I+
Sbjct: 122 LQEFHISHLDKSLGMSLSGGERRRVEIARALAIEPSFILLDEPFAGVDPISVIDIKKIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L ++GIG+LITDHNV E L + +RAYI+  G +L  GT   I+ NQ VR +YLGD F  
Sbjct: 182 HLCNKGIGVLITDHNVRETLDICERAYIVSQGKILCEGTPDIILANQQVRAVYLGDDFTL 241


>gi|257095834|ref|YP_003169475.1| ABC transporter-like protein [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257048358|gb|ACV37546.1| ABC transporter related [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
          Length = 244

 Score =  264 bits (675), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 134/241 (55%), Positives = 171/241 (70%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           +   S LSA  L K+Y    VV  V   V  GE+VGLLGPNGAGKTT FYM+ GL+  D 
Sbjct: 2   SDTQSTLSAHQLKKRYKKRTVVHDVSFEVVSGEVVGLLGPNGAGKTTCFYMVVGLVACDG 61

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G I +DG  +T +P++RRARLG+SYLPQEAS+FR LTV ENI AVLE+     +    + 
Sbjct: 62  GDIHLDGQPLTHLPIHRRARLGVSYLPQEASVFRKLTVSENIKAVLELQVLPVEDLDART 121

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL+E +I   R+  A  LSGG+RRR+EIAR+L + P ++LLDEPFAGVDP+A+ DI  
Sbjct: 122 EELLEELHIGHLRNNPATSLSGGERRRVEIARALATAPKFLLLDEPFAGVDPIAVLDIQK 181

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           +IR L  RGIG+LITDHNV E L + D AYII+ GGVLA G  +EII N++VR++YLG+ 
Sbjct: 182 IIRFLKERGIGVLITDHNVRETLGICDHAYIINEGGVLASGRPEEIIYNENVRKVYLGEN 241

Query: 260 F 260
           F
Sbjct: 242 F 242


>gi|152981012|ref|YP_001355041.1| ABC-type transport system, ATPase component [Janthinobacterium sp.
           Marseille]
 gi|151281089|gb|ABR89499.1| ABC-type transport system, ATPase component [Janthinobacterium sp.
           Marseille]
          Length = 246

 Score =  264 bits (675), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 178/242 (73%), Gaps = 5/242 (2%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L    L K Y +  VV+ V L V+ GE++GLLGPNGAGKTT FYM+ GL+ +D+G I+
Sbjct: 3   SKLIVNGLQKSYGARQVVRDVALQVESGEVIGLLGPNGAGKTTSFYMIVGLVPSDAGRIE 62

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKK-----KRHEK 138
           +DG DI+++P+++RA+LG+SYLPQEAS+FR L+VE+NI AVLE+   + K     +  ++
Sbjct: 63  LDGVDISRLPIHKRAQLGLSYLPQEASVFRKLSVEDNIRAVLELQRVNGKALNSAQLEQR 122

Query: 139 LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIH 198
           LD+LL +  I K R   A  LSGG+RRR+EIAR+L + P ++LLDEPFAGVDP+A+ +I 
Sbjct: 123 LDTLLADLQIEKLRENQAMSLSGGERRRVEIARALATNPRFVLLDEPFAGVDPIAVIEIQ 182

Query: 199 VLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGD 258
            ++R L  RGIG+LITDHNV E L + DRAYII+ G VLA G   +II N+ VRR+YLG+
Sbjct: 183 RIVRFLKERGIGVLITDHNVRETLGICDRAYIINQGAVLASGRPDDIIANESVRRVYLGE 242

Query: 259 RF 260
            F
Sbjct: 243 HF 244


>gi|148977773|ref|ZP_01814329.1| ABC transporter, ATP-binding protein [Vibrionales bacterium SWAT-3]
 gi|145962987|gb|EDK28257.1| ABC transporter, ATP-binding protein [Vibrionales bacterium SWAT-3]
          Length = 241

 Score =  264 bits (674), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 177/238 (74%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A +L K Y+   VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G+I 
Sbjct: 2   AVLKAQNLAKTYSKRKVVTDVSLQVESGQIVGLLGPNGAGKTTSFYMIVGLVARDEGTIS 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           ID  DI+ +PM+ R+RLGI YLPQEASIFR L+VE NI+AVL+   E   ++R +KL+ L
Sbjct: 62  IDDRDISILPMHSRSRLGIGYLPQEASIFRKLSVENNIMAVLQTRDEMTNEQRQDKLEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   RH     LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LEEFHIQHIRHSNGMALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A GT +++++N+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGHLIAEGTPEDVLNNEQVKQVYLGEQF 239


>gi|83647982|ref|YP_436417.1| ABC transporter ATPase [Hahella chejuensis KCTC 2396]
 gi|83636025|gb|ABC31992.1| ABC-type (unclassified) transport system, ATPase component [Hahella
           chejuensis KCTC 2396]
          Length = 241

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 175/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L+A +L K Y    VVK V + ++ GEIVGLLGPNGAGKTT FYM+ GLI +D GS+ 
Sbjct: 2   STLAARNLAKAYKKRPVVKDVSVEIRSGEIVGLLGPNGAGKTTCFYMVVGLIPSDKGSVF 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID  +IT +PM+ RAR GI YLPQEAS+FR L+VE+NI A+LE   + ++K+R +K++ L
Sbjct: 62  IDDAEITSLPMHGRARKGIGYLPQEASVFRKLSVEDNIYAILETRADLNRKERKQKMEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EF+IT  R  L   LSGG+RRR+EIAR+L + P ++LLDEPFAGVDP++++DI  +I 
Sbjct: 122 LHEFHITHIRKSLGMSLSGGERRRVEIARALATEPKFVLLDEPFAGVDPISVNDIKQIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIG+LITDHNV E L + +RAYI+  G ++A G   +I+ N  VR +YLGD+F
Sbjct: 182 HLKKRGIGVLITDHNVRETLDICERAYIVSEGFIIASGAPSDILANPKVREVYLGDQF 239


>gi|229527539|ref|ZP_04416931.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholerae 12129(1)]
 gi|229335171|gb|EEO00656.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           cholerae 12129(1)]
 gi|327485013|gb|AEA79420.1| Lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Vibrio cholerae LMA3894-4]
          Length = 241

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 176/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K Y    VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G+I 
Sbjct: 2   AILKAQHLAKSYKKRKVVSDVSLQVESGQIVGLLGPNGAGKTTSFYMIVGLVARDEGTIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID NDI+ +PM+ R+R+GI YLPQEASIFR L+VE+NI+AVL+  E+   + R +KL+ L
Sbjct: 62  IDDNDISILPMHSRSRMGIGYLPQEASIFRKLSVEDNIMAVLQTREELTHEGRQDKLEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LEEFHIQHIRKSAGMALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A GT Q++++N+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGRLIAEGTPQDVLNNEQVKQVYLGEQF 239


>gi|303249491|ref|ZP_07335698.1| putative ABC transporter ATP-binding protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307245160|ref|ZP_07527252.1| Lipopolysaccharide export system ATP-binding protein lptB
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|307249554|ref|ZP_07531541.1| Lipopolysaccharide export system ATP-binding protein lptB
           [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|307251883|ref|ZP_07533784.1| Lipopolysaccharide export system ATP-binding protein lptB
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|307254108|ref|ZP_07535954.1| Lipopolysaccharide export system ATP-binding protein lptB
           [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|307256378|ref|ZP_07538161.1| Lipopolysaccharide export system ATP-binding protein lptB
           [Actinobacillus pleuropneumoniae serovar 10 str. D13039]
 gi|307258571|ref|ZP_07540307.1| Lipopolysaccharide export system ATP-binding protein lptB
           [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
 gi|307260806|ref|ZP_07542493.1| Lipopolysaccharide export system ATP-binding protein lptB
           [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
 gi|307262934|ref|ZP_07544556.1| Lipopolysaccharide export system ATP-binding protein lptB
           [Actinobacillus pleuropneumoniae serovar 13 str. N273]
 gi|302651565|gb|EFL81714.1| putative ABC transporter ATP-binding protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306853940|gb|EFM86153.1| Lipopolysaccharide export system ATP-binding protein lptB
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|306858409|gb|EFM90478.1| Lipopolysaccharide export system ATP-binding protein lptB
           [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|306860575|gb|EFM92587.1| Lipopolysaccharide export system ATP-binding protein lptB
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306862932|gb|EFM94880.1| Lipopolysaccharide export system ATP-binding protein lptB
           [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|306865204|gb|EFM97104.1| Lipopolysaccharide export system ATP-binding protein lptB
           [Actinobacillus pleuropneumoniae serovar 10 str. D13039]
 gi|306867365|gb|EFM99217.1| Lipopolysaccharide export system ATP-binding protein lptB
           [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
 gi|306869532|gb|EFN01322.1| Lipopolysaccharide export system ATP-binding protein lptB
           [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
 gi|306871560|gb|EFN03282.1| Lipopolysaccharide export system ATP-binding protein lptB
           [Actinobacillus pleuropneumoniae serovar 13 str. N273]
          Length = 243

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 133/239 (55%), Positives = 176/239 (73%), Gaps = 3/239 (1%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y +  VVK V L VK GEIVGLLGPNGAGKTT FYM+ GL+  D G I+ID
Sbjct: 6   LYAEHLAKSYKNRQVVKDVSLNVKAGEIVGLLGPNGAGKTTTFYMVVGLVRHDQGQIRID 65

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD--KKKRHEKLDSLL 143
             DI+ +PM+ RA+ GI YLPQEASIFR LTV +N++AVL+V  KD   ++R  + D L+
Sbjct: 66  DQDISLLPMHDRAKQGIGYLPQEASIFRRLTVYDNLMAVLQV-RKDLTTQQRKARADELI 124

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            EF+I   R+ L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I +
Sbjct: 125 NEFHIEHIRNSLGQSLSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIVN 184

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  RG+G+LITDHNV E L + +RAYI+ +G ++A GT +E+++N DV+R+YLGD+F  
Sbjct: 185 LKERGLGVLITDHNVRETLDVCERAYIVGSGQMIASGTPEEVLNNADVKRVYLGDQFKL 243


>gi|212633558|ref|YP_002310083.1| ABC transporter [Shewanella piezotolerans WP3]
 gi|212555042|gb|ACJ27496.1| ABC transporter [Shewanella piezotolerans WP3]
          Length = 243

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 173/236 (73%), Gaps = 1/236 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L K Y +  VV+ V L VK G+IVGLLGPNGAGKTT FYM+ GL+ +D G I ID
Sbjct: 6   LMARNLAKSYKNRAVVQDVSLTVKTGQIVGLLGPNGAGKTTTFYMVVGLVQSDKGQIFID 65

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
            +D+T  PM+ RAR GI YLPQEASIFR L+V +NI+AVL+     D ++R  +L+SLL+
Sbjct: 66  EDDLTLDPMHLRARKGIGYLPQEASIFRKLSVRDNIMAVLQTRSDIDNEQREAQLESLLE 125

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+IT  R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I  L
Sbjct: 126 EFHITHIRDSQGMALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIEQL 185

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            SRG+G+LITDHNV E L + + AYI+  G ++A GT  EI+DNQ VR +YLG++F
Sbjct: 186 KSRGLGVLITDHNVRETLDVCEHAYIVSHGNLIAEGTPAEILDNQQVRAVYLGEQF 241


>gi|46143809|ref|ZP_00133924.2| COG1137: ABC-type (unclassified) transport system, ATPase component
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126207820|ref|YP_001053045.1| putative ABC transporter ATP-binding protein [Actinobacillus
           pleuropneumoniae L20]
 gi|165975794|ref|YP_001651387.1| ABC transporter ATP-binding protein [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|190149610|ref|YP_001968135.1| ABC transporter ATP-binding protein [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|126096612|gb|ABN73440.1| putative ABC transporter ATP-binding protein [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|165875895|gb|ABY68943.1| probable ABC transporter ATP-binding protein [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|189914741|gb|ACE60993.1| putative ABC transporter ATP-binding protein [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
          Length = 241

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 133/239 (55%), Positives = 176/239 (73%), Gaps = 3/239 (1%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y +  VVK V L VK GEIVGLLGPNGAGKTT FYM+ GL+  D G I+ID
Sbjct: 4   LYAEHLAKSYKNRQVVKDVSLNVKAGEIVGLLGPNGAGKTTTFYMVVGLVRHDQGQIRID 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD--KKKRHEKLDSLL 143
             DI+ +PM+ RA+ GI YLPQEASIFR LTV +N++AVL+V  KD   ++R  + D L+
Sbjct: 64  DQDISLLPMHDRAKQGIGYLPQEASIFRRLTVYDNLMAVLQV-RKDLTTQQRKARADELI 122

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            EF+I   R+ L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I +
Sbjct: 123 NEFHIEHIRNSLGQSLSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIVN 182

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  RG+G+LITDHNV E L + +RAYI+ +G ++A GT +E+++N DV+R+YLGD+F  
Sbjct: 183 LKERGLGVLITDHNVRETLDVCERAYIVGSGQMIASGTPEEVLNNADVKRVYLGDQFKL 241


>gi|312881875|ref|ZP_07741642.1| ABC transporter, ATP-binding protein [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370454|gb|EFP97939.1| ABC transporter, ATP-binding protein [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 241

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 176/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K Y    VV  V + V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G+I 
Sbjct: 2   AILKAEHLAKTYGDRKVVTDVSIQVESGQIVGLLGPNGAGKTTSFYMIVGLVARDEGAIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           IDG DI+ +PM+ R+R+GI YLPQEASIFR L+VE+NI+AVLE  E+   ++R +K+  L
Sbjct: 62  IDGKDISILPMHSRSRMGIGYLPQEASIFRKLSVEDNIMAVLETREELTIEQRQDKMQDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   RH     LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LEEFHIQHIRHSTGMSLSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A GT  E+++N+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGHLIAQGTPDEVLNNERVKQVYLGEQF 239


>gi|239813484|ref|YP_002942394.1| ABC transporter [Variovorax paradoxus S110]
 gi|239800061|gb|ACS17128.1| ABC transporter related [Variovorax paradoxus S110]
          Length = 264

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 141/261 (54%), Positives = 176/261 (67%), Gaps = 10/261 (3%)

Query: 10  IEMPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFY 69
           IE    Q    +  S L    L K Y S  VV+ V L V+ GE+VGLLGPNGAGKTT FY
Sbjct: 2   IEAAGTQNADGTPGSRLVVRGLQKSYGSRKVVRDVSLDVQKGEVVGLLGPNGAGKTTSFY 61

Query: 70  MMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY- 128
           M+ GL+ AD+G I IDG  I  MP++RRAR+G+SYLPQEASIFR LTVEEN+ AVLE+  
Sbjct: 62  MIVGLVRADAGEITIDGEPIAHMPIHRRARMGLSYLPQEASIFRKLTVEENVRAVLELQR 121

Query: 129 EKD---------KKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSY 179
           E D         K++  E+L  LL +  +   R   A  LSGG+RRR+EIAR+L + P +
Sbjct: 122 EPDAGGKPAPLTKQRIEERLSGLLADLRVDHLRDSPALALSGGERRRVEIARALATQPRF 181

Query: 180 ILLDEPFAGVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAH 239
           ILLDEPFAG+DP+A+ +I  +I  L  RGIG+LITDHNV E L + D A+II  G VLA 
Sbjct: 182 ILLDEPFAGIDPIAVIEIQRIISFLKERGIGVLITDHNVRETLGICDHAFIISDGHVLAQ 241

Query: 240 GTVQEIIDNQDVRRLYLGDRF 260
           GT  EI+DN +VRR+YLG+ F
Sbjct: 242 GTPSEIVDNAEVRRVYLGEHF 262


>gi|109896895|ref|YP_660150.1| ABC transporter related [Pseudoalteromonas atlantica T6c]
 gi|109699176|gb|ABG39096.1| ABC transporter related protein [Pseudoalteromonas atlantica T6c]
          Length = 241

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 130/238 (54%), Positives = 172/238 (72%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y S  VV+ V L V  G+IVGLLGPNGAGKTT FYM+ GL+  D G I 
Sbjct: 2   ATLKASHLAKSYKSRQVVRDVSLEVSTGQIVGLLGPNGAGKTTTFYMIVGLVPLDKGEIS 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           ID  D+T  PM+ RARLGI YLPQEASIFR LTV +N++A+L+   E   ++R ++ DSL
Sbjct: 62  IDQQDLTLQPMHMRARLGIGYLPQEASIFRKLTVYQNLMAILQTRKELSAEQREQQADSL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EFNI   R+     LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP++++DI  +I+
Sbjct: 122 LDEFNINHIRNSAGMSLSGGERRRVEIARALAADPEFILLDEPFAGVDPISVNDIKKIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIG+LITDHNV E L + ++AYI+  G ++A GT +E++ +Q VR +YLG++F
Sbjct: 182 HLRDRGIGVLITDHNVRETLDVCEKAYIVSHGELIASGTAEEVLSDQRVRDVYLGEQF 239


>gi|160896122|ref|YP_001561704.1| ABC transporter-like protein [Delftia acidovorans SPH-1]
 gi|160361706|gb|ABX33319.1| ABC transporter related [Delftia acidovorans SPH-1]
          Length = 262

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 178/246 (72%), Gaps = 8/246 (3%)

Query: 22  KDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGS 81
           + S L A  L K Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+ +D G 
Sbjct: 16  QGSSLQARHLAKSYGSRKVVKDVSLSVKKGEVVGLLGPNGAGKTTSFYMIVGLVRSDGGD 75

Query: 82  IKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR------ 135
           I IDG  +  MP+++R+RLG+SYLPQEASIFR L+VE+N+ AVLE+ ++D++ R      
Sbjct: 76  IFIDGQAVGNMPIHQRSRLGLSYLPQEASIFRKLSVEDNVRAVLEL-QRDEQGRPLARSV 134

Query: 136 -HEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAI 194
             E+L +LL+E  +   R   A  LSGG+RRR+EIAR+L + P +ILLDEPFAG+DP+A+
Sbjct: 135 IEERLTALLQELRVDHLRASPALALSGGERRRVEIARALATQPRFILLDEPFAGIDPIAV 194

Query: 195 SDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRL 254
            +I  +I  L +RGIG+LITDHNV E L + D A+II  G VLA GT +EI+DN +VRR+
Sbjct: 195 IEIQRIIGFLKARGIGVLITDHNVRETLGICDHAFIISDGHVLAQGTPEEIVDNAEVRRV 254

Query: 255 YLGDRF 260
           YLG+ F
Sbjct: 255 YLGEHF 260


>gi|241767259|ref|ZP_04764998.1| ABC transporter related protein [Acidovorax delafieldii 2AN]
 gi|241362078|gb|EER58201.1| ABC transporter related protein [Acidovorax delafieldii 2AN]
          Length = 279

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 175/254 (68%), Gaps = 11/254 (4%)

Query: 13  PEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMT 72
           PE Q       S L    L K Y S  VVK V L V+ GE+VGLLGPNGAGKTT FYM+ 
Sbjct: 29  PETQAG-----SRLEVEHLEKSYGSRKVVKDVSLVVQKGEVVGLLGPNGAGKTTSFYMIV 83

Query: 73  GLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDK 132
           GL+  D G I+IDG+ +  MP++RR+RLG+SYLPQEASIFR LTVEEN+ AVLE+   + 
Sbjct: 84  GLVRCDGGDIRIDGHSVADMPIHRRSRLGLSYLPQEASIFRKLTVEENVRAVLELQRGED 143

Query: 133 KKR------HEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPF 186
            +        E+L +LL+E  +   R   A  LSGG+RRR+EIAR+L + P +ILLDEPF
Sbjct: 144 GRPLPRAVIDERLGALLQELRVDHLRESPALALSGGERRRVEIARALATQPRFILLDEPF 203

Query: 187 AGVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEII 246
           AG+DP+A+ +I  +I  L +RGIG+LITDHNV E L + D A+II  G VLA GT  EI+
Sbjct: 204 AGIDPIAVIEIQRIIGFLKARGIGVLITDHNVRETLGICDHAFIISDGRVLAQGTPSEIV 263

Query: 247 DNQDVRRLYLGDRF 260
           DN +VRR+YLG+ F
Sbjct: 264 DNAEVRRVYLGEHF 277


>gi|114778206|ref|ZP_01453078.1| ATP/GTP-binding site motif A (P-loop):ABC transporter:AAA ATPase
           [Mariprofundus ferrooxydans PV-1]
 gi|114551453|gb|EAU54008.1| ATP/GTP-binding site motif A (P-loop):ABC transporter:AAA ATPase
           [Mariprofundus ferrooxydans PV-1]
          Length = 243

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 132/237 (55%), Positives = 169/237 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LSA  L K Y S  VV  VD+ V  GE +GLLGPNGAGKTT FYM++GLI AD G I +D
Sbjct: 7   LSARGLCKAYRSKQVVSNVDMDVYSGECIGLLGPNGAGKTTSFYMVSGLIRADKGEISLD 66

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             DIT+ PM+ RAR GI YLPQEASIFR L+V +N+LA+ E       +  E+L++LL +
Sbjct: 67  DMDITEQPMHLRARSGIGYLPQEASIFRKLSVRDNLLAIFETLNLPSAQIEEELEALLVD 126

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
             I   +H  A  LSGGQRRR EIAR+LV+ P ++LLDEPFAGVDP+A+ DI  +I +L 
Sbjct: 127 LGIEAVQHQKAYTLSGGQRRRTEIARALVTKPKFLLLDEPFAGVDPIAVEDIQAIIAELR 186

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           S+GIGILITDHNV + L++ DRAY++ AG ++ +GT   II + D RRLYLG+ F+ 
Sbjct: 187 SKGIGILITDHNVRDTLSICDRAYLMSAGEIIVNGTPDNIITHPDARRLYLGESFSM 243


>gi|189425226|ref|YP_001952403.1| ABC transporter [Geobacter lovleyi SZ]
 gi|189421485|gb|ACD95883.1| ABC transporter related [Geobacter lovleyi SZ]
          Length = 247

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 127/245 (51%), Positives = 178/245 (72%), Gaps = 2/245 (0%)

Query: 16  QENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLI 75
           Q+N  S++  L A  L K Y    VV+GV+L +  G+++GLLGPNGAGKTT FYMM GL 
Sbjct: 3   QKNSHSRN--LCAEGLCKTYGRRQVVRGVNLSLDSGQVIGLLGPNGAGKTTTFYMMVGLT 60

Query: 76  CADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR 135
             D G +++DG++IT++PM++RAR GISYLPQEAS+FR L+V +N+LA+LE  E D++ +
Sbjct: 61  RPDGGQVRLDGDEITELPMHQRARRGISYLPQEASVFRKLSVRDNLLAILETTEPDRELQ 120

Query: 136 HEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAIS 195
             +   LL+EF IT         LSGG+RRR+EIAR+L++ P++ILLDEPFAG+DP+A++
Sbjct: 121 QHRAQELLEEFGITHVADTKGYALSGGERRRVEIARALITRPAFILLDEPFAGIDPIAVA 180

Query: 196 DIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLY 255
           DI  LI  L +R IG+LI+DHNV E L + D AYI+ AG VL  GT ++I +++  R +Y
Sbjct: 181 DIQQLIIGLKARNIGVLISDHNVRETLGVCDAAYIVSAGEVLEFGTPEQIAESKKAREIY 240

Query: 256 LGDRF 260
           LG+ F
Sbjct: 241 LGEDF 245


>gi|260891460|ref|ZP_05902723.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Leptotrichia hofstadii F0254]
 gi|260858843|gb|EEX73343.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Leptotrichia hofstadii F0254]
          Length = 254

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 177/246 (71%), Gaps = 1/246 (0%)

Query: 17  ENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLIC 76
           E+ A K S+  A SL K Y +  VVK V L ++ GE+VGLLGPNGAGKTT FYM+TG++ 
Sbjct: 9   EDMARKISI-EADSLKKIYKNREVVKSVSLSMEKGEVVGLLGPNGAGKTTTFYMITGIVR 67

Query: 77  ADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRH 136
            + G +  +G +IT +PMY+RARLG+ YLPQEAS+FR LTVEENI++VLE+    KK+R 
Sbjct: 68  PNHGRVMYNGEEITTLPMYKRARLGLGYLPQEASVFRNLTVEENIVSVLEMRGVKKKERI 127

Query: 137 EKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISD 196
             + +L++EF ++     L   LSGG+RRR+EIAR++ + P +ILLDEPFAGVDP+A+ D
Sbjct: 128 ATMQNLIEEFKLSHVAKSLGYALSGGERRRVEIARTISTNPDFILLDEPFAGVDPIAVED 187

Query: 197 IHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYL 256
           I  +I  L  RG+GILITDHNV E L + +RAYI+  G +L  GT Q+I +++  RR+YL
Sbjct: 188 IQNIIMQLKERGLGILITDHNVRETLRITERAYIMAEGTILIAGTGQQIANDETARRVYL 247

Query: 257 GDRFAF 262
           GD F  
Sbjct: 248 GDNFKL 253


>gi|269104090|ref|ZP_06156787.1| lipopolysaccharide ABC transporter ATP-binding protein LptB
           [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268163988|gb|EEZ42484.1| lipopolysaccharide ABC transporter ATP-binding protein LptB
           [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 241

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 176/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K YN   VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G+I 
Sbjct: 2   AILKAEHLAKSYNGRKVVSDVSLQVESGKIVGLLGPNGAGKTTSFYMIVGLVARDEGAIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           ID  DI+  PM+ R+R+GI YLPQEASIFR L+V +N++AVL+   E  K++R +KL+ L
Sbjct: 62  IDDTDISLQPMHNRSRMGIGYLPQEASIFRRLSVHDNLMAVLQTRKELTKQERQDKLEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EFNI   R+ +   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LDEFNIQHIRNSMGMALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + + AYI+  G ++A+GT +++++++ V+R+YLGD+F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEHAYIVSQGQLIANGTPEQVLNDEHVKRVYLGDQF 239


>gi|167568729|ref|ZP_02361603.1| ABC transporter, ATP-binding protein [Burkholderia oklahomensis
           C6786]
          Length = 258

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 175/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y +  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 10  AGTSSSLVVRNLKKRYGTRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I ++G+ I+ MP+++RA LG+SYLPQEAS+FR LTVEENI AVLE+   D  KR  K 
Sbjct: 70  GDISLNGSPISLMPIHKRASLGLSYLPQEASVFRKLTVEENIRAVLELQHDDNGKRLSKD 129

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL+E  I   R   A  LSGG+RRR+EIAR+L S PS+ILLDEPFAGVDP+A
Sbjct: 130 EIGARAEALLEELQIAHLRENPALSLSGGERRRVEIARALASNPSFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G  ++II+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLASGAPKDIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|90022820|ref|YP_528647.1| PAS/PAC sensor signal transduction histidine kinase [Saccharophagus
           degradans 2-40]
 gi|89952420|gb|ABD82435.1| PAS/PAC sensor signal transduction histidine kinase [Saccharophagus
           degradans 2-40]
          Length = 241

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 174/238 (73%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y    VV  V + V+ G++VGLLGPNGAGKTT FYM+ G++ AD GS+ I+
Sbjct: 4   LEALHLAKSYKGRKVVIDVSMSVEDGQVVGLLGPNGAGKTTCFYMIAGIVQADKGSVHIN 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
           G D++++PM+ RAR G+ YLPQEAS+FR LTV ENILA+LE     ++K+R E+L+ LL 
Sbjct: 64  GKDVSRLPMHGRARAGLGYLPQEASVFRKLTVSENILAILETRSDLNRKQRLEQLERLLG 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+I   ++ L   LSGG+RRR+EIAR+L + P++ILLDEPFAGVDP+++SDI  +IR L
Sbjct: 124 EFHINHIKNSLGMALSGGERRRVEIARALATDPAFILLDEPFAGVDPISVSDIKDIIRHL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            +RGIG+LITDHNV E L + ++AYI+  G ++A G    +++N+ VR +YLG  F  
Sbjct: 184 KARGIGVLITDHNVRETLDICEKAYIVSEGHIIAEGDAATVLNNKKVREVYLGQHFTL 241


>gi|77166244|ref|YP_344769.1| ABC transporter, ATPase subunit [Nitrosococcus oceani ATCC 19707]
 gi|254435189|ref|ZP_05048696.1| ABC transporter, ATP-binding protein, putative [Nitrosococcus
           oceani AFC27]
 gi|76884558|gb|ABA59239.1| ABC transporter, ATPase subunit [Nitrosococcus oceani ATCC 19707]
 gi|207088300|gb|EDZ65572.1| ABC transporter, ATP-binding protein, putative [Nitrosococcus
           oceani AFC27]
          Length = 241

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 169/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S LSA  L K Y S +VVK V L +   +IVG+LGPNGAGKTT FYM+ GLI AD G I 
Sbjct: 2   SRLSAYHLAKCYQSRWVVKDVSLEISSSQIVGILGPNGAGKTTCFYMLVGLISADRGLIS 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           +D  DIT  P++RRARLGISYLPQEAS+FR LTV ENI+A++E      K  R   +  L
Sbjct: 62  LDHRDITHYPIHRRARLGISYLPQEASVFRKLTVAENIMAIVETRRNLTKPDRKCLVSQL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+E NIT  ++ L   LSGG+RRR+EIAR+L   P +ILLDEPFAGVDP+++ DI  +IR
Sbjct: 122 LRELNITHIKNTLGMSLSGGERRRVEIARALAVEPQFILLDEPFAGVDPISVLDIQGIIR 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            LA RGIG+LITDHNV E L +   AYI++ G V+A G  QEI+DN+ V+ +YLG  F
Sbjct: 182 HLAERGIGVLITDHNVRETLGICQYAYIVNEGEVIAKGKPQEILDNEQVKEVYLGYNF 239


>gi|114332262|ref|YP_748484.1| ABC transporter-related protein [Nitrosomonas eutropha C91]
 gi|114309276|gb|ABI60519.1| ABC transporter-related protein [Nitrosomonas eutropha C91]
          Length = 240

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 138/239 (57%), Positives = 177/239 (74%), Gaps = 4/239 (1%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A +L KKY S  VV  V   V+ GE+VGLLGPNGAGKTT FYM+ GL+  + G I 
Sbjct: 2   SELRAENLKKKYQSRTVVMDVSFSVRSGEVVGLLGPNGAGKTTCFYMVVGLVPLNGGEIF 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV--YEKDKKKRHEKLDS 141
           +D ++++++P+++RARLG+SYLPQEAS+FR L+VEENILAVLE+  ++KD+ +RH  LD 
Sbjct: 62  LDEHNLSQLPIHQRARLGLSYLPQEASVFRRLSVEENILAVLELQHFQKDEMQRH--LDG 119

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           LL + +I   R  L   LSGG+RRR+EIAR+L S P +ILLDEPFAGVDP+A+ DI  +I
Sbjct: 120 LLHDLHIGHLRESLGMSLSGGERRRVEIARALASQPRFILLDEPFAGVDPIAVMDIQRVI 179

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             L SRGIG+LITDHNV E L + DRAYII  G VLA G   EII++  VR +YLG+ F
Sbjct: 180 GFLKSRGIGVLITDHNVRETLGICDRAYIISEGTVLASGVPAEIINDGRVREVYLGEHF 238


>gi|311695332|gb|ADP98205.1| protein containing ABC transporter-like domain [marine bacterium
           HP15]
          Length = 241

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 170/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A +L K Y    VV  V L ++ GEIVGLLGPNGAGKTT FYM+ GL+ AD G I 
Sbjct: 2   AVLRASNLAKSYKQKKVVIDVSLEIRSGEIVGLLGPNGAGKTTCFYMIVGLVPADHGRIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DIT +PM+ RAR GI YLPQEAS+FR L+V +NI+A+LE  +   K  R +KL+ L
Sbjct: 62  IDSRDITPLPMHGRARQGIGYLPQEASVFRKLSVRDNIMAILETRQGLSKADRQKKLEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+IT  R  +   LSGG+RRR+EIAR+L   P++ILLDEPFAGVDP+++SDI  +IR
Sbjct: 122 LEEFHITHIRDSVGMALSGGERRRVEIARALAMEPAFILLDEPFAGVDPISVSDIKHIIR 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  +GIG+LITDHNV E L + + AYI+  G ++A G    I+ NQ V+ +YLGD F
Sbjct: 182 HLRDKGIGVLITDHNVRETLDICENAYIVSGGHIIASGNADAILANQQVKEVYLGDEF 239


>gi|307247330|ref|ZP_07529378.1| Lipopolysaccharide export system ATP-binding protein lptB
           [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
 gi|306856174|gb|EFM88329.1| Lipopolysaccharide export system ATP-binding protein lptB
           [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
          Length = 243

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 176/239 (73%), Gaps = 3/239 (1%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y +  VVK V L VK GEIVGLLGPNGAGKTT FYM+ GL+  D G I+ID
Sbjct: 6   LYAEHLAKSYKNRQVVKDVSLNVKAGEIVGLLGPNGAGKTTTFYMVVGLVRHDQGQIRID 65

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD--KKKRHEKLDSLL 143
             DI+ +PM+ RA+ GI YLPQEAS+FR LTV +N++AVL+V  KD   ++R  + D L+
Sbjct: 66  DQDISLLPMHDRAKQGIGYLPQEASVFRRLTVYDNLMAVLQV-RKDLTTQQRKARADELI 124

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            EF+I   R+ L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I +
Sbjct: 125 NEFHIEHIRNSLGQSLSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIVN 184

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  RG+G+LITDHNV E L + +RAYI+ +G ++A GT +E+++N DV+R+YLGD+F  
Sbjct: 185 LKERGLGVLITDHNVRETLDVCERAYIVGSGQMIASGTPEEVLNNADVKRVYLGDQFKL 243


>gi|303252578|ref|ZP_07338741.1| putative ABC transporter ATP-binding protein [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302648546|gb|EFL78739.1| putative ABC transporter ATP-binding protein [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
          Length = 241

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 176/239 (73%), Gaps = 3/239 (1%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y +  VVK V L VK GEIVGLLGPNGAGKTT FYM+ GL+  D G I+ID
Sbjct: 4   LYAEHLAKSYKNRQVVKDVSLNVKAGEIVGLLGPNGAGKTTTFYMVVGLVRHDQGQIRID 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD--KKKRHEKLDSLL 143
             DI+ +PM+ RA+ GI YLPQEAS+FR LTV +N++AVL+V  KD   ++R  + D L+
Sbjct: 64  DQDISLLPMHDRAKQGIGYLPQEASVFRRLTVYDNLMAVLQV-RKDLTTQQRKARADELI 122

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            EF+I   R+ L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I +
Sbjct: 123 NEFHIEHIRNSLGQSLSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIVN 182

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  RG+G+LITDHNV E L + +RAYI+ +G ++A GT +E+++N DV+R+YLGD+F  
Sbjct: 183 LKERGLGVLITDHNVRETLDVCERAYIVGSGQMIASGTPEEVLNNADVKRVYLGDQFKL 241


>gi|332994379|gb|AEF04434.1| ABC transporter ATPase [Alteromonas sp. SN2]
          Length = 241

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 173/238 (72%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + LSA SL K Y +  VV+ V L V  G+IVGLLGPNGAGKTT FYM+ GL+  D G I 
Sbjct: 2   ATLSAQSLAKAYKARQVVRDVSLSVSTGQIVGLLGPNGAGKTTTFYMIVGLVPLDKGKIS 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID +++T  PM+ RAR GI YLPQEASIFR LTV ENI+A+L+  +     ++ ++ D+L
Sbjct: 62  IDDSELTHEPMHERARRGIGYLPQEASIFRKLTVFENIMAILQTRKGLSSSEQEQEADAL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EFNI   R+     LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP++++DI  +I+
Sbjct: 122 LDEFNINHIRNSTGMSLSGGERRRVEIARALAADPQFILLDEPFAGVDPISVNDIKKIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIGILITDHNV E L + ++AYI+  G ++A GT ++++ NQ VR +YLG++F
Sbjct: 182 HLRDRGIGILITDHNVRETLDVCEKAYIVSQGELIAQGTAEQVLSNQKVRDVYLGEQF 239


>gi|91781725|ref|YP_556931.1| ABC transporter, ATPase subunit [Burkholderia xenovorans LB400]
 gi|91685679|gb|ABE28879.1| ABC transporter, ATPase subunit [Burkholderia xenovorans LB400]
          Length = 261

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 173/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 13  AGTSSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 72

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I +DG  I+ +P+++RA LG+SYLPQEAS+FR L+VEENI AVLE+  +D  KR  K 
Sbjct: 73  GEIDLDGKSISLLPIHKRASLGLSYLPQEASVFRKLSVEENIRAVLELQHEDNGKRLSKD 132

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL E  I   R   A  LSGG+RRR+EIAR+L + PS+ILLDEPFAGVDP+A
Sbjct: 133 TITSRTEALLDELQIAHLRANPALSLSGGERRRVEIARALATNPSFILLDEPFAGVDPIA 192

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   EII+N+ VRR
Sbjct: 193 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPAEIIENESVRR 252

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 253 VYLGEHF 259


>gi|315497167|ref|YP_004085971.1| abc transporter related protein [Asticcacaulis excentricus CB 48]
 gi|315415179|gb|ADU11820.1| ABC transporter related protein [Asticcacaulis excentricus CB 48]
          Length = 263

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 169/228 (74%)

Query: 33  KKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKM 92
           K Y    VVK V L ++ GE VGLLGPNGAGKTT FYM+TGL+  D G+I +DG+DIT  
Sbjct: 34  KSYKERAVVKTVSLSLRRGEAVGLLGPNGAGKTTCFYMITGLVQPDYGTISLDGHDITSQ 93

Query: 93  PMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITKWR 152
           PMY+RAR+G+ YLPQE+SIFRGL+VE+N+ +VLE+   ++ +   ++  LL+E +I   R
Sbjct: 94  PMYQRARMGLGYLPQESSIFRGLSVEQNLESVLELRLTNRSQIDAEVTRLLEELHIAHIR 153

Query: 153 HVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIGIL 212
              A  LSGG+RRR+EIAR+L   PS+ILLDEPFAG+DP+AISDI  ++  L  RGIGIL
Sbjct: 154 KSPATALSGGERRRVEIARALAGNPSFILLDEPFAGIDPLAISDIRDVVGYLKHRGIGIL 213

Query: 213 ITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           ITDHNV E L +IDRA IIH+G VL  GT  EI  N +VRR+YLG+ F
Sbjct: 214 ITDHNVRETLDIIDRASIIHSGEVLFEGTPDEIRHNPEVRRVYLGENF 261


>gi|254454246|ref|ZP_05067683.1| ABC transporter, ATP-binding protein [Octadecabacter antarcticus
           238]
 gi|198268652|gb|EDY92922.1| ABC transporter, ATP-binding protein [Octadecabacter antarcticus
           238]
          Length = 254

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 175/238 (73%)

Query: 23  DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSI 82
           D  L   +L K Y    V++ V L +  GE+V LLGPNG+GKTT FY + GL+  ++G++
Sbjct: 14  DVGLKVVNLRKSYRKRMVIRDVSLELGRGEVVALLGPNGSGKTTCFYAIAGLVTPEAGNV 73

Query: 83  KIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSL 142
            +DG DIT +PMYRRA+LGI YLPQE SIFRGL+VE+NILA+LE+ E D+ +R E+L+ L
Sbjct: 74  IVDGRDITALPMYRRAKLGIGYLPQEMSIFRGLSVEDNILAILEIAEPDRTRRRERLEEL 133

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L +F+I   R   A  LSGG+RRR EIAR L + P Y+LLDEPFAGVDP+A+ +I  L  
Sbjct: 134 LSDFSIEHLRRAPAMALSGGERRRAEIARCLAADPKYVLLDEPFAGVDPIAVGEIRHLTA 193

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           DL +RGIG+LITDHNV E L ++DRAYI+H G +L  GT  E++ +++VRR+YLG+ F
Sbjct: 194 DLKNRGIGVLITDHNVQETLQIVDRAYILHDGKILMSGTTDEVVRDENVRRVYLGNSF 251


>gi|53718173|ref|YP_107159.1| ABC transporter ATP-binding protein [Burkholderia pseudomallei
           K96243]
 gi|53726126|ref|YP_104592.1| ABC transporter ATP-binding protein [Burkholderia mallei ATCC
           23344]
 gi|67643426|ref|ZP_00442172.1| ABC transporter, ATP-binding protein [Burkholderia mallei GB8 horse
           4]
 gi|76810319|ref|YP_332179.1| ABC transporter ATP-binding protein [Burkholderia pseudomallei
           1710b]
 gi|121598282|ref|YP_991427.1| ABC transporter, ATP-binding protein [Burkholderia mallei SAVP1]
 gi|124383393|ref|YP_001027497.1| ABC transporter, ATP-binding protein [Burkholderia mallei NCTC
           10229]
 gi|126442100|ref|YP_001057634.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           668]
 gi|126449464|ref|YP_001082463.1| ABC transporter, ATP-binding protein [Burkholderia mallei NCTC
           10247]
 gi|126453601|ref|YP_001064880.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           1106a]
 gi|134279441|ref|ZP_01766153.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           305]
 gi|167001033|ref|ZP_02266834.1| ABC transporter, ATP-binding protein [Burkholderia mallei PRL-20]
 gi|167718031|ref|ZP_02401267.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           DM98]
 gi|167737046|ref|ZP_02409820.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei 14]
 gi|167814155|ref|ZP_02445835.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei 91]
 gi|167822678|ref|ZP_02454149.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei 9]
 gi|167844252|ref|ZP_02469760.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           B7210]
 gi|167892761|ref|ZP_02480163.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           7894]
 gi|167901257|ref|ZP_02488462.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           NCTC 13177]
 gi|167909474|ref|ZP_02496565.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           112]
 gi|167917503|ref|ZP_02504594.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           BCC215]
 gi|217419750|ref|ZP_03451256.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           576]
 gi|226199487|ref|ZP_03795044.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|237810784|ref|YP_002895235.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           MSHR346]
 gi|242317009|ref|ZP_04816025.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           1106b]
 gi|254174967|ref|ZP_04881628.1| ABC transporter, ATP-binding protein [Burkholderia mallei ATCC
           10399]
 gi|254181854|ref|ZP_04888451.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           1655]
 gi|254187787|ref|ZP_04894299.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254196434|ref|ZP_04902858.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           S13]
 gi|254201681|ref|ZP_04908045.1| ABC transporter, ATP-binding protein [Burkholderia mallei FMH]
 gi|254207013|ref|ZP_04913364.1| ABC transporter, ATP-binding protein [Burkholderia mallei JHU]
 gi|254261330|ref|ZP_04952384.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           1710a]
 gi|254296095|ref|ZP_04963552.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           406e]
 gi|254357492|ref|ZP_04973766.1| ABC transporter, ATP-binding protein [Burkholderia mallei
           2002721280]
 gi|52208587|emb|CAH34523.1| ABC transporter system, ATP-binding protein [Burkholderia
           pseudomallei K96243]
 gi|52429549|gb|AAU50142.1| ABC transporter, ATP-binding protein [Burkholderia mallei ATCC
           23344]
 gi|76579772|gb|ABA49247.1| ABC transporter system, ATP-binding protein [Burkholderia
           pseudomallei 1710b]
 gi|121227092|gb|ABM49610.1| ABC transporter, ATP-binding protein [Burkholderia mallei SAVP1]
 gi|124291413|gb|ABN00682.1| ABC transporter, ATP-binding protein [Burkholderia mallei NCTC
           10229]
 gi|126221593|gb|ABN85099.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           668]
 gi|126227243|gb|ABN90783.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           1106a]
 gi|126242334|gb|ABO05427.1| ABC transporter, ATP-binding protein [Burkholderia mallei NCTC
           10247]
 gi|134248641|gb|EBA48723.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           305]
 gi|147747575|gb|EDK54651.1| ABC transporter, ATP-binding protein [Burkholderia mallei FMH]
 gi|147752555|gb|EDK59621.1| ABC transporter, ATP-binding protein [Burkholderia mallei JHU]
 gi|148026556|gb|EDK84641.1| ABC transporter, ATP-binding protein [Burkholderia mallei
           2002721280]
 gi|157805649|gb|EDO82819.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           406e]
 gi|157935467|gb|EDO91137.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160696012|gb|EDP85982.1| ABC transporter, ATP-binding protein [Burkholderia mallei ATCC
           10399]
 gi|169653177|gb|EDS85870.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           S13]
 gi|184212392|gb|EDU09435.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           1655]
 gi|217397054|gb|EEC37070.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           576]
 gi|225928368|gb|EEH24398.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|237506300|gb|ACQ98618.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           MSHR346]
 gi|238524778|gb|EEP88209.1| ABC transporter, ATP-binding protein [Burkholderia mallei GB8 horse
           4]
 gi|242140248|gb|EES26650.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           1106b]
 gi|243063104|gb|EES45290.1| ABC transporter, ATP-binding protein [Burkholderia mallei PRL-20]
 gi|254220019|gb|EET09403.1| ABC transporter, ATP-binding protein [Burkholderia pseudomallei
           1710a]
          Length = 258

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 175/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 10  AGTTSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I ++G+ I+ MP+++RA LG+SYLPQEAS+FR LTVE+N+ AVLE+   +  KR  K 
Sbjct: 70  GDISLNGSPISLMPIHKRASLGLSYLPQEASVFRKLTVEQNVRAVLELQHDENGKRLSKD 129

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL+E  I   R   A  LSGG+RRR+EIAR+L S PS+ILLDEPFAGVDP+A
Sbjct: 130 AIGARTEALLEELQIAHLRENPALSLSGGERRRVEIARALASNPSFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G  +EII+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLASGAPKEIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|238028656|ref|YP_002912887.1| ABC transporter ATP-binding protein [Burkholderia glumae BGR1]
 gi|237877850|gb|ACR30183.1| ABC transporter system, ATP-binding protein [Burkholderia glumae
           BGR1]
          Length = 258

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 175/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 10  AGTTSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I ++G+ I+++P+++RA LG+SYLPQEAS+FR LTVEENI AVLE+   D  +R  K 
Sbjct: 70  GDISLNGSPISRLPIHKRASLGLSYLPQEASVFRKLTVEENIRAVLELQYDDDGRRLSKD 129

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL E  I   R   A  LSGG+RRR+EIAR+L S PS+ILLDEPFAGVDP+A
Sbjct: 130 ATATRAEALLDELQIAHLRDNPALSLSGGERRRVEIARALASNPSFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G  Q+II+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLASGAPQDIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|71282626|ref|YP_271190.1| ABC transporter ATP-binding protein [Colwellia psychrerythraea 34H]
 gi|71148366|gb|AAZ28839.1| ABC transporter, ATP-binding protein [Colwellia psychrerythraea
           34H]
          Length = 246

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 171/238 (71%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L+K Y S  VVK V L V  G+IVGLLGPNGAGKTT FYM+ GL+  D+GSIK++
Sbjct: 9   LIADGLSKSYKSRQVVKNVSLQVDAGQIVGLLGPNGAGKTTSFYMIVGLVPNDNGSIKLN 68

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSLLK 144
           G D+T  PM+ RAR GI YLPQEASIFR LTV +NI+A+L+   E  + +R EKL++LL+
Sbjct: 69  GQDLTLAPMHERARSGIGYLPQEASIFRKLTVSDNIMAILQTRKELSETQRAEKLENLLE 128

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+I   +      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I  L
Sbjct: 129 EFHICHIKDNTGMSLSGGERRRVEIARALAADPQFILLDEPFAGVDPISVGDIKKIILHL 188

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             RGIGILITDHNV E L + + AYI+  G ++A G   +I+ NQ VR +YLG++F  
Sbjct: 189 KQRGIGILITDHNVRETLDVCEHAYIVSHGEIIAQGNADQILANQKVRDVYLGEQFTL 246


>gi|332297523|ref|YP_004439445.1| Sulfate-transporting ATPase [Treponema brennaborense DSM 12168]
 gi|332180626|gb|AEE16314.1| Sulfate-transporting ATPase [Treponema brennaborense DSM 12168]
          Length = 252

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 133/250 (53%), Positives = 176/250 (70%), Gaps = 1/250 (0%)

Query: 12  MPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMM 71
           M +  +   S + +L   SL K +    VV+GVD  ++ GEI+GLLGPNGAGKTT FYM+
Sbjct: 1   MSDHTDTVRSAEHVLKINSLYKSFGKKQVVRGVDFSMQTGEILGLLGPNGAGKTTSFYMI 60

Query: 72  TGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EK 130
            G     SG + +DGN IT++PMYRRARLGISYLPQEAS+FR LTVE+NI ++LE   + 
Sbjct: 61  VGFYKPTSGEVFLDGNCITRLPMYRRARLGISYLPQEASVFRKLTVEQNIWSILETRGDL 120

Query: 131 DKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVD 190
              +R  KL+ L+ EF+I + R   A  LSGG+RRR EIARSL   P ++LLDEPFAG+D
Sbjct: 121 SGAERRHKLEQLIDEFDIGRIRKQPAYTLSGGERRRTEIARSLAIEPKFLLLDEPFAGID 180

Query: 191 PVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQD 250
           P+A+SDI  +IR LA RGIG+LITDHNV + L + DRA II +G ++A G   EI+++  
Sbjct: 181 PIAVSDIKSMIRLLAGRGIGVLITDHNVRDTLEITDRAIIISSGQIVAQGGKDEILESPI 240

Query: 251 VRRLYLGDRF 260
            R++YLG+ F
Sbjct: 241 ARKIYLGEEF 250


>gi|256027952|ref|ZP_05441786.1| ABC transporter ATP-binding protein [Fusobacterium sp. D11]
 gi|260494136|ref|ZP_05814267.1| urea ABC transporter, ATP-binding protein UrtD [Fusobacterium sp.
           3_1_33]
 gi|289765897|ref|ZP_06525275.1| ABC transporter ATP-binding protein [Fusobacterium sp. D11]
 gi|260198282|gb|EEW95798.1| urea ABC transporter, ATP-binding protein UrtD [Fusobacterium sp.
           3_1_33]
 gi|289717452|gb|EFD81464.1| ABC transporter ATP-binding protein [Fusobacterium sp. D11]
          Length = 241

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 170/235 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LSA SL K Y    VV  V L V  GEIVGLLGPNGAGKTT FYM+TG++  DSG +   
Sbjct: 4   LSADSLVKTYKKRKVVDKVSLEVNKGEIVGLLGPNGAGKTTTFYMITGIVKPDSGEVMCA 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             DIT +PMY+RA +GI YL QE S+FR LTVEENI  VLE+ +  KKK+ E +D LL+E
Sbjct: 64  EQDITNLPMYKRADMGIGYLAQEPSVFRNLTVEENIEVVLEMKKISKKKQKETVDRLLEE 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T  R  L   LSGG+RRR+EIAR++ + PS+ILLDEPFAGVDP+A+ DI  +IR L 
Sbjct: 124 FKLTHVRDSLGYSLSGGERRRIEIARTIANNPSFILLDEPFAGVDPIAVEDIQNIIRHLK 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            R +GILITDHNV E L++ D++YI+  G VL  GT +EI +N + RR+YLG++F
Sbjct: 184 KRDLGILITDHNVRETLSITDKSYIMAKGKVLLEGTPREIANNPEARRIYLGEKF 238


>gi|257126599|ref|YP_003164713.1| ABC transporter [Leptotrichia buccalis C-1013-b]
 gi|257050538|gb|ACV39722.1| ABC transporter related [Leptotrichia buccalis C-1013-b]
          Length = 244

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 127/237 (53%), Positives = 171/237 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           + A SL K Y    VVK V L ++ GE+VGLLGPNGAGKTT FYM+TG++  + G +  +
Sbjct: 7   IEADSLKKIYKKREVVKSVSLSMEKGEVVGLLGPNGAGKTTTFYMITGIVRPNYGRVMYN 66

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G +IT +PMY+RARLG+ YLPQEAS+FR LTVEENI++VLE+    KK+R   + +L++E
Sbjct: 67  GEEITNLPMYKRARLGLGYLPQEASVFRNLTVEENIVSVLEMRGVKKKERIATMQNLIEE 126

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F ++     L   LSGG+RRR+EIAR++ + P +ILLDEPFAGVDP+A+ DI  +I  L 
Sbjct: 127 FKLSHVAKSLGYALSGGERRRVEIARTISTNPDFILLDEPFAGVDPIAVEDIQNIIMQLK 186

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RG+GILITDHNV E L + +RAYI+  G +L  GT Q+I +++  RR+YLGD F  
Sbjct: 187 ERGLGILITDHNVRETLRITERAYIMAEGTILIAGTGQQIANDETARRVYLGDNFKL 243


>gi|187479588|ref|YP_787613.1| ABC transporter ATP-binding protein [Bordetella avium 197N]
 gi|115424175|emb|CAJ50728.1| ABC transporter, ATP-binding protein [Bordetella avium 197N]
          Length = 259

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 136/241 (56%), Positives = 172/241 (71%), Gaps = 6/241 (2%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K YN   VV+ V L V+ GE+VGLLGPNGAGKTT FYM+ GL+ AD+G I+ID
Sbjct: 17  LRATGLRKTYNGRTVVQDVSLSVESGEVVGLLGPNGAGKTTSFYMIVGLVPADAGRIEID 76

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR------HEKL 139
           G +IT MP+++RAR+G+SYLPQ+AS+FR LTVE+NI AVLE+    + K        E L
Sbjct: 77  GKEITAMPIHKRARMGLSYLPQDASVFRRLTVEQNIRAVLELQLDAQGKALSAAKIAENL 136

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           +SLL E  I   R   A  LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+A+ +I  
Sbjct: 137 ESLLDELQIGHIRSNTAISLSGGERRRVEIARALATNPRFILLDEPFAGVDPIAVIEIQR 196

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           ++R L  RGIG+LITDHNV E L + DRAYII  G VL +G   EI+ +  VRR+YLG+ 
Sbjct: 197 IVRFLKGRGIGVLITDHNVRETLGICDRAYIISEGKVLTNGHPDEIVGDPAVRRVYLGEH 256

Query: 260 F 260
           F
Sbjct: 257 F 257


>gi|290968956|ref|ZP_06560491.1| ABC transporter, ATP-binding protein [Megasphaera genomosp. type_1
           str. 28L]
 gi|290780912|gb|EFD93505.1| ABC transporter, ATP-binding protein [Megasphaera genomosp. type_1
           str. 28L]
          Length = 239

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 130/233 (55%), Positives = 167/233 (71%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           +L K Y S  VV GV L V  GEIVGLLGPNGAGKTT FYM+ G+     G I++   +I
Sbjct: 7   NLVKTYKSRNVVNGVSLRVAQGEIVGLLGPNGAGKTTTFYMIVGIEHPTRGCIRVQEQEI 66

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           T +P++RRA  GI YLPQEASIFR LTVEEN+LA+LE      +++ EK  +LL+EF+IT
Sbjct: 67  THLPIHRRAAYGIGYLPQEASIFRKLTVEENLLAMLETTSLSPREQKEKAMALLEEFSIT 126

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
           K RH L   LSGG+RRR+EIAR LV+ PS+ILLDEPFAG+DP+A++DI  +I  L  RGI
Sbjct: 127 KLRHRLGIQLSGGERRRVEIARCLVTDPSFILLDEPFAGIDPLAVNDIQSIINHLKKRGI 186

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           G+LITDHNV E L ++DRAYI+  G +L  GT ++I  +   ++ YLG+ F  
Sbjct: 187 GVLITDHNVRETLRIVDRAYILSEGRILLEGTPEQIATDPVAKKFYLGEEFCM 239


>gi|319779020|ref|YP_004129933.1| Lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Taylorella equigenitalis MCE9]
 gi|317109044|gb|ADU91790.1| Lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Taylorella equigenitalis MCE9]
          Length = 252

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 137/246 (55%), Positives = 173/246 (70%), Gaps = 6/246 (2%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
           + D  L A  L K Y    VVK V L V  GEIVGLLGPNGAGKTT FY++ GL+ AD G
Sbjct: 5   NSDGTLKAIGLRKDYGKRSVVKNVSLEVNSGEIVGLLGPNGAGKTTSFYIIVGLVPADYG 64

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKK------K 134
           +I+ID  DIT +P+++RA++G+SYLPQEASIFR LTVE+NILAVLE+ +   K       
Sbjct: 65  AIQIDDRDITTLPIHKRAKIGLSYLPQEASIFRKLTVEQNILAVLEIQQYFNKAIGRKLN 124

Query: 135 RHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAI 194
             E+L++LL E  I   R   A  LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+A+
Sbjct: 125 LKEELNNLLDELQIQHIRTSPAISLSGGERRRVEIARALATKPRFILLDEPFAGVDPIAV 184

Query: 195 SDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRL 254
            +I  ++  L  R IG+LITDHNV E L + DRAYII  G VL  GT +EII + DVR++
Sbjct: 185 IEIQRIVNFLKERNIGVLITDHNVRETLGICDRAYIISDGTVLTSGTPEEIIQDPDVRKV 244

Query: 255 YLGDRF 260
           YLG+ F
Sbjct: 245 YLGENF 250


>gi|89075265|ref|ZP_01161692.1| putative ABC transporter, ATP-binding protein [Photobacterium sp.
           SKA34]
 gi|89048946|gb|EAR54514.1| putative ABC transporter, ATP-binding protein [Photobacterium sp.
           SKA34]
          Length = 241

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 175/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K YN   VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G I 
Sbjct: 2   AILKAEHLAKSYNGRKVVSDVSLEVESGKIVGLLGPNGAGKTTSFYMIVGLVARDEGVIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           IDGNDI+  PM+ R+R+GI YLPQEASIFR L+V +N++AVL+   E  K++R +K + L
Sbjct: 62  IDGNDISLQPMHNRSRMGIGYLPQEASIFRRLSVYDNLMAVLQTRKELTKEERQDKAEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EFNI   R+ L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LDEFNIQHIRNNLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + + AYI+  G ++A+GT + +++++ V+R+YLGD+F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEHAYIVSQGQLIANGTPEHVLNDEHVKRVYLGDQF 239


>gi|149372423|ref|ZP_01891611.1| ABC transporter, ATP-binding protein [unidentified eubacterium
           SCB49]
 gi|149354813|gb|EDM43376.1| ABC transporter, ATP-binding protein [unidentified eubacterium
           SCB49]
          Length = 248

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 171/235 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L K Y    VVKG+ + V  GEIVGLLGPNGAGKTT FYM+ GLI  + G+I +D
Sbjct: 3   LKAENLMKSYKGRKVVKGITVEVNQGEIVGLLGPNGAGKTTSFYMIVGLIKPNGGTIHLD 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G +ITK PMY+RA+ GI YL QEAS+FR L+VE+NIL+VL++ +  KK++  K++SL++E
Sbjct: 63  GTEITKYPMYKRAQNGIGYLAQEASVFRKLSVEDNILSVLQMTKLSKKEQKAKMESLIEE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +   R     LLSGG+RRR EIAR+L + P++ILLDEPFAGVDPVA+ DI  ++  L 
Sbjct: 123 FGLGHIRKNRGDLLSGGERRRTEIARALATDPNFILLDEPFAGVDPVAVEDIQRIVAKLK 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           ++ IGILITDHNV E L + DR Y++  G +L HG  +E+  ++ VR++YLG  F
Sbjct: 183 NKNIGILITDHNVQETLAITDRTYLMFEGSILKHGKPEELAADEMVRKVYLGQNF 237


>gi|332305024|ref|YP_004432875.1| ABC transporter related protein [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172353|gb|AEE21607.1| ABC transporter related protein [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 241

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 172/238 (72%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y S  VV+ V L V  G+IVGLLGPNGAGKTT FYM+ GL+  D G I 
Sbjct: 2   ATLKATHLAKSYKSRQVVRDVSLEVSTGQIVGLLGPNGAGKTTTFYMIVGLVPLDKGEIC 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           ID  D+T  PM+ RARLGI YLPQEASIFR LTV +N++A+L+   E   +++ ++ DSL
Sbjct: 62  IDQQDLTLQPMHMRARLGIGYLPQEASIFRKLTVHQNLMAILQTRKELSSEQKEQQADSL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EFNI   R+     LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP++++DI  +I+
Sbjct: 122 LDEFNINHIRNSAGMSLSGGERRRVEIARALAADPEFILLDEPFAGVDPISVNDIKKIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIG+LITDHNV E L + ++AYI+  G ++A GT +E++ +Q VR +YLG++F
Sbjct: 182 HLRDRGIGVLITDHNVRETLDVCEKAYIVSHGELIASGTAEEVLSDQRVRDVYLGEQF 239


>gi|292490479|ref|YP_003525918.1| ABC transporter [Nitrosococcus halophilus Nc4]
 gi|291579074|gb|ADE13531.1| ABC transporter related protein [Nitrosococcus halophilus Nc4]
          Length = 241

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 170/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S LSA  L K Y S +VV+ V L +  GE+VGLLGPNGAGKTT FYM+ GLI  D G I 
Sbjct: 2   SRLSAYHLAKCYQSRWVVRDVSLELSSGEVVGLLGPNGAGKTTCFYMLVGLISIDKGLIS 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           +D ++IT+ P++RRARLGISYLPQEAS+FR LTV ENI+A+ E      K  R + +D L
Sbjct: 62  LDHHEITRYPIHRRARLGISYLPQEASVFRKLTVAENIMAIAETRSDLTKPARRQLVDEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L E NIT  ++ L   LSGG+RRR+EIAR+L   P +ILLDEPFAGVDP+++ DI  +IR
Sbjct: 122 LHELNITHVKNTLGMSLSGGERRRVEIARALAVEPQFILLDEPFAGVDPISVLDIQGIIR 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIG+LITDHNV E L +   AYI++ G V+A G  QEI++N+ V+ +YLG  F
Sbjct: 182 QLTERGIGVLITDHNVRETLGICQYAYIVNEGEVIAKGQPQEILNNERVKEVYLGYNF 239


>gi|134096263|ref|YP_001101338.1| ABC transporter ATP-binding protein [Herminiimonas arsenicoxydans]
 gi|133740166|emb|CAL63217.1| Putative ABC-type transport system, ATPase component [Herminiimonas
           arsenicoxydans]
          Length = 246

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 130/242 (53%), Positives = 178/242 (73%), Gaps = 5/242 (2%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L    L K Y +  VV+ V L V+ GE++GLLGPNGAGKTT FYM+ GL+ +D+G I+
Sbjct: 3   SKLIVSGLQKSYGARQVVRDVALQVESGEVIGLLGPNGAGKTTSFYMIVGLVPSDAGRIE 62

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD-----KKKRHEK 138
           +DG DI++ P+++RA+LG+SYLPQEAS+FR L+VE+NI AVLE+   +     K++  ++
Sbjct: 63  LDGVDISRQPIHKRAQLGLSYLPQEASVFRKLSVEDNIRAVLELQRVNGKALSKEQIEQR 122

Query: 139 LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIH 198
           LD+LL +  I K R   A  LSGG+RRR+EIAR+L + P ++LLDEPFAGVDP+A+ +I 
Sbjct: 123 LDTLLADLQIEKLRENQALSLSGGERRRVEIARALATNPRFVLLDEPFAGVDPIAVIEIQ 182

Query: 199 VLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGD 258
            ++R L  RGIG+LITDHNV E L + DRAYII+ G VLA G   +II ++ VRR+YLG+
Sbjct: 183 RIVRFLKERGIGVLITDHNVRETLGICDRAYIINQGAVLASGRPDDIIADESVRRVYLGE 242

Query: 259 RF 260
            F
Sbjct: 243 HF 244


>gi|145590090|ref|YP_001156687.1| ABC transporter related [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145048496|gb|ABP35123.1| ABC transporter related protein [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 255

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 140/256 (54%), Positives = 175/256 (68%), Gaps = 8/256 (3%)

Query: 10  IEMPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFY 69
           + M   Q N A+    LSA +L K+Y S  VVK V + VK GE+VGLLGPNGAGKTT FY
Sbjct: 1   MTMDSAQTNAAAT---LSAHNLQKRYGSRTVVKDVSIQVKCGEVVGLLGPNGAGKTTSFY 57

Query: 70  MMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYE 129
           M+ GL+  D G I +DG DIT +P++ RAR+G+SYLPQEAS+FR L V ENI AVLE+  
Sbjct: 58  MIVGLVPLDGGRIVLDGTDITHLPIHERARMGLSYLPQEASVFRKLNVAENIQAVLELQV 117

Query: 130 K-----DKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDE 184
           +      K +   +LD LL E  I+  R+  A  LSGG+RRR+EIAR+L S P +ILLDE
Sbjct: 118 QGGKPLSKGEIASRLDELLGELQISHLRNNPALSLSGGERRRVEIARALASQPKFILLDE 177

Query: 185 PFAGVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQE 244
           PFAGVDP+A+ +I  ++R L  R IG+LITDHNV E L + D AYII  G VLA G   +
Sbjct: 178 PFAGVDPIAVGEIQRIVRFLRDRNIGVLITDHNVRETLGICDHAYIISEGSVLAEGKPDQ 237

Query: 245 IIDNQDVRRLYLGDRF 260
           II N  VRR+YLG+ F
Sbjct: 238 IIQNDAVRRVYLGENF 253


>gi|254509106|ref|ZP_05121208.1| ABC transporter, ATP-binding protein [Vibrio parahaemolyticus 16]
 gi|219547987|gb|EED25010.1| ABC transporter, ATP-binding protein [Vibrio parahaemolyticus 16]
          Length = 241

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 176/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           +LL A  L K Y +  VV  V L VK G+IVGLLGPNGAGKTT FYM+ GL+  D G+I 
Sbjct: 2   ALLKAEHLAKSYKNRKVVSDVSLQVKSGQIVGLLGPNGAGKTTSFYMIVGLVARDEGAIY 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           ID  DI+ +PM+ R+R+GI YLPQEASIFR L+V++NI+AVLE   E  +++R +KL+ L
Sbjct: 62  IDDQDISVLPMHSRSRMGIGYLPQEASIFRKLSVQDNIMAVLETRKELTREERQDKLEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LEEFHIQHIRQSAGMALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A G+  E+++N+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGHLIAEGSPDEVLNNEQVKQVYLGEQF 239


>gi|237744280|ref|ZP_04574761.1| ABC transporter ATP-binding protein [Fusobacterium sp. 7_1]
 gi|229431509|gb|EEO41721.1| ABC transporter ATP-binding protein [Fusobacterium sp. 7_1]
          Length = 241

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 170/235 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LSA SL K Y    VV  V L V  GEIVGLLGPNGAGKTT FYM+TG++  DSG +   
Sbjct: 4   LSADSLIKTYKKRKVVDKVSLEVNKGEIVGLLGPNGAGKTTTFYMITGIVKPDSGEVMCA 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             DIT +PMY+RA +GI YL QE S+FR LTVEENI  VLE+ +  KKK+ E +D LL+E
Sbjct: 64  EQDITNLPMYKRADMGIGYLAQEPSVFRNLTVEENIEVVLEMKKISKKKQKETVDRLLEE 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T  R  L   LSGG+RRR+EIAR++ + PS+ILLDEPFAGVDP+A+ DI  +IR L 
Sbjct: 124 FKLTHVRDSLGYSLSGGERRRIEIARTIANNPSFILLDEPFAGVDPIAVEDIQNIIRHLK 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            R +GILITDHNV E L++ D++YI+  G VL  GT +EI +N + RR+YLG++F
Sbjct: 184 KRDLGILITDHNVRETLSITDKSYIMAKGKVLLEGTPREIANNPEARRIYLGEKF 238


>gi|170691492|ref|ZP_02882657.1| ABC transporter related [Burkholderia graminis C4D1M]
 gi|170143697|gb|EDT11860.1| ABC transporter related [Burkholderia graminis C4D1M]
          Length = 261

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 173/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 13  AGTSSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 72

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I +DG  I+ +P+++RA LG+SYLPQEAS+FR L+VEENI AVLE+  ++  KR  K 
Sbjct: 73  GEIDLDGKSISLLPIHKRASLGLSYLPQEASVFRKLSVEENIRAVLELQHEENGKRLSKD 132

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL E  I   R   A  LSGG+RRR+EIAR+L + PS+ILLDEPFAGVDP+A
Sbjct: 133 AITNRTEALLDELQIAHLRENPALSLSGGERRRVEIARALATNPSFILLDEPFAGVDPIA 192

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   EII+N+ VRR
Sbjct: 193 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPSEIIENESVRR 252

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 253 VYLGEHF 259


>gi|149279019|ref|ZP_01885153.1| ABC transporter, ATP-binding protein [Pedobacter sp. BAL39]
 gi|149230298|gb|EDM35683.1| ABC transporter, ATP-binding protein [Pedobacter sp. BAL39]
          Length = 244

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 168/238 (70%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L KKY    VV  V   V  GEIVGLLGPNGAGKTT FYM+ GLI  + G+I +
Sbjct: 2   ILRADHLIKKYKQRTVVNDVSFSVSQGEIVGLLGPNGAGKTTSFYMIVGLIKPNEGTIFL 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           D  DIT   MYRRA+ GI YL QEAS+FR L+VE+NI+++LE+ +  K++RHEKL+ L+ 
Sbjct: 62  DEEDITSDAMYRRAQKGIGYLAQEASVFRKLSVEDNIMSILEMTDMSKEERHEKLEELIN 121

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF++ K R     LLSGG+RRR EIAR+L + P++ILLDEPFAGVDP+A+ +I  ++  L
Sbjct: 122 EFSLNKVRKNRGDLLSGGERRRTEIARALAASPNFILLDEPFAGVDPIAVEEIQTIVAKL 181

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             + IGILITDHNV E L++ DRAY++  G +L  GT + +  N+ VRR+YLG  F  
Sbjct: 182 KKKNIGILITDHNVQETLSITDRAYLLFEGKILESGTPEVLAANEMVRRVYLGSNFVL 239


>gi|107023723|ref|YP_622050.1| ABC transporter related [Burkholderia cenocepacia AU 1054]
 gi|105893912|gb|ABF77077.1| ABC transporter related protein [Burkholderia cenocepacia AU 1054]
          Length = 258

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 174/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+ AD+
Sbjct: 10  AGTTSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPADA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I ++G+ I+ +P+++RA LG+SYLPQEAS+FR LTVEENI AVLE+   +  KR  K 
Sbjct: 70  GEISLNGSSISLLPIHKRASLGLSYLPQEASVFRKLTVEENIRAVLELQHGEDGKRLSKD 129

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL E  I   R   A  LSGG+RRR+EIAR+L + PS+ILLDEPFAGVDP+A
Sbjct: 130 AISSRTEALLDELQIGHLRENPALSLSGGERRRVEIARALATNPSFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   EII+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPSEIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|34763052|ref|ZP_00144026.1| ABC transporter ATP-binding protein [Fusobacterium nucleatum subsp.
           vincentii ATCC 49256]
 gi|256844994|ref|ZP_05550452.1| urea ABC transporter, ATP-binding protein UrtD [Fusobacterium sp.
           3_1_36A2]
 gi|27887278|gb|EAA24375.1| ABC transporter ATP-binding protein [Fusobacterium nucleatum subsp.
           vincentii ATCC 49256]
 gi|256718553|gb|EEU32108.1| urea ABC transporter, ATP-binding protein UrtD [Fusobacterium sp.
           3_1_36A2]
          Length = 241

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 170/235 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LSA SL K Y    VV  V L V  GEIVGLLGPNGAGKTT FYM+TG++  DSG +   
Sbjct: 4   LSADSLVKTYKKRKVVDRVSLEVNKGEIVGLLGPNGAGKTTTFYMITGIVKPDSGEVMCA 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             DIT +PMY+RA +GI YL QE S+FR LTVEENI  VLE+ +  KKK+ E +D LL+E
Sbjct: 64  EQDITNLPMYKRADMGIGYLAQEPSVFRNLTVEENIEVVLEMKKISKKKQKETVDRLLEE 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T  R  L   LSGG+RRR+EIAR++ + PS+ILLDEPFAGVDP+A+ DI  +IR L 
Sbjct: 124 FKLTHVRDSLGYSLSGGERRRIEIARTIANNPSFILLDEPFAGVDPIAVEDIQNIIRHLK 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            R +GILITDHNV E L++ D++YI+  G VL  GT +EI +N + RR+YLG++F
Sbjct: 184 KRDLGILITDHNVRETLSITDKSYIMAKGKVLLEGTPREIANNPEARRIYLGEKF 238


>gi|325520921|gb|EGC99897.1| ABC-type transporter ATPase [Burkholderia sp. TJI49]
          Length = 258

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 173/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 10  AGTTSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I ++G+ I+ +P+++RA LG+SYLPQEAS+FR LTVEENI AVLE+   D  KR  K 
Sbjct: 70  GEISLNGSSISLLPIHKRASLGLSYLPQEASVFRKLTVEENIRAVLELQHGDDGKRLSKD 129

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL E  I   R   A  LSGG+RRR+EIAR+L + PS+ILLDEPFAGVDP+A
Sbjct: 130 AIASRTEALLDELQIAHLRENPALSLSGGERRRVEIARALATNPSFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   EII+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPSEIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|3341483|emb|CAA11111.1| hypothetical protein [Pseudomonas stutzeri]
          Length = 241

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 172/238 (72%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K Y S  VV+ V L ++ G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   AVLKAQHLAKSYKSRQVVRDVSLSIESGQIVGLLGPNGAGKTTCFYMIAGLVNADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID ND+T +PM+ RAR GI YLPQEASIFR L+V +NI+A+LE  +  D+  R + L+ L
Sbjct: 62  IDQNDVTHLPMHGRARAGIGYLPQEASIFRKLSVADNIMAILETRKDLDRSGRQQALEGL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R+ L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHINHIRNSLGMSLSGGERRRVEIARALATAPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIG+LITDHNV E L + + AYI++ G ++A G  Q I+ NQ V+ +YLG  F
Sbjct: 182 HLKAKGIGVLITDHNVRETLDICETAYIVNDGQLIAEGDAQTILSNQLVKEVYLGHEF 239


>gi|330826952|ref|YP_004390255.1| sulfate-transporting ATPase [Alicycliphilus denitrificans K601]
 gi|329312324|gb|AEB86739.1| Sulfate-transporting ATPase [Alicycliphilus denitrificans K601]
          Length = 266

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 172/244 (70%), Gaps = 8/244 (3%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A  L K Y S  VVK V L V+ GE+VGLLGPNGAGKTT FYM+ GL+ +D G I+
Sbjct: 22  SRLEALHLQKSYGSRKVVKDVSLVVQKGEVVGLLGPNGAGKTTSFYMIVGLVRSDGGDIR 81

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR-------H 136
           IDG+ +  MP++RR+RLG+SYLPQEASIFR L VE+N+ AVLE+ + D   R        
Sbjct: 82  IDGHSVANMPIHRRSRLGLSYLPQEASIFRKLNVEDNVRAVLEL-QTDADGRALPRDEIE 140

Query: 137 EKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISD 196
            +L  LL+E  +   R   A  LSGG+RRR+EIAR+L + P +ILLDEPFAG+DP+A+ +
Sbjct: 141 RRLTELLQELRVDHLRQSPALALSGGERRRVEIARALATQPRFILLDEPFAGIDPIAVIE 200

Query: 197 IHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYL 256
           I  +I  L +RGIG+LITDHNV E L + D A+II  G VLA GT  EI+DN +VRR+YL
Sbjct: 201 IQRIIGFLKARGIGVLITDHNVRETLGICDHAFIISDGHVLAQGTPSEIVDNAEVRRVYL 260

Query: 257 GDRF 260
           G+ F
Sbjct: 261 GEHF 264


>gi|323524684|ref|YP_004226837.1| ABC transporter-like protein [Burkholderia sp. CCGE1001]
 gi|323381686|gb|ADX53777.1| ABC transporter related protein [Burkholderia sp. CCGE1001]
          Length = 261

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 173/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 13  AGTSSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 72

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I +DG  I+ +P+++RA LG+SYLPQEAS+FR L+VEENI AVLE+  ++  KR  K 
Sbjct: 73  GEIDLDGKSISLLPIHKRASLGLSYLPQEASVFRKLSVEENIRAVLELQHEENGKRLSKD 132

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL E  I   R   A  LSGG+RRR+EIAR+L + PS+ILLDEPFAGVDP+A
Sbjct: 133 AIKSRTEALLDELQIAHLRENPALSLSGGERRRVEIARALATNPSFILLDEPFAGVDPIA 192

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   EII+N+ VRR
Sbjct: 193 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPSEIIENESVRR 252

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 253 VYLGEHF 259


>gi|254480331|ref|ZP_05093579.1| ABC transporter, ATP-binding protein, putative [marine gamma
           proteobacterium HTCC2148]
 gi|214039893|gb|EEB80552.1| ABC transporter, ATP-binding protein, putative [marine gamma
           proteobacterium HTCC2148]
          Length = 241

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 176/240 (73%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A +L K Y    VV+ V L V  G++VGLLGPNGAGKTT FYM+ G+I AD G I+
Sbjct: 2   ACLQANNLAKAYRGREVVRDVSLQVDSGQVVGLLGPNGAGKTTCFYMIIGIIQADRGVIE 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           ++G DIT + M+ RAR G+ YLPQEASIFR LTV +NILA+LE   + +KK+R E+ D L
Sbjct: 62  LNGEDITPLSMHERARHGLGYLPQEASIFRKLTVGDNILAILETRPDLNKKQRLERRDQL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF++   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP++++DI  +I 
Sbjct: 122 LEEFHVEHLRDSLGQALSGGERRRIEIARALAAEPDFILLDEPFAGVDPISVNDIKTIIN 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L  RGIG+LITDHNV + L + ++AYI+  G ++A GT ++++ ++ VRR+YLGD+F  
Sbjct: 182 HLRDRGIGVLITDHNVRDTLDICEKAYIVGEGHIIASGTAEDVLGSEHVRRIYLGDQFQL 241


>gi|56708113|ref|YP_170009.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110670584|ref|YP_667141.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           tularensis FSC198]
 gi|118497494|ref|YP_898544.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           novicida U112]
 gi|134301924|ref|YP_001121893.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|195536187|ref|ZP_03079194.1| ABC transporter, ATP-binding protein, putative [Francisella
           tularensis subsp. novicida FTE]
 gi|208779292|ref|ZP_03246638.1| ABC transporter, ATP-binding protein, putative [Francisella
           novicida FTG]
 gi|254370597|ref|ZP_04986602.1| ABC transporter [Francisella tularensis subsp. tularensis FSC033]
 gi|254372823|ref|ZP_04988312.1| hypothetical protein FTCG_00393 [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|254374314|ref|ZP_04989796.1| hypothetical protein FTDG_00480 [Francisella novicida GA99-3548]
 gi|56604605|emb|CAG45657.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110320917|emb|CAL09040.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           tularensis FSC198]
 gi|118423400|gb|ABK89790.1| ABC transporter, ATP-binding protein [Francisella novicida U112]
 gi|134049701|gb|ABO46772.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|151568840|gb|EDN34494.1| ABC transporter [Francisella tularensis subsp. tularensis FSC033]
 gi|151570550|gb|EDN36204.1| hypothetical protein FTCG_00393 [Francisella novicida GA99-3549]
 gi|151572034|gb|EDN37688.1| hypothetical protein FTDG_00480 [Francisella novicida GA99-3548]
 gi|194372664|gb|EDX27375.1| ABC transporter, ATP-binding protein, putative [Francisella
           tularensis subsp. novicida FTE]
 gi|208745092|gb|EDZ91390.1| ABC transporter, ATP-binding protein, putative [Francisella
           novicida FTG]
 gi|282159313|gb|ADA78704.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           tularensis NE061598]
 gi|328676057|gb|AEB28732.1| Lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Francisella cf. novicida 3523]
 gi|332678189|gb|AEE87318.1| Lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Francisella cf. novicida Fx1]
          Length = 243

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 130/238 (54%), Positives = 174/238 (73%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L KKY S +VV  V + V  GEIVGLLGPNGAGKTT FYM+ GL+ A  G +++ 
Sbjct: 6   LEAKRLGKKYGSRWVVNNVSMKVSTGEIVGLLGPNGAGKTTSFYMIVGLVAATRGKVRMG 65

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
             D+TKMP++ RAR G+ YLPQEAS+FR L+VE+NI+A+LE  +  +K +  EKL+ LL 
Sbjct: 66  QEDVTKMPIHLRARRGLGYLPQEASVFRKLSVEDNIVAILETRKDLNKIQIEEKLNELLD 125

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+I   R  L   LSGG+RRR+EIAR+L   P +ILLDEPFAGVDPV++ +I  ++R L
Sbjct: 126 EFSIQHIRKSLGMSLSGGERRRVEIARALAMDPKFILLDEPFAGVDPVSVIEIKEVVRHL 185

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             RGIG+LITDHNV E L + +RAYI++AG +LA GT +E++ ++ VR++YLG+ F  
Sbjct: 186 KDRGIGVLITDHNVRETLDICERAYIVNAGNMLAAGTPEEVLADETVRKVYLGEDFKL 243


>gi|29654080|ref|NP_819772.1| LPS ABC transporter ATP-binding protein [Coxiella burnetii RSA 493]
 gi|154707739|ref|YP_001424153.1| LPS ABC transporter ATP-binding protein [Coxiella burnetii Dugway
           5J108-111]
 gi|161830573|ref|YP_001596943.1| ABC transporter, ATP-binding protein [Coxiella burnetii RSA 331]
 gi|212212789|ref|YP_002303725.1| LPS ABC transporter ATP-binding protein [Coxiella burnetii
           CbuG_Q212]
 gi|29541346|gb|AAO90286.1| LPS ABC transporter ATP-binding protein [Coxiella burnetii RSA 493]
 gi|154357025|gb|ABS78487.1| LPS ABC transporter ATP-binding protein [Coxiella burnetii Dugway
           5J108-111]
 gi|161762440|gb|ABX78082.1| ABC transporter, ATP-binding protein [Coxiella burnetii RSA 331]
 gi|212011199|gb|ACJ18580.1| LPS ABC transporter ATP-binding protein [Coxiella burnetii
           CbuG_Q212]
          Length = 249

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 174/238 (73%), Gaps = 2/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++LSA  L K Y S  VVK V L +   EIVGLLGPNGAGKTT FYM+ GLI  DSG + 
Sbjct: 3   AILSAKQLQKSYKSRRVVKDVSLAIT-NEIVGLLGPNGAGKTTSFYMIVGLITPDSGEVF 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           +D  +I+  PM++RARLGI YLPQE SIFR L+V +NI+A+L++     K++R EK +SL
Sbjct: 62  LDNQNISFQPMHKRARLGIGYLPQETSIFRKLSVAQNIMAILQLRNDLSKQQRQEKCESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+I+  R +    LSGG++RR+EIAR+L   P +ILLDEPFAG+DP+++ DI  +I 
Sbjct: 122 MQEFHISHLRDIPGYSLSGGEKRRVEIARALAMDPKFILLDEPFAGIDPISVIDIKRIII 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIGILITDHNV E L +  RAYI++ G ++AHGT  EI+ N+DVR +YLGD F
Sbjct: 182 HLRERGIGILITDHNVRETLDICQRAYIVNDGAIIAHGTPGEILRNKDVRAVYLGDEF 239


>gi|296161541|ref|ZP_06844346.1| ABC transporter related protein [Burkholderia sp. Ch1-1]
 gi|295888185|gb|EFG67998.1| ABC transporter related protein [Burkholderia sp. Ch1-1]
          Length = 261

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 173/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 13  AGTSSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 72

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I +DG  I+ +P+++RA LG+SYLPQEAS+FR L+VEENI AVLE+  +D  KR  K 
Sbjct: 73  GEIDLDGKSISLLPIHKRASLGLSYLPQEASVFRKLSVEENIRAVLELQHEDNGKRLSKD 132

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL E  I   R   A  LSGG+RRR+EIAR+L + PS+ILLDEPFAGVDP+A
Sbjct: 133 TITSRTEALLDELQIAHLRANPALSLSGGERRRVEIARALATNPSFILLDEPFAGVDPIA 192

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   EII+N+ VRR
Sbjct: 193 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPGEIIENESVRR 252

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 253 VYLGEHF 259


>gi|319764736|ref|YP_004128673.1| abc transporter related protein [Alicycliphilus denitrificans BC]
 gi|317119297|gb|ADV01786.1| ABC transporter related protein [Alicycliphilus denitrificans BC]
          Length = 266

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 172/244 (70%), Gaps = 8/244 (3%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A  L K Y S  VVK V L V+ GE+VGLLGPNGAGKTT FYM+ GL+ +D G I+
Sbjct: 22  SRLEALHLQKSYGSRKVVKDVSLVVQKGEVVGLLGPNGAGKTTSFYMIVGLVRSDGGDIR 81

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR-------H 136
           IDG+ +  MP++RR+RLG+SYLPQEASIFR L VE+N+ AVLE+ + D   R        
Sbjct: 82  IDGHSVANMPIHRRSRLGLSYLPQEASIFRKLNVEDNVRAVLEL-QTDADGRALPRDEIE 140

Query: 137 EKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISD 196
            +L  LL+E  +   R   A  LSGG+RRR+EIAR+L + P +ILLDEPFAG+DP+A+ +
Sbjct: 141 RRLTELLQELRVDHLRQSPALALSGGERRRVEIARALATQPRFILLDEPFAGIDPIAVIE 200

Query: 197 IHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYL 256
           I  +I  L +RGIG+LITDHNV E L + D A+II  G VLA GT  EI+DN +VRR+YL
Sbjct: 201 IQRIIGFLKARGIGVLITDHNVRETLGICDHAFIISDGHVLAQGTPSEIVDNAEVRRVYL 260

Query: 257 GDRF 260
           G+ F
Sbjct: 261 GEHF 264


>gi|323498690|ref|ZP_08103680.1| ABC transporter, ATP-binding protein [Vibrio sinaloensis DSM 21326]
 gi|323316246|gb|EGA69267.1| ABC transporter, ATP-binding protein [Vibrio sinaloensis DSM 21326]
          Length = 241

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 174/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           +LL A  L K Y +  VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G I 
Sbjct: 2   ALLKAEHLAKSYKNRKVVSDVSLQVQSGQIVGLLGPNGAGKTTSFYMIVGLVARDEGRIS 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           ID  DI+ +PM+ R+R+GI YLPQEASIFR L+VE NI+AVLE   E  +++R +KL+ L
Sbjct: 62  IDDEDISVLPMHSRSRMGIGYLPQEASIFRKLSVENNIMAVLETRKELTREERQDKLEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LEEFHIQHIRQSAGMALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A G+  E+++N+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGHLIAEGSPDEVLNNEQVKQVYLGEQF 239


>gi|255322172|ref|ZP_05363318.1| ABC-transporter ATP-binding protein [Campylobacter showae RM3277]
 gi|255300545|gb|EET79816.1| ABC-transporter ATP-binding protein [Campylobacter showae RM3277]
          Length = 242

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 127/237 (53%), Positives = 167/237 (70%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L    L K      ++KG+ L VK GE+VGLLGPNGAGKTT FYM+ GLI   SGS+ +D
Sbjct: 4   LEVKDLQKTIKKTNIIKGISLEVKSGEVVGLLGPNGAGKTTTFYMICGLISPSSGSVFLD 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G D+TK+P+++RA +GI YLPQE+SIF+ L+VEEN+L   E+  KD+  R +K++ +L  
Sbjct: 64  GADVTKVPLHKRAHMGIGYLPQESSIFKDLSVEENLLLGAEILYKDEAVREKKVNEMLNL 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
            NI   R      LSGG+RRR EIARSL+  P ++LLDEPFAGVDP+A+SDI  ++RDL 
Sbjct: 124 LNIEPIRLRKGVSLSGGERRRCEIARSLIITPKFLLLDEPFAGVDPIAVSDIQSIVRDLK 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             GIG+LITDHNV E L + DRAY+I  G +LA G+  E+ +N+ VR  YLG+ F F
Sbjct: 184 KLGIGVLITDHNVRETLAICDRAYVIKDGSLLASGSANEVANNKLVRTHYLGEEFKF 240


>gi|300313259|ref|YP_003777351.1| ABC transporter ATPase [Herbaspirillum seropedicae SmR1]
 gi|300076044|gb|ADJ65443.1| ABC-type transport system, ATPase component protein [Herbaspirillum
           seropedicae SmR1]
          Length = 247

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 133/242 (54%), Positives = 176/242 (72%), Gaps = 5/242 (2%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L    L K Y +  VV+ V + V+ GE+VGLLGPNGAGKTT FYM+ GL+ +D G I 
Sbjct: 4   SSLVVRGLKKSYGARQVVRDVSMEVRSGEVVGLLGPNGAGKTTSFYMIVGLVPSDGGEID 63

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKK--KRHE---K 138
           +DG  I+++ +++RA LG+SYLPQEAS+FR LTVE+NI AVLE+ ++D K   R E   +
Sbjct: 64  LDGEPISRLAIHKRATLGLSYLPQEASVFRKLTVEDNIRAVLELRQEDGKPLSRDEIEGR 123

Query: 139 LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIH 198
           L++LL E  I K R   A  LSGG+RRR+EIAR+L + P ++LLDEPFAG+DP+A+ +I 
Sbjct: 124 LNNLLHELQIEKLRESQALSLSGGERRRVEIARALATDPRFVLLDEPFAGIDPIAVIEIQ 183

Query: 199 VLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGD 258
            ++R L  RGIG+LITDHNV E L + DRAYII+ G VLA G  +EII N+ VRR+YLG+
Sbjct: 184 RIVRFLKERGIGVLITDHNVRETLGICDRAYIINQGTVLASGNPEEIIANESVRRVYLGE 243

Query: 259 RF 260
            F
Sbjct: 244 HF 245


>gi|89256400|ref|YP_513762.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           holarctica LVS]
 gi|115314844|ref|YP_763567.1| ABC transporter ATP-binding protein [Francisella tularensis subsp.
           holarctica OSU18]
 gi|156502491|ref|YP_001428556.1| ABC transporter ATP-binding protein [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|167010422|ref|ZP_02275353.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           holarctica FSC200]
 gi|254367738|ref|ZP_04983759.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           holarctica 257]
 gi|290953823|ref|ZP_06558444.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295312834|ref|ZP_06803566.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           holarctica URFT1]
 gi|89144231|emb|CAJ79504.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           holarctica LVS]
 gi|115129743|gb|ABI82930.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Francisella tularensis subsp. holarctica OSU18]
 gi|134253549|gb|EBA52643.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           holarctica 257]
 gi|156253094|gb|ABU61600.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           holarctica FTNF002-00]
          Length = 243

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 130/238 (54%), Positives = 174/238 (73%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L KKY S +VV  V + V  GEIVGLLGPNGAGKTT FYM+ GL+ A  G +++ 
Sbjct: 6   LEAKRLGKKYGSRWVVNNVSMKVSTGEIVGLLGPNGAGKTTSFYMIVGLVTATRGKVRMG 65

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
             D+TKMP++ RAR G+ YLPQEAS+FR L+VE+NI+A+LE  +  +K +  EKL+ LL 
Sbjct: 66  QEDVTKMPIHLRARRGLGYLPQEASVFRKLSVEDNIVAILETRKDLNKIQIEEKLNELLD 125

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+I   R  L   LSGG+RRR+EIAR+L   P +ILLDEPFAGVDPV++ +I  ++R L
Sbjct: 126 EFSIQHIRKSLGMSLSGGERRRVEIARALAMDPKFILLDEPFAGVDPVSVIEIKEVVRHL 185

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             RGIG+LITDHNV E L + +RAYI++AG +LA GT +E++ ++ VR++YLG+ F  
Sbjct: 186 KDRGIGVLITDHNVRETLDICERAYIVNAGNMLAAGTPEEVLADETVRKVYLGEDFKL 243


>gi|146328708|ref|YP_001209443.1| ABC transporter ATP-binding protein [Dichelobacter nodosus
           VCS1703A]
 gi|146232178|gb|ABQ13156.1| ABC transporter family ATP-binding protein [Dichelobacter nodosus
           VCS1703A]
          Length = 243

 Score =  261 bits (668), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 170/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L    + K+Y    +++   L V+P ++VGLLGPNGAGKTT FYM+ GLI  D+G+I 
Sbjct: 2   SGLEVVQIQKRYGDRVILRDFSLTVQPAQVVGLLGPNGAGKTTGFYMIVGLIPVDAGTIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ++  +IT +P+++RARLG+SYLPQEAS+FR L+VE+NILA+LE+  + D+K R EK   L
Sbjct: 62  LNEQNITHLPIHQRARLGLSYLPQEASVFRRLSVEDNILAILELATRLDRKARREKAQQL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           + E  IT   + L   LSGG+RRR EIAR+L + P +ILLDEPFAGVDP+A+SDI  +I+
Sbjct: 122 MAELGITHLANTLGIALSGGERRRCEIARALATEPQFILLDEPFAGVDPIAVSDIRHIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  R IG+LITDHNV E L   D +YI+  G ++AHGT  EI+ N+  RR YLGD F
Sbjct: 182 HLTKRNIGVLITDHNVRETLKSCDHSYILSEGRIIAHGTPAEIVANEAARRAYLGDDF 239


>gi|167561500|ref|ZP_02354416.1| ABC transporter, ATP-binding protein [Burkholderia oklahomensis
           EO147]
          Length = 258

 Score =  261 bits (668), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 174/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y +  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 10  AGTSSSLVVRNLKKRYGTRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I ++G+ I+ MP+++RA LG+SYLPQEAS+FR LTVEENI AVLE+   D   R  K 
Sbjct: 70  GDISLNGSPISLMPIHKRASLGLSYLPQEASVFRKLTVEENIRAVLELQHDDNGNRLSKD 129

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL+E  I   R   A  LSGG+RRR+EIAR+L S PS+ILLDEPFAGVDP+A
Sbjct: 130 EIGARAEALLEELQIAHLRENPALSLSGGERRRVEIARALASNPSFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G  ++II+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLASGAPKDIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|223040647|ref|ZP_03610917.1| ABC-transporter ATP-binding protein [Campylobacter rectus RM3267]
 gi|222878105|gb|EEF13216.1| ABC-transporter ATP-binding protein [Campylobacter rectus RM3267]
          Length = 242

 Score =  261 bits (668), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 127/237 (53%), Positives = 167/237 (70%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L    L K      ++KG+ L VK GE+VGLLGPNGAGKTT FYM+ GLI   SGS+ +D
Sbjct: 4   LEVKDLQKTIKKTNIIKGISLEVKSGEVVGLLGPNGAGKTTTFYMICGLISPTSGSVFLD 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G D+TK+P+++RA +GI YLPQE+SIF+ L+VEEN+L   E+  KD+  R +K++ +L  
Sbjct: 64  GADVTKVPLHKRAHMGIGYLPQESSIFKDLSVEENLLLGAEILYKDEAVREKKVNEMLNL 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
            NI   R      LSGG+RRR EIARSL+  P ++LLDEPFAGVDP+A+SDI  ++RDL 
Sbjct: 124 LNIEPIRLRKGVSLSGGERRRCEIARSLIITPKFLLLDEPFAGVDPIAVSDIQSIVRDLK 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             GIG+LITDHNV E L + DRAY+I  G +LA G+  E+ +N+ VR  YLG+ F F
Sbjct: 184 KLGIGVLITDHNVRETLAICDRAYVIKDGSLLASGSANEVANNKLVRTHYLGEEFKF 240


>gi|326798143|ref|YP_004315962.1| sulfate-transporting ATPase [Sphingobacterium sp. 21]
 gi|326548907|gb|ADZ77292.1| Sulfate-transporting ATPase [Sphingobacterium sp. 21]
          Length = 245

 Score =  261 bits (668), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 169/238 (71%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L KKY    VV  V  +V+ GEIVGLLGPNGAGKTT FYM+ GLI  + G++ +
Sbjct: 2   ILKAEHLVKKYKQRTVVNDVSFHVEQGEIVGLLGPNGAGKTTSFYMIVGLIKPNEGNVYL 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           + ++IT+ PMYRRA+ GI YL QEAS+FR L+VE+NI+AVLE++ +DK  R EKL+ L+ 
Sbjct: 62  EDDNITEDPMYRRAQKGIGYLAQEASVFRKLSVEDNIMAVLEIHHQDKTVRKEKLEELIN 121

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF++ K R     LLSGG+RRR EIAR+L + P +ILLDEPFAGVDP+A+ +I  ++  L
Sbjct: 122 EFSLHKVRKNRGDLLSGGERRRTEIARALAASPHFILLDEPFAGVDPIAVEEIQTIVHKL 181

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             R IGILITDHNV E L++ DRAY++  G ++  GT +EI  N+  R  YLG  F  
Sbjct: 182 KHRNIGILITDHNVQETLSITDRAYLLTEGKIMLTGTPEEIAVNEMARTYYLGRHFEL 239


>gi|325855167|ref|ZP_08171790.1| ABC transporter, ATP-binding protein [Prevotella denticola CRIS
           18C-A]
 gi|327312570|ref|YP_004328007.1| ABC transporter ATP-binding protein [Prevotella denticola F0289]
 gi|325483904|gb|EGC86848.1| ABC transporter, ATP-binding protein [Prevotella denticola CRIS
           18C-A]
 gi|326945295|gb|AEA21180.1| ABC transporter, ATP-binding protein [Prevotella denticola F0289]
          Length = 278

 Score =  261 bits (668), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 172/253 (67%)

Query: 10  IEMPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFY 69
           +E   F      K+S+L    L K+Y    V  GV + V+ GEIVGLLGPNGAGKTT FY
Sbjct: 2   LETDNFVVRPEGKESVLRTDRLVKRYGKRTVANGVSINVRQGEIVGLLGPNGAGKTTSFY 61

Query: 70  MMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYE 129
           M TGL+  + G + ID  +IT  P+Y+RAR GI YLPQEAS+FR ++VE+NI++VLE+ +
Sbjct: 62  MTTGLVVPNEGHVYIDNQEITNYPVYKRARAGIGYLPQEASVFRKMSVEDNIMSVLEMTK 121

Query: 130 KDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGV 189
             K++R EK++SL++EF + K R  L   LSGG+RRR EIAR L   P +I+LDEPFAGV
Sbjct: 122 LSKQERIEKMESLIREFRLEKVRKNLGDRLSGGERRRCEIARCLAIDPKFIMLDEPFAGV 181

Query: 190 DPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQ 249
           DP+A+ DI  ++  L  R IGILITDHNVHE L + DRAY++  G +L  GT +E+  N+
Sbjct: 182 DPIAVEDIQHIVWRLKFRNIGILITDHNVHETLNITDRAYLLFEGRILFKGTPEELAANK 241

Query: 250 DVRRLYLGDRFAF 262
            V+  YLG  F  
Sbjct: 242 IVKEKYLGTDFVL 254


>gi|169633847|ref|YP_001707583.1| lipopolysaccharide ABC transporter ATP-binding protein LptB
           [Acinetobacter baumannii SDF]
 gi|169152639|emb|CAP01634.2| putative lipopolysaccharide transport protein B (ABC superfamily,
           atp_bind) (LptB) [Acinetobacter baumannii]
          Length = 248

 Score =  261 bits (668), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 125/232 (53%), Positives = 169/232 (72%), Gaps = 1/232 (0%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K Y+  +VVK V   ++ G+IVGLLGPNGAGKTT FYM+ GL+  D G I +D  D++
Sbjct: 16  LAKNYSKRWVVKDVSFSMQSGQIVGLLGPNGAGKTTSFYMVVGLVRMDKGEIHLDDLDMS 75

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLKEFNIT 149
              M+ RAR GI YLPQEASIFR LT+ ENI+++LE  +  +K++R ++L  LL +FNI+
Sbjct: 76  DRAMHERARKGIGYLPQEASIFRKLTIAENIMSILETRKDLNKQQRQQRLTELLNDFNIS 135

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             +  L   +SGG+RRR EIAR+L + P ++LLDEPFAGVDP+++ DI  +I+ L  RGI
Sbjct: 136 HIKDSLGMSVSGGERRRAEIARALAADPKFMLLDEPFAGVDPISVGDIKDIIQTLKDRGI 195

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
           G+LITDHNV E L + +RAYI+  G V+A GT QEI+DN+ VR++YLGD F 
Sbjct: 196 GVLITDHNVRETLAICERAYIVSEGSVIAEGTPQEILDNEQVRKVYLGDDFT 247


>gi|77361465|ref|YP_341040.1| ABC transporter ATP-binding protein [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76876376|emb|CAI87598.1| putative transport protein (ABC superfamily, atp-binding protein)
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 241

 Score =  261 bits (667), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 175/240 (72%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A  L K Y    VVK V L VK G IVGLLGPNGAGKTT FYM+ GL+ +D G I 
Sbjct: 2   STLKAELLAKSYKGREVVKNVGLEVKAGSIVGLLGPNGAGKTTTFYMIVGLVPSDKGKIL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID NDIT +PM+ RARLGI YLPQE+SIFR LTV +N++A+LE  ++ +K+ R E L+SL
Sbjct: 62  IDDNDITLLPMHSRARLGIGYLPQESSIFRKLTVYQNLMAILETRKQLNKQAREETLNSL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EF++   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LDEFSLQHIRDSLGMALSGGERRRVEIARALAADPKFILLDEPFAGVDPISVLDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L +RGIG+LITDHNV E L + ++AYI+  G ++A GT + +++++ VR +YLG++F  
Sbjct: 182 HLKNRGIGVLITDHNVRETLDVCEKAYIVSHGELIASGTPEFVLNDKTVRDVYLGEQFKL 241


>gi|167627939|ref|YP_001678439.1| ABC transporter ATP-binding protein [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
 gi|241668491|ref|ZP_04756069.1| ABC transporter, ATP-binding protein [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254877025|ref|ZP_05249735.1| ABC transporter [Francisella philomiragia subsp. philomiragia ATCC
           25015]
 gi|167597940|gb|ABZ87938.1| ABC transporter, ATP-binding protein [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
 gi|254843046|gb|EET21460.1| ABC transporter [Francisella philomiragia subsp. philomiragia ATCC
           25015]
          Length = 243

 Score =  261 bits (667), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 174/238 (73%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L KKY + +VV  V + V  GEIVGLLGPNGAGKTT FYM+ GL+ A  G +++ 
Sbjct: 6   LEAKRLGKKYGARWVVNNVSMKVSTGEIVGLLGPNGAGKTTSFYMIVGLVAATRGKVRMG 65

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSLLK 144
             D+TKMP++ RAR G+ YLPQEAS+FR L+VE+NI+A+LE   E +K +  EKL+ LL 
Sbjct: 66  DEDVTKMPIHLRARRGLGYLPQEASVFRKLSVEDNIIAILETRKELNKVQIEEKLNELLD 125

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+I   R  L   LSGG+RRR+EIAR+L   P +ILLDEPFAGVDPV++ +I  ++R L
Sbjct: 126 EFSIQHIRKSLGMSLSGGERRRVEIARALAMDPKFILLDEPFAGVDPVSVIEIKEVVRHL 185

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             RGIG+LITDHNV E L + +RAYI++AG +LA G+ +E++ ++ VR++YLG+ F  
Sbjct: 186 KDRGIGVLITDHNVRETLDICERAYIVNAGNMLAAGSPEEVLADETVRKVYLGEDFKL 243


>gi|148652635|ref|YP_001279728.1| ABC transporter-like protein [Psychrobacter sp. PRwf-1]
 gi|148571719|gb|ABQ93778.1| ABC transporter related [Psychrobacter sp. PRwf-1]
          Length = 271

 Score =  261 bits (667), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 125/241 (51%), Positives = 173/241 (71%), Gaps = 1/241 (0%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
           S D+ L+  +L K+Y   +VVK V   V+PG++VGLLGPNGAGKTT FYM+ GL+  D G
Sbjct: 29  SSDTALTMLNLAKRYGKRWVVKDVSFSVEPGQVVGLLGPNGAGKTTSFYMVVGLVNMDKG 88

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKL 139
            +K+   D++K  M+ RAR GI YLPQEASIFR LTV ENILA+L+  +  DK  + ++L
Sbjct: 89  MVKLGNQDLSKYAMHERARAGIGYLPQEASIFRKLTVRENILAILQTRKDLDKAAQEQEL 148

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + L+ +F++    H L   +SGG+RRR EIAR+L + P +ILLDEPFAGVDP+++SDI  
Sbjct: 149 NKLIADFSLEHVCHSLGMSVSGGERRRCEIARALAANPKFILLDEPFAGVDPISVSDIKE 208

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           +I  L  RGIG+LITDHNV E L + + AYI+  G ++AHGT +E+++N+ V+ +YLG  
Sbjct: 209 VIVALKRRGIGVLITDHNVRETLAICEHAYIVSEGAIIAHGTSEEVLNNELVQEVYLGRD 268

Query: 260 F 260
           F
Sbjct: 269 F 269


>gi|325916422|ref|ZP_08178694.1| ABC-type (unclassified) transport system, ATPase component
           [Xanthomonas vesicatoria ATCC 35937]
 gi|325537342|gb|EGD09066.1| ABC-type (unclassified) transport system, ATPase component
           [Xanthomonas vesicatoria ATCC 35937]
          Length = 239

 Score =  261 bits (667), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 168/237 (70%), Gaps = 1/237 (0%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L KKY    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GL+ AD+G I++
Sbjct: 1   MLVATGLRKKYKQREVVKEFGLTLEAGEVVGLLGPNGAGKTTCFYMIVGLVEADAGRIEL 60

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLL 143
           DG D+T  PMY RA+LG+ YLPQE SIFR LTV +NI  VLE+ E+ D   R ++L SLL
Sbjct: 61  DGRDLTAEPMYARAKLGVGYLPQEPSIFRKLTVADNIRLVLELREELDTAGREKELASLL 120

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +E  IT     L   LSGG+RRR EIAR+L + P  +LLDEPFAGVDP+++ +I  +I  
Sbjct: 121 EELQITHVADQLGASLSGGERRRCEIARALAAKPRMMLLDEPFAGVDPISVGEIQRIIIH 180

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L + DRAYI+  GGVLA G  + ++ N DVRR+YLG+ F
Sbjct: 181 LKERGIGVLITDHNVRETLGICDRAYILAEGGVLAQGAPEALLANPDVRRVYLGETF 237


>gi|183597959|ref|ZP_02959452.1| hypothetical protein PROSTU_01308 [Providencia stuartii ATCC 25827]
 gi|188022731|gb|EDU60771.1| hypothetical protein PROSTU_01308 [Providencia stuartii ATCC 25827]
          Length = 241

 Score =  261 bits (667), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 179/238 (75%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L+A +L K Y    VV+ V L VK GEIVGLLGPNGAGKTT FYM+ G++  D+G I 
Sbjct: 2   ATLTAENLAKAYKKRKVVEDVSLEVKSGEIVGLLGPNGAGKTTTFYMVVGIVQRDAGKIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           IDG DI+ +P++ RAR GI YLPQEASIFR L+V +N++AVLE+ ++ + ++R E+ + L
Sbjct: 62  IDGEDISLLPLHERARRGIGYLPQEASIFRRLSVYDNLMAVLEIRHDLNTEQRKERAEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+IT  R  +   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I+
Sbjct: 122 MEEFSITHLRDSIGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVLDIKKIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT + I++N+ V+R+YLG+ F
Sbjct: 182 HLRDYGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGTPEMILENEQVKRVYLGEGF 239


>gi|188996126|ref|YP_001930377.1| ABC transporter related [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931193|gb|ACD65823.1| ABC transporter related [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 243

 Score =  261 bits (667), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 169/239 (70%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   ++ K + +  VV GV LY + GEIVGLLGPNGAGKTT F  + G +  + GS+ 
Sbjct: 4   SRLELKNIEKSFKNRTVVNGVSLYAEEGEIVGLLGPNGAGKTTTFKCLLGFLKPEKGSVL 63

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           ++G DIT +P++ RA+ GIS+LPQE+SIFR LTV +N++  LE       +   K   LL
Sbjct: 64  LNGEDITDLPVWERAKKGISFLPQESSIFRDLTVWDNLMMFLEFQNLTVSEMTSKAQELL 123

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           KEFNI   +H  A  LSGG+RRRLEIARSL+  PS++LLDEPFAGVDPV++ DI+ LI  
Sbjct: 124 KEFNIDHLKHQKASTLSGGERRRLEIARSLIINPSFLLLDEPFAGVDPVSVKDINQLILS 183

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SR IGI+ITDHNV E L + DRAYII  G V+A GT QEI++NQ+V+R++LG+ F  
Sbjct: 184 LKSRNIGIIITDHNVRETLKITDRAYIIAHGRVIAEGTPQEIVENQEVKRVFLGEDFVL 242


>gi|307564909|ref|ZP_07627430.1| ABC transporter, ATP-binding protein [Prevotella amnii CRIS 21A-A]
 gi|307346382|gb|EFN91698.1| ABC transporter, ATP-binding protein [Prevotella amnii CRIS 21A-A]
          Length = 283

 Score =  261 bits (667), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 127/245 (51%), Positives = 172/245 (70%)

Query: 18  NRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICA 77
           ++  K S+L   +L K+Y    V  GV + V+ GEIVGLLGPNGAGKTT FYM TGL+  
Sbjct: 10  SQEKKSSILHTENLVKRYGKRTVANGVSINVRQGEIVGLLGPNGAGKTTSFYMTTGLVVP 69

Query: 78  DSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHE 137
           + G + ID  +ITK P+Y+RA+ GI YLPQEAS+FR ++VE+NI++VLE+ +  +++R E
Sbjct: 70  NEGHVYIDDKEITKYPVYKRAKAGIGYLPQEASVFRKMSVEDNIMSVLEMTKLSREQRIE 129

Query: 138 KLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDI 197
           K++SL++EF + K R  L   LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI
Sbjct: 130 KMESLIREFRLEKVRKNLGDRLSGGERRRCEIARCLAIDPKFIMLDEPFAGVDPIAVEDI 189

Query: 198 HVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLG 257
             ++  L  R IGILITDHNVHE L + DRAY++  G +L  GT +E+  N+ V+  YLG
Sbjct: 190 QHIVWQLKFRNIGILITDHNVHETLNITDRAYLLFEGRILFKGTPEELSANKVVKEKYLG 249

Query: 258 DRFAF 262
             F  
Sbjct: 250 VDFVL 254


>gi|225011805|ref|ZP_03702243.1| ABC transporter-related protein [Flavobacteria bacterium MS024-2A]
 gi|225004308|gb|EEG42280.1| ABC transporter-related protein [Flavobacteria bacterium MS024-2A]
          Length = 260

 Score =  261 bits (667), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 126/235 (53%), Positives = 168/235 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LSA ++ K Y    VVKG+ L V  GEIVGLLGPNGAGKTT FYM+ GLI  ++G+I ++
Sbjct: 17  LSASNIEKAYKGRKVVKGISLEVSQGEIVGLLGPNGAGKTTSFYMIVGLIKPNNGAIFLN 76

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             +ITK PMY+RA+ GI YL QEAS+FR L+VEENIL+VL++ +  K  + EK++SLL+E
Sbjct: 77  DQEITKFPMYKRAQQGIGYLAQEASVFRKLSVEENILSVLQMTDLSKTAQKEKMESLLEE 136

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +   R     LLSGG+RRR EIAR+L + P ++LLDEPFAGVDPVA+ DI  ++  L 
Sbjct: 137 FGLNHIRKNRGDLLSGGERRRTEIARALATDPKFVLLDEPFAGVDPVAVEDIQRIVAHLK 196

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            + IGILITDHNV E L + D+ Y++  G +L  GT  E+  ++ VR++YLG  F
Sbjct: 197 KKNIGILITDHNVQETLAITDKTYLMFEGSILKAGTPDELASDEMVRKVYLGQNF 251


>gi|253583469|ref|ZP_04860667.1| ABC superfamily ATP binding cassette transporter ABC protein
           [Fusobacterium varium ATCC 27725]
 gi|251834041|gb|EES62604.1| ABC superfamily ATP binding cassette transporter ABC protein
           [Fusobacterium varium ATCC 27725]
          Length = 241

 Score =  261 bits (667), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 170/237 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L K Y    VV  V L V  GEIVGLLGPNGAGKTT FYM+TG+I  +SG +  D
Sbjct: 4   LVAQNLCKSYKKRTVVDNVSLEVNKGEIVGLLGPNGAGKTTTFYMITGIIKPESGKVYCD 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
            ND+T  PM++RA LGI YL QE S+FR LTVEENI AVLE+     K++ E ++ L++E
Sbjct: 64  NNDVTTYPMFKRANLGIGYLAQEPSVFRNLTVEENIAAVLEMKGIAPKEQQEIIEKLMEE 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T  R  L   LSGG+RRR+EIAR++ + PS+ILLDEPFAGVDP+A+ DI  +IR L 
Sbjct: 124 FKLTHVRKSLGYSLSGGERRRIEIARTIANNPSFILLDEPFAGVDPIAVEDIQQIIRYLR 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           +RG+GILITDH+V E L + ++AYI+  G VL  GT +EI +++  R++YLG++F  
Sbjct: 184 NRGLGILITDHSVRETLRITEKAYIMANGKVLISGTPEEISNDETARKIYLGEKFKL 240


>gi|161523705|ref|YP_001578717.1| ABC transporter-like protein [Burkholderia multivorans ATCC 17616]
 gi|189351531|ref|YP_001947159.1| ABC-type transporter ATPase [Burkholderia multivorans ATCC 17616]
 gi|221199998|ref|ZP_03573041.1| ABC transporter, ATPase subunit [Burkholderia multivorans CGD2M]
 gi|221206847|ref|ZP_03579859.1| ABC transporter, ATPase subunit [Burkholderia multivorans CGD2]
 gi|221211205|ref|ZP_03584184.1| ABC transporter, ATPase subunit [Burkholderia multivorans CGD1]
 gi|160341134|gb|ABX14220.1| ABC transporter related [Burkholderia multivorans ATCC 17616]
 gi|189335553|dbj|BAG44623.1| ABC-type transport system ATPase component [Burkholderia
           multivorans ATCC 17616]
 gi|221168566|gb|EEE01034.1| ABC transporter, ATPase subunit [Burkholderia multivorans CGD1]
 gi|221173502|gb|EEE05937.1| ABC transporter, ATPase subunit [Burkholderia multivorans CGD2]
 gi|221180237|gb|EEE12641.1| ABC transporter, ATPase subunit [Burkholderia multivorans CGD2M]
          Length = 258

 Score =  261 bits (667), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 173/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 10  AGTTSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I ++G+ I+ +P+++RA LG+SYLPQEAS+FR LTVEENI AVLE+   D  KR  K 
Sbjct: 70  GEISLNGSSISLLPIHKRASLGLSYLPQEASVFRKLTVEENIRAVLELQHGDDGKRLSKD 129

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL E  I   R   A  LSGG+RRR+EIAR+L + PS+ILLDEPFAGVDP+A
Sbjct: 130 AIASRTEALLDELQIGHLRENPALSLSGGERRRVEIARALATNPSFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   EII+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPNEIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|227824356|ref|ZP_03989188.1| conserved hypothetical protein [Acidaminococcus sp. D21]
 gi|226904855|gb|EEH90773.1| conserved hypothetical protein [Acidaminococcus sp. D21]
          Length = 239

 Score =  261 bits (667), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 171/235 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           + A  L K+Y    VV  V L V  G IVGLLG NGAGKTT FYM+ GL   D G++ +D
Sbjct: 3   IRANDLVKEYGGRIVVDHVSLEVAQGSIVGLLGKNGAGKTTTFYMIVGLEHPDRGTVHLD 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             ++T +PMY+RA  GI YLPQEASIFR LTVEEN+LA+LE  E D KKR EK+++L++E
Sbjct: 63  ELEVTHLPMYKRALAGIGYLPQEASIFRKLTVEENLLAILEDVEPDGKKRQEKMEALIEE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F+I   R  L   LSGG+RRR+EIAR+L + P++ILLDEPFAG+DP+A++DI VL++ LA
Sbjct: 123 FHIGHIRKSLGTALSGGERRRVEIARALATEPAFILLDEPFAGIDPIAVADIQVLVKHLA 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            RGIG+LITDHNV E L+++D+AYI++ G ++  G  +++  +   R+ YLG  F
Sbjct: 183 KRGIGVLITDHNVRETLSIVDKAYILNEGKIMVEGPSEKVAADPIARKYYLGKDF 237


>gi|313675543|ref|YP_004053539.1| ABC transporter related protein [Marivirga tractuosa DSM 4126]
 gi|312942241|gb|ADR21431.1| ABC transporter related protein [Marivirga tractuosa DSM 4126]
          Length = 243

 Score =  261 bits (667), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 173/236 (73%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A +L KKY+   VV  + + V+ GEIVGLLGPNGAGKTT FYM+ GL+  +SG I +
Sbjct: 2   ILRAENLVKKYSKRTVVDHISVSVEQGEIVGLLGPNGAGKTTSFYMIVGLVKPNSGEIFL 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           D  +IT +PMY+RA+ G+ YL QEAS+FR LTVEEN++AVLE+ +  K  + EK++SLL 
Sbjct: 62  DEQNITGLPMYKRAKKGVGYLAQEASVFRSLTVEENLMAVLEMRKISKAAKKEKMESLLD 121

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF++   R     +LSGG+RRR EIAR+L   PS+ILLDEPFAGVDP+A+ +I  ++  L
Sbjct: 122 EFSLGHVRKNKGMVLSGGERRRTEIARALAMDPSFILLDEPFAGVDPIAVEEIQTIVGRL 181

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             + IGILITDHNV+E L++ DRAY++  G +L  GT +E+ +++ VRR+YLG  F
Sbjct: 182 KEKNIGILITDHNVNETLSITDRAYLMFEGKLLKAGTAEELANDEQVRRVYLGKHF 237


>gi|86136831|ref|ZP_01055409.1| ABC transporter, ATP-binding protein [Roseobacter sp. MED193]
 gi|85826155|gb|EAQ46352.1| ABC transporter, ATP-binding protein [Roseobacter sp. MED193]
          Length = 253

 Score =  261 bits (666), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 130/230 (56%), Positives = 172/230 (74%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K Y    V++ V + +  GE+V LLGPNG+GKTT FY + GLI  ++G++ IDG ++T
Sbjct: 21  LRKSYRKKVVIRDVSITLDRGEVVALLGPNGSGKTTSFYAIAGLIFPEAGTVTIDGQNVT 80

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITK 150
            +PMYRRARLGI YLPQE SIFRGL+VE+NI+AVL++  K   +R E+L+ LL +F+I  
Sbjct: 81  TLPMYRRARLGIGYLPQEMSIFRGLSVEDNIMAVLDIAVKHSHRRRERLEELLSDFSIEH 140

Query: 151 WRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIG 210
            R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+++ DI  L+ DL  RGIG
Sbjct: 141 LRRAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDPISVGDIRHLVADLKKRGIG 200

Query: 211 ILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +LITDHNV E L ++DRAYI+H G VL  GT  E+++N++VRR+YLGD F
Sbjct: 201 VLITDHNVRETLEIVDRAYILHDGQVLMSGTPAEVVENENVRRVYLGDNF 250


>gi|167585436|ref|ZP_02377824.1| ABC transporter related protein [Burkholderia ubonensis Bu]
          Length = 258

 Score =  261 bits (666), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 173/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 10  AGTSSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I ++G+ I+ +P+++RA LG+SYLPQEAS+FR LTVEENI AVLE+   D  KR  K 
Sbjct: 70  GEISLNGSSISLLPIHKRASLGLSYLPQEASVFRKLTVEENIRAVLELQHDDGGKRLSKD 129

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL E  I   R   A  LSGG+RRR+EIAR+L + PS+ILLDEPFAGVDP+A
Sbjct: 130 AIASRTEALLDELQIGHLRENPALSLSGGERRRVEIARALATNPSFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   EII+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGTVLAAGAPSEIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|187931652|ref|YP_001891636.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|187712561|gb|ACD30858.1| ABC transporter, ATP-binding protein [Francisella tularensis subsp.
           mediasiatica FSC147]
          Length = 243

 Score =  261 bits (666), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 130/238 (54%), Positives = 174/238 (73%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L KKY S +VV  V + V  GEIVGLLGPNGAGKTT FYM+ GL+ A  G +++ 
Sbjct: 6   LEAKRLGKKYGSRWVVNNVSMKVLTGEIVGLLGPNGAGKTTSFYMIVGLVAATRGKVRMG 65

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
             D+TKMP++ RAR G+ YLPQEAS+FR L+VE+NI+A+LE  +  +K +  EKL+ LL 
Sbjct: 66  QEDVTKMPIHLRARRGLGYLPQEASVFRKLSVEDNIVAILETRKDLNKIQIEEKLNELLD 125

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+I   R  L   LSGG+RRR+EIAR+L   P +ILLDEPFAGVDPV++ +I  ++R L
Sbjct: 126 EFSIQHIRKSLGISLSGGERRRVEIARALAMDPKFILLDEPFAGVDPVSVIEIKEVVRHL 185

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             RGIG+LITDHNV E L + +RAYI++AG +LA GT +E++ ++ VR++YLG+ F  
Sbjct: 186 KDRGIGVLITDHNVRETLDICERAYIVNAGNMLAAGTPEEVLADETVRKVYLGEDFKL 243


>gi|90580191|ref|ZP_01235998.1| putative ABC transporter, ATP-binding protein [Vibrio angustum S14]
 gi|90438493|gb|EAS63677.1| putative ABC transporter, ATP-binding protein [Vibrio angustum S14]
          Length = 241

 Score =  261 bits (666), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 175/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K YN   VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G I 
Sbjct: 2   AILKAEHLAKSYNGRKVVSDVSLEVESGKIVGLLGPNGAGKTTSFYMIVGLVARDEGVIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           IDG+DI+  PM+ R+R+GI YLPQEASIFR L+V +N++AVL+   E  K++R +K + L
Sbjct: 62  IDGDDISLQPMHNRSRMGIGYLPQEASIFRRLSVYDNLMAVLQTRKELTKEERQDKAEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EFNI   R+ L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LDEFNIQHIRNSLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + + AYI+  G ++A+GT + +++++ V+R+YLGD+F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEHAYIVSQGQLIANGTPEHVLNDEHVKRVYLGDQF 239


>gi|237741670|ref|ZP_04572151.1| ABC transporter ATP-binding protein [Fusobacterium sp. 4_1_13]
 gi|294785719|ref|ZP_06751007.1| ABC transporter, ATP-binding protein [Fusobacterium sp. 3_1_27]
 gi|229429318|gb|EEO39530.1| ABC transporter ATP-binding protein [Fusobacterium sp. 4_1_13]
 gi|294487433|gb|EFG34795.1| ABC transporter, ATP-binding protein [Fusobacterium sp. 3_1_27]
          Length = 241

 Score =  261 bits (666), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 170/235 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LSA +L K Y    VV  V L V  GEIVGLLGPNGAGKTT FYM+TG++  DSG +   
Sbjct: 4   LSADNLVKTYKKRKVVDRVSLEVNKGEIVGLLGPNGAGKTTTFYMITGIVKPDSGEVMCA 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             DIT +PMY+RA +GI YL QE S+FR LTVEENI  VLE+ +  KKK+ E +D LL+E
Sbjct: 64  EQDITNLPMYKRADMGIGYLAQEPSVFRNLTVEENIEVVLEMKKISKKKQKETVDRLLEE 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T  R  L   LSGG+RRR+EIAR++ + PS+ILLDEPFAGVDP+A+ DI  +IR L 
Sbjct: 124 FKLTHVRDSLGYSLSGGERRRIEIARTIANNPSFILLDEPFAGVDPIAVEDIQNIIRHLK 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            R +GILITDHNV E L++ D++YI+  G VL  GT +EI +N + RR+YLG++F
Sbjct: 184 KRDLGILITDHNVRETLSITDKSYIMAKGKVLLEGTPREIANNPEARRIYLGEKF 238


>gi|62258400|gb|AAX77788.1| unknown protein [synthetic construct]
          Length = 278

 Score =  261 bits (666), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 130/238 (54%), Positives = 174/238 (73%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L KKY S +VV  V + V  GEIVGLLGPNGAGKTT FYM+ GL+ A  G +++ 
Sbjct: 32  LEAKRLGKKYGSRWVVNNVSMKVSTGEIVGLLGPNGAGKTTSFYMIVGLVAATRGKVRMG 91

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
             D+TKMP++ RAR G+ YLPQEAS+FR L+VE+NI+A+LE  +  +K +  EKL+ LL 
Sbjct: 92  QEDVTKMPIHLRARRGLGYLPQEASVFRKLSVEDNIVAILETRKDLNKIQIEEKLNELLD 151

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+I   R  L   LSGG+RRR+EIAR+L   P +ILLDEPFAGVDPV++ +I  ++R L
Sbjct: 152 EFSIQHIRKSLGMSLSGGERRRVEIARALAMDPKFILLDEPFAGVDPVSVIEIKEVVRHL 211

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             RGIG+LITDHNV E L + +RAYI++AG +LA GT +E++ ++ VR++YLG+ F  
Sbjct: 212 KDRGIGVLITDHNVRETLDICERAYIVNAGNMLAAGTPEEVLADETVRKVYLGEDFKL 269


>gi|126668776|ref|ZP_01739724.1| ABC transporter, ATP-binding protein [Marinobacter sp. ELB17]
 gi|126626759|gb|EAZ97408.1| ABC transporter, ATP-binding protein [Marinobacter sp. ELB17]
          Length = 241

 Score =  261 bits (666), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 170/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A +L K Y    VV  V L ++ GEIVGLLGPNGAGKTT FYM+ GL+ AD G I 
Sbjct: 2   AVLRASNLAKSYKQKKVVIDVSLEIRSGEIVGLLGPNGAGKTTCFYMIVGLVQADHGRIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKK-KRHEKLDSL 142
           ID  DIT +PM+ RAR GI YLPQEAS+FR L+V +NI+A+LE  +  K+ +R  KL+ L
Sbjct: 62  IDNQDITPLPMHGRARKGIGYLPQEASVFRKLSVRDNIMAILETRKSMKRAEREAKLEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EF+I   R  +   LSGG+RRR+EIAR+L   P++ILLDEPFAGVDP+++SDI  +IR
Sbjct: 122 LAEFHINHIRDSMGMALSGGERRRVEIARALAMEPAFILLDEPFAGVDPISVSDIKQIIR 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  +GIG+LITDHNV + L + + AYI+  G ++A G+  EI  NQ V+ +YLG+ F
Sbjct: 182 HLRDKGIGVLITDHNVRDTLDICENAYIVSGGHIIASGSSAEIFGNQQVKEVYLGNEF 239


>gi|261868143|ref|YP_003256065.1| ABC transporter ATP-binding protein [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|293391916|ref|ZP_06636250.1| ABC transporter, ATP-binding protein [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|261413475|gb|ACX82846.1| ABC transporter, ATP-binding protein [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|290952450|gb|EFE02569.1| ABC transporter, ATP-binding protein [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 241

 Score =  261 bits (666), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 176/241 (73%), Gaps = 3/241 (1%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A +L K Y +  VV  V L V  GEIVGLLGPNGAGKTT FYM+ GL+  D G I+
Sbjct: 2   AILYAENLAKSYKNRQVVSDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGLVNHDQGKIR 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKK--KRHEKLDS 141
           ID  DI+ +PM+ RA+ GI YLPQEASIFR L+V +N++AVLE+  KD    +R E+ D 
Sbjct: 62  IDEEDISLLPMHNRAQKGIGYLPQEASIFRRLSVYDNLMAVLEI-RKDLTALQRRERADE 120

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           L++EFNI+  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I
Sbjct: 121 LIEEFNISHIRDNLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKII 180

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
           +DL  RG+G+LITDHNV E L + +RAYI+ AG ++A GT QEI++N+ V+ +YLG  F 
Sbjct: 181 KDLRDRGLGVLITDHNVRETLDVCERAYIVSAGKMIATGTPQEIMNNKLVKDVYLGADFQ 240

Query: 262 F 262
            
Sbjct: 241 L 241


>gi|254515276|ref|ZP_05127337.1| ABC-type (unclassified) transport system, ATPase component [gamma
           proteobacterium NOR5-3]
 gi|219677519|gb|EED33884.1| ABC-type (unclassified) transport system, ATPase component [gamma
           proteobacterium NOR5-3]
          Length = 241

 Score =  261 bits (666), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 173/238 (72%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L+A +L K Y    VVK V L V+  ++VGLLGPNGAGKTT FYM+ G++ +D+G I 
Sbjct: 2   ATLTASNLAKAYRGRAVVKDVSLEVQSAQVVGLLGPNGAGKTTCFYMIVGIVPSDAGDIC 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID   IT +PM+ RAR GI YLPQEASIFR +TV +NILA+LE  +   + +R+++ D L
Sbjct: 62  IDDQSITALPMHERARRGIGYLPQEASIFRRMTVGDNILAILETRKDLSRDERNKRRDEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF++   +  L   LSGG+RRR+EIAR+L   P +ILLDEPFAGVDP+++ DI  +IR
Sbjct: 122 LEEFHVGHLKESLGQALSGGERRRVEIARALAMEPKFILLDEPFAGVDPISVGDIKNIIR 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L +RGIG+LITDHNV E L + + AYI+  G ++A G+ QE++DN  VR++YLG+ F
Sbjct: 182 HLQTRGIGVLITDHNVRETLDICETAYIVGEGHIIAQGSPQEVLDNAKVRKVYLGENF 239


>gi|303236803|ref|ZP_07323382.1| ABC transporter, ATP-binding protein [Prevotella disiens
           FB035-09AN]
 gi|302482971|gb|EFL45987.1| ABC transporter, ATP-binding protein [Prevotella disiens
           FB035-09AN]
          Length = 281

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 128/242 (52%), Positives = 168/242 (69%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
            K S+L    L K+Y    V  GV + V+ GEIVGLLGPNGAGKTT FYM TGL+  + G
Sbjct: 18  EKSSILRTEGLVKRYGKRTVANGVSINVRQGEIVGLLGPNGAGKTTSFYMTTGLVIPNEG 77

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLD 140
            + ID  +IT  P+Y+RA+ GI YLPQEAS+FR ++VE+NI++VLE+ +  K++R EK++
Sbjct: 78  HVYIDEQEITNYPVYKRAKAGIGYLPQEASVFRKMSVEDNIMSVLEMTKLTKEQRIEKME 137

Query: 141 SLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVL 200
           SL+KEF + K R  L   LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  +
Sbjct: 138 SLIKEFRLEKVRKNLGDRLSGGERRRCEIARCLAIDPKFIMLDEPFAGVDPIAVEDIQHI 197

Query: 201 IRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +  L  R IGILITDHNVHE L + DRAY++  G +L  GT +E+  N+ V+  YLG  F
Sbjct: 198 VWRLKFRNIGILITDHNVHETLNITDRAYLLFEGQILFKGTPEELAANKIVKEKYLGTDF 257

Query: 261 AF 262
             
Sbjct: 258 VL 259


>gi|30248094|ref|NP_840164.1| ABC transporter ATPase [Nitrosomonas europaea ATCC 19718]
 gi|30179979|emb|CAD83974.1| ATPase component ABC-type (unclassified) transport system
           [Nitrosomonas europaea ATCC 19718]
          Length = 240

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 132/237 (55%), Positives = 172/237 (72%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A +L K Y S  VV  V   V+ GE+VGLLGPNGAGKTT FYM+ GL+  + G I 
Sbjct: 2   SELRAENLKKSYQSRTVVTDVSFSVRSGEVVGLLGPNGAGKTTCFYMVVGLVPLNGGEIF 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +D ++++++P+++RARLG+SYLPQEAS+FR L+VEEN+LAVLE+ +  K +    LD LL
Sbjct: 62  LDEHNLSRLPIHQRARLGLSYLPQEASVFRRLSVEENVLAVLELQQLQKDEIQRYLDELL 121

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + +I+  R      LSGG+RRR+EIAR+L S P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 122 HDLHISHLRESSGMSLSGGERRRVEIARALASRPRFILLDEPFAGVDPIAVMDIQRVISF 181

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L SRGIG+LITDHNV E L + DRAYII  G VLA+G   EII ++ VR +YLG+ F
Sbjct: 182 LKSRGIGVLITDHNVRETLRICDRAYIISGGTVLANGAPAEIITDERVREVYLGENF 238


>gi|307728394|ref|YP_003905618.1| ABC transporter-like protein [Burkholderia sp. CCGE1003]
 gi|307582929|gb|ADN56327.1| ABC transporter related protein [Burkholderia sp. CCGE1003]
          Length = 261

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 135/247 (54%), Positives = 173/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 13  AGTSSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 72

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I +DG  I+ +P+++RA LG+SYLPQEAS+FR L+VEENI AVL++  ++  KR  K 
Sbjct: 73  GDIDLDGKSISLLPIHKRASLGLSYLPQEASVFRKLSVEENIRAVLQLQHEENGKRLSKD 132

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL E  I   R   A  LSGG+RRR+EIAR+L + PS+ILLDEPFAGVDP+A
Sbjct: 133 AITSRTEALLDELQIAHLRENPALSLSGGERRRVEIARALATNPSFILLDEPFAGVDPIA 192

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   EII+N+ VRR
Sbjct: 193 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPSEIIENESVRR 252

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 253 VYLGEHF 259


>gi|268590746|ref|ZP_06124967.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Providencia rettgeri DSM 1131]
 gi|291313519|gb|EFE53972.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Providencia rettgeri DSM 1131]
          Length = 241

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 176/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L+A +L K Y    VV+ V L VK GEIVGLLGPNGAGKTT FYM+ G++  D+G I 
Sbjct: 2   ATLTAENLAKAYKKRKVVEDVSLEVKSGEIVGLLGPNGAGKTTTFYMVVGIVQRDAGKIM 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           IDG DI+ +P++ RAR GI YLPQEASIFR L+V +N++AVLE+ E    ++R E+ + L
Sbjct: 62  IDGEDISLLPLHERARRGIGYLPQEASIFRRLSVHDNLMAVLEIREDLSSQQRKERAEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+IT  R  +   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I+
Sbjct: 122 MEEFSITHLRDSMGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVLDIKKIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHG+   I++N+ V+R+YLG+ F
Sbjct: 182 HLRDYGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGSPTMILENEQVKRVYLGEGF 239


>gi|116690810|ref|YP_836433.1| ABC transporter related [Burkholderia cenocepacia HI2424]
 gi|170734135|ref|YP_001766082.1| ABC transporter-like protein [Burkholderia cenocepacia MC0-3]
 gi|254247187|ref|ZP_04940508.1| ABC transporter [Burkholderia cenocepacia PC184]
 gi|116648899|gb|ABK09540.1| ABC transporter related protein [Burkholderia cenocepacia HI2424]
 gi|124871963|gb|EAY63679.1| ABC transporter [Burkholderia cenocepacia PC184]
 gi|169817377|gb|ACA91960.1| ABC transporter related [Burkholderia cenocepacia MC0-3]
          Length = 258

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 173/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 10  AGTTSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPTDA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I ++G+ I+ +P+++RA LG+SYLPQEAS+FR LTVEENI AVLE+   +  KR  K 
Sbjct: 70  GEISLNGSSISLLPIHKRASLGLSYLPQEASVFRKLTVEENIRAVLELQHGEDGKRLSKD 129

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL E  I   R   A  LSGG+RRR+EIAR+L + PS+ILLDEPFAGVDP+A
Sbjct: 130 AISSRTEALLDELQIGHLRENPALSLSGGERRRVEIARALATNPSFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   EII+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPSEIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|193214751|ref|YP_001995950.1| ABC transporter-like protein [Chloroherpeton thalassium ATCC 35110]
 gi|193088228|gb|ACF13503.1| ABC transporter-related protein [Chloroherpeton thalassium ATCC
           35110]
          Length = 250

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 159/212 (75%)

Query: 51  GEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEAS 110
           GEIVGLLGPNGAGKTT FYM+ GLI  D G + +D   IT  PMY+RARLG+ YLPQE S
Sbjct: 36  GEIVGLLGPNGAGKTTTFYMIVGLISPDGGDVFLDNRVITDFPMYKRARLGVGYLPQEPS 95

Query: 111 IFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIA 170
           +FR L+VE+NIL+VLE     +K + E+++ LL++FNIT  R  +   LSGG+RRR EIA
Sbjct: 96  VFRQLSVEQNILSVLEYSTLSRKAQKERMEKLLEDFNITHIRKSMGYALSGGERRRTEIA 155

Query: 171 RSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYI 230
           R+L + P +ILLDEPFAGVDP+A+ DI  ++ DL +R IG+LITDHNVHE L++ DRAY+
Sbjct: 156 RALATEPKFILLDEPFAGVDPIAVEDIQHIVADLKTRNIGVLITDHNVHETLSITDRAYL 215

Query: 231 IHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           +  G +L  GT +E+  ++  R+LYLG++F+ 
Sbjct: 216 LFEGNILMQGTAEELASSEQARKLYLGEKFSL 247


>gi|187922604|ref|YP_001894246.1| ABC transporter [Burkholderia phytofirmans PsJN]
 gi|187713798|gb|ACD15022.1| ABC transporter related [Burkholderia phytofirmans PsJN]
          Length = 261

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 135/247 (54%), Positives = 173/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 13  AGTSSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 72

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I +DG  I+ +P+++RA LG+SYLPQEAS+FR L+VEENI AVLE+  ++  KR  K 
Sbjct: 73  GEIDLDGKSISLLPIHKRASLGLSYLPQEASVFRKLSVEENIRAVLELQHEENGKRLSKD 132

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL E  I   R   A  LSGG+RRR+EIAR+L + PS+ILLDEPFAGVDP+A
Sbjct: 133 AITNRTEALLDELQIAHLRENPALSLSGGERRRVEIARALATNPSFILLDEPFAGVDPIA 192

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   +II+N+ VRR
Sbjct: 193 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPSDIIENESVRR 252

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 253 VYLGEHF 259


>gi|225872295|ref|YP_002753750.1| ABC transporter, ATP-binding protein [Acidobacterium capsulatum
           ATCC 51196]
 gi|225791426|gb|ACO31516.1| ABC transporter, ATP-binding protein [Acidobacterium capsulatum
           ATCC 51196]
          Length = 242

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 170/238 (71%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LS   +TK Y    VV+GV + V  GE+VGLLGPNGAGKTT FYM  GLI  DSG I +D
Sbjct: 4   LSTDEITKSYKGRQVVRGVSVEVLQGEVVGLLGPNGAGKTTSFYMTVGLIQPDSGRIFVD 63

Query: 86  GNDITKMPMYRRAR-LGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
             +IT++PMY RAR  GISYLPQE S+FR LTVEENILAVLEV    ++ R  + + L+ 
Sbjct: 64  DQEITRVPMYLRARQYGISYLPQEPSVFRKLTVEENILAVLEVQPIPQEARRARTEKLID 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           + NI   R      LSGG+RRR+EIARSL   PS+ILLDEPF+G+DP+A+ D+  +I +L
Sbjct: 124 QLNIGHIRKTRGYALSGGERRRVEIARSLCIQPSFILLDEPFSGIDPIAVLDLQKIIFEL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            + GIG+LITDHNV E L++ DRAYII+ G +  HGT +E+  + +VRR+YLG+ F+ 
Sbjct: 184 KASGIGVLITDHNVRETLSVTDRAYIINEGKIFRHGTPEELGSDPEVRRVYLGEGFSL 241


>gi|88798180|ref|ZP_01113766.1| ABC-type (unclassified) transport system, ATPase component
           [Reinekea sp. MED297]
 gi|88778956|gb|EAR10145.1| ABC-type (unclassified) transport system, ATPase component
           [Reinekea sp. MED297]
          Length = 241

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 173/238 (72%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           +LL A +L K Y    VV+ V L V+  +IVGLLGPNGAGKTT FYM+ GL+ AD GS++
Sbjct: 2   ALLEARNLAKSYKRRPVVQDVSLAVEEAQIVGLLGPNGAGKTTCFYMIVGLVAADKGSVQ 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           IDG D+T  PM+ RA+ GI YLPQEASIFR L+VE+NILAVL+  +  ++ ++ E++++L
Sbjct: 62  IDGIDVTAQPMHARAKRGIGYLPQEASIFRKLSVEDNILAVLQTRKDINRAEQRERMEAL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF++T  R  L   LSGG+RRR+EIAR+L   P  +LLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LEEFSVTHIRKSLGMALSGGERRRVEIARALAMEPKVVLLDEPFAGVDPISVGDIKEIIY 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  R I +LITDHNV E L + ++AYI+ +G ++A G    ++ NQ VR +YLGD+F
Sbjct: 182 HLQQRKIAVLITDHNVRETLDICEKAYIVGSGHIIAEGNADAVLSNQTVREVYLGDQF 239


>gi|261855365|ref|YP_003262648.1| ABC transporter [Halothiobacillus neapolitanus c2]
 gi|261835834|gb|ACX95601.1| ABC transporter related protein [Halothiobacillus neapolitanus c2]
          Length = 247

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 173/243 (71%), Gaps = 1/243 (0%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
           +   +L A SL K Y +  VV+GV L V  GEIVGLLGPNGAGKTT FYM+ GL+ AD G
Sbjct: 5   TTKPILVAESLVKHYGARAVVQGVSLEVNAGEIVGLLGPNGAGKTTSFYMIVGLVAADQG 64

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKL 139
            I ++G DIT MP+ +RA++G+ YLPQEAS+FR LTVE+NIL VLE+     + ++ ++L
Sbjct: 65  QIWLNGRDITLMPVNQRAQMGLGYLPQEASVFRKLTVEQNILGVLELRRDLTRAQQRDEL 124

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL+E +I   R      LSGG+RRR+EIAR+L + P  ILLDEPFAGVDP+++ DI  
Sbjct: 125 EGLLQELHIRAIRRSSGQSLSGGERRRVEIARALAANPRVILLDEPFAGVDPISVIDIQR 184

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           +I  L +RGI +LITDHNV E L + +RAYI+  G +LA G+ Q+I+DN  VR +YLG+ 
Sbjct: 185 IIHHLKARGIAVLITDHNVRETLGVCERAYIVSDGKILAEGSPQDILDNPQVRAVYLGEH 244

Query: 260 FAF 262
           F  
Sbjct: 245 FTL 247


>gi|312797343|ref|YP_004030265.1| ABC transporter ATP-binding protein [Burkholderia rhizoxinica HKI
           454]
 gi|312169118|emb|CBW76121.1| ABC transporter ATP-binding protein [Burkholderia rhizoxinica HKI
           454]
          Length = 259

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 135/243 (55%), Positives = 173/243 (71%), Gaps = 6/243 (2%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S LS  +L K+Y +  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+G I 
Sbjct: 15  STLSVRNLRKRYGARTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDAGEIM 74

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK----- 138
           +D   I+ +P+++RAR+G+SYLPQEAS+FR L+V ENI AVLE+   ++ K   K     
Sbjct: 75  LDDTSISLLPIHKRARMGLSYLPQEASVFRKLSVNENIRAVLELQLDERGKPLSKQAVSA 134

Query: 139 -LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDI 197
             D+LL+E  I   R   A  LSGG+RRR+EIAR+L + PS+ILLDEPFAGVDP+A+ +I
Sbjct: 135 RADALLEELQIAHLRDNPAMSLSGGERRRVEIARALATRPSFILLDEPFAGVDPIAVLEI 194

Query: 198 HVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLG 257
             ++R L  RGIG+LITDHNV E L + D AYII  G VLA G  +EII N+ VRR+YLG
Sbjct: 195 QKIVRFLKERGIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPKEIIANESVRRVYLG 254

Query: 258 DRF 260
           + F
Sbjct: 255 EHF 257


>gi|254369371|ref|ZP_04985383.1| ABC transporter [Francisella tularensis subsp. holarctica FSC022]
 gi|157122321|gb|EDO66461.1| ABC transporter [Francisella tularensis subsp. holarctica FSC022]
          Length = 243

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 173/238 (72%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L KKY S +VV  V + V  GEIVGLLGPNGAGKTT FYM+ GL+ A  G +++ 
Sbjct: 6   LEAKRLGKKYGSRWVVNNVSMKVSTGEIVGLLGPNGAGKTTSFYMIVGLVAATRGKVRMG 65

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
             D+TKMP++ RAR G+ YLPQEAS+FR L+VE+NI+A+LE  +  +K +  EKL+ LL 
Sbjct: 66  QEDVTKMPIHLRARRGLGYLPQEASVFRKLSVEDNIVAILETRKDLNKIQIEEKLNELLD 125

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+I   R  L   LSGG+RRR+EIAR+L   P +ILLDEPFAGVDPV++ +I  ++R L
Sbjct: 126 EFSIQHIRKSLGMSLSGGERRRVEIARALAMDPKFILLDEPFAGVDPVSVIEIKEVVRHL 185

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             RGIG+LITDHNV E L + +RAYI++ G +LA GT +E++ ++ VR++YLG+ F  
Sbjct: 186 KDRGIGVLITDHNVRETLDICERAYIVNGGNMLAAGTPEEVLADETVRKVYLGEDFKL 243


>gi|317494040|ref|ZP_07952456.1| ABC transporter [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917813|gb|EFV39156.1| ABC transporter [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 241

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 175/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A +L K Y    VV+ V L V  GEIVGLLGPNGAGKTT FYM+ G++  D+G I+
Sbjct: 2   ATLIAENLAKAYKGRRVVENVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGRIE 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V  N++AVLE+ +   K++R ++ D L
Sbjct: 62  IDDEDISLLPLHARARRGIGYLPQEASIFRRLSVYNNLMAVLEIRDDLTKEQRADRADEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+I   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 MEEFHIAHLRDNLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + +RAYI++ G ++AHGT  EI+D++ V+R+YLG+ F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCERAYIVNQGNLIAHGTPSEILDDEQVKRVYLGEEF 239


>gi|206559207|ref|YP_002229968.1| ABC transporter ATP-binding protein [Burkholderia cenocepacia
           J2315]
 gi|198035245|emb|CAR51120.1| ABC transporter ATP-binding protein [Burkholderia cenocepacia
           J2315]
          Length = 258

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 173/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 10  AGTTSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPTDA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I ++G+ I+ +P+++RA LG+SYLPQEAS+FR LTVEENI AVLE+   +  KR  K 
Sbjct: 70  GEITLNGSSISLLPIHKRASLGLSYLPQEASVFRKLTVEENIRAVLELQHDEDGKRLSKD 129

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL E  I   R   A  LSGG+RRR+EIAR+L + PS+ILLDEPFAGVDP+A
Sbjct: 130 AISSRTEALLDELQIGHLRENPALSLSGGERRRVEIARALATNPSFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   EII+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPSEIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|194364733|ref|YP_002027343.1| ABC transporter-like protein [Stenotrophomonas maltophilia R551-3]
 gi|194347537|gb|ACF50660.1| ABC transporter related [Stenotrophomonas maltophilia R551-3]
          Length = 239

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 165/239 (69%), Gaps = 1/239 (0%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L K+Y    VVK   L +  GE+VGLLGPNGAGKTT FYM+ GL+ AD+GSI +
Sbjct: 1   MLVAKGLRKRYKQREVVKDFGLTLDAGEVVGLLGPNGAGKTTCFYMIVGLVAADAGSIVL 60

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLL 143
           DG DIT  PMY RA+ G+ YLPQE S+FR L+V +NI  VLE+ E  D K R  +L+SLL
Sbjct: 61  DGKDITGDPMYTRAKQGVGYLPQEPSVFRKLSVADNIRLVLELREDLDSKGRERELNSLL 120

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            E  +      L   LSGG+RRR EIAR+L + P  ILLDEPFAGVDP+++ +I  ++  
Sbjct: 121 DELQLGHVADQLGASLSGGERRRCEIARALAAQPRLILLDEPFAGVDPISVGEIQRIVTH 180

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  RGIG+LITDHNV E L + DRAYI+  G VLA G+ + I+DN DVRR+YLGD F  
Sbjct: 181 LKQRGIGVLITDHNVRETLGICDRAYILAEGSVLAQGSPEAILDNADVRRVYLGDSFKL 239


>gi|54113921|gb|AAV29594.1| NT02FT0199 [synthetic construct]
          Length = 243

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 174/238 (73%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L KKY S +VV  V + V  GEIVGLLGPNGAGKTT FYM+ GL+ A  G +++ 
Sbjct: 6   LEAKRLGKKYGSRWVVNNVSMKVSTGEIVGLLGPNGAGKTTSFYMIVGLVAATRGKVRMG 65

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
             D+TKMP++ RAR G+ YLPQEAS+FR L+VE+NI+A+LE  +  +K +  EKL+ LL 
Sbjct: 66  QEDVTKMPIHLRARRGLGYLPQEASVFRKLSVEDNIVAILETRKDLNKIQIEEKLNELLD 125

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+I   R  L   LSGG+RRR+EIAR+L   P +ILLDEPFAGVDPV++ +I  ++R L
Sbjct: 126 EFSIQHIRKSLGMSLSGGERRRVEIARALAMDPKFILLDEPFAGVDPVSVIEIKEVVRHL 185

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             RGIG+LITDHNV E L + +RAYI++AG +LA GT +E++ ++ VR+++LG+ F  
Sbjct: 186 KDRGIGVLITDHNVRETLDICERAYIVNAGNMLAAGTPEEVLADETVRKVHLGEDFKL 243


>gi|226329336|ref|ZP_03804854.1| hypothetical protein PROPEN_03241 [Proteus penneri ATCC 35198]
 gi|225202522|gb|EEG84876.1| hypothetical protein PROPEN_03241 [Proteus penneri ATCC 35198]
          Length = 241

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 177/238 (74%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           +LL A +L K Y    VV  V L V  GEIVGLLGPNGAGKTT FYM+ G++  D+GSI 
Sbjct: 2   ALLKAENLAKAYKGRTVVGDVSLNVNSGEIVGLLGPNGAGKTTTFYMVVGIVARDAGSIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID  DIT +P++ RAR GI YLPQEASIFR L+V +NI+ +LE+ ++   ++R ++ + L
Sbjct: 62  IDDEDITLLPLHERARKGIGYLPQEASIFRRLSVYDNIMGILEIRHDLTPEERKDRAEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EFN++  R+ L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I+
Sbjct: 122 LEEFNVSHLRNSLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVLDIKKIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHG+ +EI++N+ V+R+YLG+ F
Sbjct: 182 HLRDYGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGSPEEILENEQVKRVYLGEGF 239


>gi|257452891|ref|ZP_05618190.1| ABC transporter ATP-binding protein [Fusobacterium sp. 3_1_5R]
 gi|317059433|ref|ZP_07923918.1| ABC transporter ATP-binding protein [Fusobacterium sp. 3_1_5R]
 gi|313685109|gb|EFS21944.1| ABC transporter ATP-binding protein [Fusobacterium sp. 3_1_5R]
          Length = 241

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 130/237 (54%), Positives = 169/237 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L+A +L K Y    VV  V L V  GEIVGLLGPNGAGKTT FYM+TG+I  ++GS+  +
Sbjct: 4   LTARNLVKAYKQRKVVDSVSLEVNKGEIVGLLGPNGAGKTTTFYMITGIIKPNAGSVICN 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G +IT  PMY+RA LGI YL QE S+FR LTVE+NI AVLE+    KK++ E +D LL+E
Sbjct: 64  GEEITSYPMYKRANLGIGYLAQEPSVFRNLTVEDNIRAVLEMKHYGKKEQKEMVDKLLEE 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T     L   LSGG+RRR+EIAR++ + PS+ILLDEPFAGVDP+A+ DI   IR L 
Sbjct: 124 FKLTHVYESLGYSLSGGERRRVEIARTIANNPSFILLDEPFAGVDPIAVEDIQQSIRYLQ 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RG+GILITDH+V E L + ++AYI+  G V+  G+ QEI +N+  R++YLG+ F  
Sbjct: 184 KRGLGILITDHSVRETLNITEKAYIMAQGKVIISGSPQEISENEMARKIYLGENFKL 240


>gi|255605940|ref|XP_002538475.1| abc transporter, putative [Ricinus communis]
 gi|223511957|gb|EEF23907.1| abc transporter, putative [Ricinus communis]
          Length = 248

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 167/235 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L    L K Y    VVK   L +  GE++GLLGPNGAGKTT FYM+ GL+  D GSI ++
Sbjct: 12  LRVSHLKKAYQGRTVVKNTTLELHSGEVIGLLGPNGAGKTTSFYMIVGLVALDDGSITLN 71

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G D++  PM+ RAR+G++YLPQEASIFR +TV +NIL++LE     +++R  +L+SLL +
Sbjct: 72  GADVSHSPMHERARMGLAYLPQEASIFRKMTVTDNILSILETRPYTEEEREVRLESLLDQ 131

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
            +I   RH  A  LSGG+RRR+EIAR L + P +ILLDEPFAG+DP+A+ +I  +IR L+
Sbjct: 132 LHIQHIRHSQAVSLSGGERRRVEIARCLATDPKFILLDEPFAGIDPIAVIEIQKIIRYLS 191

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           S+ IGILITDHNV E L + DRAYI++ G V A GT  EII N+ VR +YLG  F
Sbjct: 192 SQNIGILITDHNVRETLDICDRAYIVNEGAVFAAGTPDEIIQNEGVREVYLGKNF 246


>gi|322514082|ref|ZP_08067153.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Actinobacillus ureae ATCC
           25976]
 gi|322120099|gb|EFX92070.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Actinobacillus ureae ATCC
           25976]
          Length = 241

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 175/238 (73%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y +  VVK V L VK GEIVGLLGPNGAGKTT FYM+ GL+  D G I+ID
Sbjct: 4   LYAEHLAKSYKNRQVVKDVSLNVKAGEIVGLLGPNGAGKTTTFYMVVGLVRYDQGKIRID 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
             DI+ +PM+ RA+ GI YLPQEASIFR L+V +N++AVL+V +  + ++R  + + L+ 
Sbjct: 64  DEDISVLPMHDRAKQGIGYLPQEASIFRRLSVYDNLMAVLQVRKDLNNQQRKARAEELIN 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+I+  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I +L
Sbjct: 124 EFHISHIRDSLGQSLSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIVNL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             RG+G+LITDHNV E L + +RAYI+ +G ++A GT  E+++N DV+R+YLGD+F  
Sbjct: 184 KERGLGVLITDHNVRETLDVCERAYIVGSGQMIASGTPAEVLNNPDVKRVYLGDQFKL 241


>gi|260429192|ref|ZP_05783169.1| ABC transporter, ATP-binding protein [Citreicella sp. SE45]
 gi|260419815|gb|EEX13068.1| ABC transporter, ATP-binding protein [Citreicella sp. SE45]
          Length = 252

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 172/238 (72%)

Query: 23  DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSI 82
           DS L    L K Y    V++ V L +  GE+V LLGPNG+GKTT FY + GL+  + G +
Sbjct: 12  DSGLRVRHLRKSYRKRVVIRDVTLELDRGEVVALLGPNGSGKTTTFYAVAGLVNPEGGQV 71

Query: 83  KIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSL 142
            IDG D T +PMYRRARLGI YLPQE SIFRGLTVE+NI +VL++   D+ +R E+L+ L
Sbjct: 72  TIDGRDATWLPMYRRARLGIGYLPQEMSIFRGLTVEDNIASVLDIALNDRHRRRERLEEL 131

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EF+I   R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP++++DI  L+ 
Sbjct: 132 LGEFSIEHLRRAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDPISVNDIRHLVA 191

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           DL  RGIG+LITDHNV E L ++DRAYI+H G VL  GT  E++ N++VRR+YLG+ F
Sbjct: 192 DLKKRGIGVLITDHNVRETLEIVDRAYILHDGKVLMSGTPAEVVQNENVRRVYLGENF 249


>gi|146281418|ref|YP_001171571.1| ABC transporter ATP-binding protein [Pseudomonas stutzeri A1501]
 gi|145569623|gb|ABP78729.1| probable ATP-binding component of ABC transporter [Pseudomonas
           stutzeri A1501]
 gi|327479595|gb|AEA82905.1| ABC transporter ATP-binding protein [Pseudomonas stutzeri DSM 4166]
          Length = 241

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 171/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K Y S  VV+ V L ++ G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   AVLKAQHLAKSYKSRQVVRDVSLSIESGQIVGLLGPNGAGKTTCFYMIVGLVNADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID ND+T +PM+ RAR GI YLPQEASIFR L+V +NI+A+LE  +  D+  R + L+ L
Sbjct: 62  IDQNDVTHLPMHGRARAGIGYLPQEASIFRKLSVADNIMAILETRKDLDRGGRQQALEGL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHINHIRDSLGMSLSGGERRRVEIARALATAPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIG+LITDHNV E L + + AYI++ G ++A G  Q I+ NQ V+ +YLG  F
Sbjct: 182 HLKAKGIGVLITDHNVRETLDICETAYIVNDGQLIAEGDAQSILANQLVKEVYLGHEF 239


>gi|332978295|gb|EGK15023.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Psychrobacter sp. 1501(2011)]
          Length = 281

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 123/241 (51%), Positives = 174/241 (72%), Gaps = 1/241 (0%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
           + D+ L+  +L K+Y   +VVK V   V+PG++VGLLGPNGAGKTT FYM+ GL+  D G
Sbjct: 39  ASDTALTMRNLAKRYGKRWVVKDVSFSVEPGQVVGLLGPNGAGKTTSFYMVVGLVNMDKG 98

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKL 139
            +K+   D++K  M+ RAR GI YLPQEASIFR L+VE+NILA+L+  +  DK  + ++L
Sbjct: 99  IVKLGNQDLSKYAMHERARAGIGYLPQEASIFRKLSVEDNILAILQTRKDLDKAAQKQQL 158

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + L+ +F++   RH L   +SGG+RRR EIAR+L + P +ILLDEPFAGVDP+++SDI  
Sbjct: 159 EKLISDFSLGHVRHSLGMSVSGGERRRCEIARALAADPKFILLDEPFAGVDPISVSDIKE 218

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           +I  L  RGIG+LITDHNV E L + + AYI+  G ++AHG+ +E+++N  V+ +YLG  
Sbjct: 219 VIIALKDRGIGVLITDHNVRETLAICEHAYIVSEGAIIAHGSSEEVLNNTLVKEVYLGKD 278

Query: 260 F 260
           F
Sbjct: 279 F 279


>gi|293608598|ref|ZP_06690901.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292829171|gb|EFF87533.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325121588|gb|ADY81111.1| putative transport protein (ABC superfamily, ATP-bind)
           [Acinetobacter calcoaceticus PHEA-2]
          Length = 247

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 126/245 (51%), Positives = 173/245 (70%), Gaps = 1/245 (0%)

Query: 18  NRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICA 77
            +A +   L    L K Y+  +VVK V   ++ G+IVGLLGPNGAGKTT FYM+ GL+  
Sbjct: 2   QQALQPQTLCIKHLAKNYSKRWVVKDVSFSMQSGQIVGLLGPNGAGKTTSFYMVVGLVRM 61

Query: 78  DSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRH 136
           D G I +D  D++ + M+ RAR GI YLPQEASIFR LT+ ENI+++LE  +  +K++R 
Sbjct: 62  DKGEIHLDDLDMSDLAMHERARKGIGYLPQEASIFRKLTIAENIMSILETRKDLNKQQRQ 121

Query: 137 EKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISD 196
           ++L  LL +F I+  +  L   +SGG+RRR EIAR+L + P ++LLDEPFAGVDP+++ D
Sbjct: 122 QRLTELLNDFKISHIKDSLGMSVSGGERRRAEIARALAADPKFMLLDEPFAGVDPISVGD 181

Query: 197 IHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYL 256
           I  +I+ L  RGIG+LITDHNV E L + +RAYI+  G V+A GT QEI+DN+ VR++YL
Sbjct: 182 IKDIIQTLKDRGIGVLITDHNVRETLAICERAYIVSEGAVIAEGTPQEILDNEQVRKVYL 241

Query: 257 GDRFA 261
           GD F 
Sbjct: 242 GDDFT 246


>gi|172061749|ref|YP_001809401.1| ABC transporter-like protein [Burkholderia ambifaria MC40-6]
 gi|171994266|gb|ACB65185.1| ABC transporter related [Burkholderia ambifaria MC40-6]
          Length = 258

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 173/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A + S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 10  AGETSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I ++G+ I+ +P+++RA LG+SYLPQEAS+FR LTVEENI AVLE+   D  KR  K 
Sbjct: 70  GEISLNGSSISLLPIHKRASLGLSYLPQEASVFRKLTVEENIRAVLELQHGDDGKRLSKD 129

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 + LL E  I   R   A  LSGG+RRR+EIAR+L + P++ILLDEPFAGVDP+A
Sbjct: 130 AIAARTEELLDELQIGHLRENPALSLSGGERRRVEIARALATSPNFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   EII+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPSEIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|257466744|ref|ZP_05631055.1| ABC transporter ATP-binding protein [Fusobacterium gonidiaformans
           ATCC 25563]
 gi|315917893|ref|ZP_07914133.1| ABC transporter ATP-binding protein [Fusobacterium gonidiaformans
           ATCC 25563]
 gi|313691768|gb|EFS28603.1| ABC transporter ATP-binding protein [Fusobacterium gonidiaformans
           ATCC 25563]
          Length = 241

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 130/237 (54%), Positives = 169/237 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L+A +L K Y    VV  V L V  GEIVGLLGPNGAGKTT FYM+TG+I  ++GS+  +
Sbjct: 4   LTARNLVKAYKQRKVVDSVSLEVNKGEIVGLLGPNGAGKTTTFYMITGIIKPNAGSVICN 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G +IT  PMY+RA LGI YL QE S+FR LTVE+NI AVLE+    KK++ E +D LL+E
Sbjct: 64  GEEITSYPMYKRANLGIGYLAQEPSVFRNLTVEDNIRAVLEMKHYGKKEQKEIVDKLLEE 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T     L   LSGG+RRR+EIAR++ + PS+ILLDEPFAGVDP+A+ DI   IR L 
Sbjct: 124 FKLTHVYESLGYSLSGGERRRVEIARTIANNPSFILLDEPFAGVDPIAVEDIQQSIRYLQ 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RG+GILITDH+V E L + ++AYI+  G V+  G+ QEI +N+  R++YLG+ F  
Sbjct: 184 KRGLGILITDHSVRETLNITEKAYIMAQGKVIISGSPQEIAENEMARKIYLGENFKL 240


>gi|169796518|ref|YP_001714311.1| lipopolysaccharide ABC transporter ATP-binding protein LptB
           [Acinetobacter baumannii AYE]
 gi|184157549|ref|YP_001845888.1| ABC transporter ATPase [Acinetobacter baumannii ACICU]
 gi|213156369|ref|YP_002318789.1| ABC transporter, ATP-binding protein [Acinetobacter baumannii
           AB0057]
 gi|215483981|ref|YP_002326206.1| ABC transporter family protein [Acinetobacter baumannii AB307-0294]
 gi|239503719|ref|ZP_04663029.1| ABC transporter family protein [Acinetobacter baumannii AB900]
 gi|260557954|ref|ZP_05830166.1| urea ABC transporter, ATP-binding protein UrtE [Acinetobacter
           baumannii ATCC 19606]
 gi|301346195|ref|ZP_07226936.1| ABC transporter family protein [Acinetobacter baumannii AB056]
 gi|301510174|ref|ZP_07235411.1| ABC transporter family protein [Acinetobacter baumannii AB058]
 gi|301594402|ref|ZP_07239410.1| ABC transporter family protein [Acinetobacter baumannii AB059]
 gi|332853950|ref|ZP_08435070.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Acinetobacter baumannii 6013150]
 gi|332870206|ref|ZP_08439101.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Acinetobacter baumannii 6013113]
 gi|332874283|ref|ZP_08442202.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Acinetobacter baumannii 6014059]
 gi|169149445|emb|CAM87331.1| putative lipopolysaccharide transport protein B (ABC superfamily,
           atp_bind) (LptB) [Acinetobacter baumannii AYE]
 gi|183209143|gb|ACC56541.1| ABC-type (unclassified) transport system, ATPase component
           [Acinetobacter baumannii ACICU]
 gi|193076935|gb|ABO11668.2| putative transport protein [Acinetobacter baumannii ATCC 17978]
 gi|213055529|gb|ACJ40431.1| ABC transporter, ATP-binding protein [Acinetobacter baumannii
           AB0057]
 gi|213987910|gb|ACJ58209.1| ABC transporter family protein [Acinetobacter baumannii AB307-0294]
 gi|260408464|gb|EEX01770.1| urea ABC transporter, ATP-binding protein UrtE [Acinetobacter
           baumannii ATCC 19606]
 gi|322507863|gb|ADX03317.1| Putative lipopolysaccharide transport protein B [Acinetobacter
           baumannii 1656-2]
 gi|323517460|gb|ADX91841.1| ABC transporter ATPase [Acinetobacter baumannii TCDC-AB0715]
 gi|332728306|gb|EGJ59687.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Acinetobacter baumannii 6013150]
 gi|332732373|gb|EGJ63630.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Acinetobacter baumannii 6013113]
 gi|332737508|gb|EGJ68416.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Acinetobacter baumannii 6014059]
          Length = 248

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 169/232 (72%), Gaps = 1/232 (0%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K Y+  +VVK V   ++ G+IVGLLGPNGAGKTT FYM+ GL+  D G I +D  D++
Sbjct: 16  LAKNYSKRWVVKDVSFSMQSGQIVGLLGPNGAGKTTSFYMVVGLVRMDKGEIHLDDLDMS 75

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLKEFNIT 149
            + M+ RAR GI YLPQEASIFR LT+ ENI+++LE  +  +K++R ++L  LL +F I+
Sbjct: 76  DLAMHERARKGIGYLPQEASIFRKLTIAENIMSILETRKDLNKQQRQQRLTELLNDFKIS 135

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             +  L   +SGG+RRR EIAR+L + P ++LLDEPFAGVDP+++ DI  +I+ L  RGI
Sbjct: 136 HIKDSLGMSVSGGERRRAEIARALAADPKFMLLDEPFAGVDPISVGDIKDIIQTLKDRGI 195

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
           G+LITDHNV E L + +RAYI+  G V+A GT QEI+DN+ VR++YLGD F 
Sbjct: 196 GVLITDHNVRETLAICERAYIVSEGSVIAEGTPQEILDNEQVRKVYLGDDFT 247


>gi|83814421|ref|YP_445486.1| ABC transporter, ATP-binding protein [Salinibacter ruber DSM 13855]
 gi|83755815|gb|ABC43928.1| ABC transporter, ATP-binding protein [Salinibacter ruber DSM 13855]
          Length = 261

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/239 (51%), Positives = 171/239 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L+A  LTK+Y+   VV  V L V  GEIVGLLGPNGAGKTT F+M+ G+I  + GSI 
Sbjct: 20  ATLAARHLTKRYDKRAVVDDVSLDVNQGEIVGLLGPNGAGKTTTFHMIVGMIRPNEGSIH 79

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           ++ +DIT++PMY+RAR G+ YL QE S+FR LTVE+N+ AVLE        R  +++SL+
Sbjct: 80  LEDDDITRLPMYKRARRGVGYLAQETSVFRELTVEDNLHAVLEFQSMSDADRTARVESLI 139

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EF + + R      LSGG+RRR EIAR+L + P + LLDEPFAGVDP+A+ DI  ++  
Sbjct: 140 EEFGLERVRDSKGYELSGGERRRTEIARALSTRPRFFLLDEPFAGVDPIAVEDIQSIVAG 199

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  RGIG+LITDHNVHE L + DRAY+++ G +L HGT +E+  + +VR+ YLG++F+ 
Sbjct: 200 LQERGIGVLITDHNVHETLAITDRAYLLYEGHILKHGTAEELAADPEVRKRYLGEKFSL 258


>gi|86131797|ref|ZP_01050394.1| ABC transporter, ATP-binding protein [Dokdonia donghaensis MED134]
 gi|85817619|gb|EAQ38793.1| ABC transporter, ATP-binding protein [Dokdonia donghaensis MED134]
          Length = 245

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 170/235 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L K Y    VVKG+ + V  GEIVGLLGPNGAGKTT FYM+ GL+  + G+I +D
Sbjct: 3   LRAENLMKSYKGRKVVKGISVEVNQGEIVGLLGPNGAGKTTSFYMIVGLVKPNGGNIYLD 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             DITK PMY+RA+ GI YL QEAS+FR L++E+NIL+VL++ +  KK++  K++ L++E
Sbjct: 63  QQDITKYPMYKRAQNGIGYLAQEASVFRKLSIEDNILSVLQLTKLSKKEQLHKMEELIEE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F++   R     LLSGG+RRR EIAR+L + PS+ILLDEPFAGVDPVA+ DI  ++  L 
Sbjct: 123 FSLGHIRKSRGDLLSGGERRRTEIARALATSPSFILLDEPFAGVDPVAVEDIQRIVAQLK 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           ++ IGILITDHNV E L + DR Y++  G +L HG  +E+  ++ VR++YLG  F
Sbjct: 183 NKNIGILITDHNVQETLAITDRTYLMFEGSILKHGEPEELAADEMVRKVYLGQNF 237


>gi|294787869|ref|ZP_06753113.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Simonsiella muelleri ATCC 29453]
 gi|294484162|gb|EFG31845.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Simonsiella muelleri ATCC 29453]
          Length = 243

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 169/242 (69%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
           +  S L    L K +    VVK   L +  GE++GLLGPNGAGKTT FYM+ GLI AD+G
Sbjct: 2   TTQSHLHVQGLQKTFKKRQVVKNFSLDIDSGEVIGLLGPNGAGKTTSFYMIVGLIAADAG 61

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLD 140
           +I +D  ++  +P++ RAR GI YLPQEASIFR +TVE+NI ++LE+  +D  +   +L+
Sbjct: 62  TIMLDKQELRHLPIHERARAGIGYLPQEASIFRKMTVEDNIRSILEINLRDATEIERQLN 121

Query: 141 SLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVL 200
            LL + NI + RH  AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +
Sbjct: 122 KLLDDLNIGRLRHSPAPALSGGERRRVEIARVLAMQPRFILLDEPFAGVDPIAVIDIQKI 181

Query: 201 IRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           I  L  RGIG+LITDHNV E L + DRAYII  G VLA G   ++++++ VR++YLGD F
Sbjct: 182 IEFLKQRGIGVLITDHNVRETLRICDRAYIISDGMVLASGRPDDLVNDEQVRKVYLGDNF 241

Query: 261 AF 262
            +
Sbjct: 242 TY 243


>gi|294634657|ref|ZP_06713190.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Edwardsiella tarda ATCC 23685]
 gi|291091903|gb|EFE24464.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Edwardsiella tarda ATCC 23685]
          Length = 241

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 173/236 (73%), Gaps = 1/236 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L K Y    VV+ V L V  GEIVGLLGPNGAGKTT FYM+ G++  D+G+I ID
Sbjct: 4   LIAQNLAKSYKGRRVVENVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIID 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
             DI+ +P++ RAR GI YLPQEASIFR L+V +N++AVLE+ +  D  +R ++ D LL+
Sbjct: 64  DEDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLEIRDDLDANQRADRADELLE 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+I   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I  L
Sbjct: 124 EFHIAHLRENLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIEHL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             RG+G+LITDHNV E L + +RAYI+  G ++AHG+  EI++N+ V+R+YLG+ F
Sbjct: 184 RDRGLGVLITDHNVRETLDVCERAYIVSQGNLIAHGSPSEILENEQVKRVYLGEEF 239


>gi|85713035|ref|ZP_01044072.1| Unclassified ABC-type transport system, ATPase component
           [Idiomarina baltica OS145]
 gi|85693138|gb|EAQ31099.1| Unclassified ABC-type transport system, ATPase component
           [Idiomarina baltica OS145]
          Length = 241

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 172/238 (72%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LS   L K YN   VVK V L V  G+++GLLGPNGAGKTT FYM+ GL+ +D GSIK+D
Sbjct: 4   LSVEHLAKSYNRRQVVKDVSLEVSQGQVIGLLGPNGAGKTTTFYMIVGLVNSDKGSIKLD 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
            +D+T +PM+ RAR GI YLPQE+SIFR +TV +N++A+LE  +     +R EKLD+LL+
Sbjct: 64  QHDLTLLPMHERARRGIGYLPQESSIFRKMTVRDNLMAILETRKSLTTIEREEKLDALLE 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EFNI    + L   LSGG+RRR+EIAR+L + P++ILLDEPFAGVDP+++ DI  +I  L
Sbjct: 124 EFNIGHIVNSLGMSLSGGERRRVEIARALAADPTFILLDEPFAGVDPISVLDIKKIIEHL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             RGIG+LITDHNV E L++ + AYI+  G ++A G    ++ NQ V+ +YLG++F  
Sbjct: 184 KHRGIGVLITDHNVRETLSVCEHAYIVSHGELIASGDANSVLSNQQVKDVYLGEQFTL 241


>gi|254523356|ref|ZP_05135411.1| ABC transporter ATP-binding protein [Stenotrophomonas sp. SKA14]
 gi|219720947|gb|EED39472.1| ABC transporter ATP-binding protein [Stenotrophomonas sp. SKA14]
          Length = 239

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 132/237 (55%), Positives = 163/237 (68%), Gaps = 1/237 (0%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L K+Y    VVK   L +  GE+VGLLGPNGAGKTT FYM+ GL+ AD+GSI +
Sbjct: 1   MLVAKGLRKRYKQREVVKDFGLTLDAGEVVGLLGPNGAGKTTCFYMIVGLVAADAGSIVL 60

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLL 143
           DG DIT  PMY RA+ G+ YLPQE S+FR LTV +NI  VLE+ E  D   R  +L SLL
Sbjct: 61  DGRDITSDPMYTRAKQGVGYLPQEPSVFRKLTVADNIRLVLELREDLDSAGRERELSSLL 120

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            E  +      L   LSGG+RRR EIAR+L + P  ILLDEPFAGVDP+++ +I  ++  
Sbjct: 121 DELQLGHVADQLGASLSGGERRRCEIARALAAQPRLILLDEPFAGVDPISVGEIQRIVTH 180

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L + DRAYI+  G VLA G+ + I+DN DVRR+YLGD F
Sbjct: 181 LKQRGIGVLITDHNVRETLGICDRAYILAEGAVLAQGSPEAILDNADVRRVYLGDSF 237


>gi|260549529|ref|ZP_05823747.1| lipopolysaccharide ABC transporter ATP-binding protein LptB
           [Acinetobacter sp. RUH2624]
 gi|260407322|gb|EEX00797.1| lipopolysaccharide ABC transporter ATP-binding protein LptB
           [Acinetobacter sp. RUH2624]
          Length = 248

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 169/232 (72%), Gaps = 1/232 (0%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K Y+  +VVK V   ++ G+IVGLLGPNGAGKTT FYM+ GL+  D G I +D  D++
Sbjct: 16  LAKNYSKRWVVKDVSFSMQSGQIVGLLGPNGAGKTTSFYMVVGLVRMDKGEIHLDDLDMS 75

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLKEFNIT 149
            + M+ RAR GI YLPQEASIFR LT+ ENI+++LE  +  +K++R ++L  LL +F I+
Sbjct: 76  DLAMHERARKGIGYLPQEASIFRKLTIAENIMSILETRKDLNKQQRQQRLHELLNDFKIS 135

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             +  L   +SGG+RRR EIAR+L + P ++LLDEPFAGVDP+++ DI  +I+ L  RGI
Sbjct: 136 HIKDSLGMSVSGGERRRAEIARALAADPKFMLLDEPFAGVDPISVGDIKDIIQTLKDRGI 195

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
           G+LITDHNV E L + +RAYI+  G V+A GT QEI+DN+ VR++YLGD F 
Sbjct: 196 GVLITDHNVRETLAICERAYIVSEGSVIAEGTPQEILDNEQVRKVYLGDDFT 247


>gi|294507372|ref|YP_003571430.1| ABC transporter ATP-binding protein [Salinibacter ruber M8]
 gi|294343700|emb|CBH24478.1| ABC transporter ATP-binding protein [Salinibacter ruber M8]
          Length = 374

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 174/243 (71%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           + + + L+A  LTK+Y+   VV  V L V  GEIVGLLGPNGAGKTT F+M+ G+I  + 
Sbjct: 129 SGEPATLAARHLTKRYDKRAVVDDVSLDVNQGEIVGLLGPNGAGKTTTFHMIVGMIRPNE 188

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           GSI ++ +DIT++PMY+RAR G+ YL QE S+FR LTVE+N+ AVLE        R  ++
Sbjct: 189 GSIHLEDDDITRLPMYKRARRGVGYLAQETSVFRELTVEDNLHAVLEFQSMSDADRTARV 248

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           +SL++EF + + R+     LSGG+RRR EIAR+L + P + LLDEPFAGVDP+A+ DI  
Sbjct: 249 ESLIEEFGLERVRYSKGYELSGGERRRTEIARALSTRPRFFLLDEPFAGVDPIAVEDIQS 308

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           ++  L  RGIG+LITDHNVHE L + DRAY+++ G +L HGT +E+  + +VR+ YLG++
Sbjct: 309 IVAGLQERGIGVLITDHNVHETLAITDRAYLLYEGHILKHGTAEELAADPEVRKRYLGEK 368

Query: 260 FAF 262
           F+ 
Sbjct: 369 FSL 371


>gi|163854754|ref|YP_001629052.1| Sulfate/thiosulfate import ATP-binding protein cysA [Bordetella
           petrii DSM 12804]
 gi|163258482|emb|CAP40781.1| Sulfate/thiosulfate import ATP-binding protein cysA [Bordetella
           petrii]
          Length = 263

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 136/251 (54%), Positives = 172/251 (68%), Gaps = 6/251 (2%)

Query: 16  QENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLI 75
           Q    +K   L A  L K YN   VV+ V L V  GE+VGLLGPNGAGKTT FYM+ GL+
Sbjct: 11  QSASGAKQGSLRATGLRKVYNGRTVVQDVSLSVVSGEVVGLLGPNGAGKTTSFYMIVGLV 70

Query: 76  CADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR 135
            AD+G I+ID   IT MP+++RAR+G+SYLPQ+AS+FR LTVE+NI AVLE+    + K 
Sbjct: 71  PADAGRIEIDDTPITSMPIHKRARMGLSYLPQDASVFRRLTVEQNIRAVLELQVDAQGKT 130

Query: 136 ------HEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGV 189
                  E+L++LL E  I   R   A  LSGG+RRR+EIAR+L + P +ILLDEPFAGV
Sbjct: 131 LTEPQIKEQLEALLDELQIGHIRGNAAISLSGGERRRVEIARALATHPRFILLDEPFAGV 190

Query: 190 DPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQ 249
           DP+A+ +I  ++R L  RGIG+LITDHNV E L + DRAYII  G VL  G   EI+ + 
Sbjct: 191 DPIAVIEIQRIVRFLKGRGIGVLITDHNVRETLGICDRAYIISEGKVLTDGQPDEIVGDP 250

Query: 250 DVRRLYLGDRF 260
            VRR+YLG+ F
Sbjct: 251 AVRRVYLGEHF 261


>gi|254251391|ref|ZP_04944709.1| ABC-type (unclassified) transport system ATPase component
           [Burkholderia dolosa AUO158]
 gi|124894000|gb|EAY67880.1| ABC-type (unclassified) transport system ATPase component
           [Burkholderia dolosa AUO158]
          Length = 258

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 173/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 10  AGTTSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I ++G+ I+ +P+++RA LG+SYLPQEAS+FR LTVE+NI AVLE+   D  KR  K 
Sbjct: 70  GEISLNGSSISLLPIHKRASLGLSYLPQEASVFRKLTVEQNIRAVLELQYGDDGKRLSKD 129

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL E  I   R   A  LSGG+RRR+EIAR+L + PS+ILLDEPFAGVDP+A
Sbjct: 130 AISLRAEALLDELQIAHLRENPALSLSGGERRRVEIARALATNPSFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   EII+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPSEIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|300113012|ref|YP_003759587.1| ABC transporter-like protein [Nitrosococcus watsonii C-113]
 gi|299538949|gb|ADJ27266.1| ABC transporter related protein [Nitrosococcus watsonii C-113]
          Length = 241

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 135/238 (56%), Positives = 167/238 (70%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S LSA  L K Y S +VVK V L +   +IVGLLGPNGAGKTT FYM+ GLI AD G I 
Sbjct: 2   SKLSAHRLAKCYQSRWVVKDVSLEISSSQIVGLLGPNGAGKTTCFYMLVGLIPADRGLIS 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           +D +DIT  P++RRARLGISYLPQEAS+FR LTV  NI+A+ E      K  R   +D L
Sbjct: 62  LDHHDITSYPIHRRARLGISYLPQEASVFRKLTVANNIMAIAETRRDLTKSARKHLVDQL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+E NIT  ++ L   LSGG+RRR+EIAR+L   P +ILLDEPFAGVDP+++ DI  +IR
Sbjct: 122 LRELNITHIKNTLGMSLSGGERRRVEIARALAVEPQFILLDEPFAGVDPISVLDIQGIIR 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  R IG+LITDHNV E L +   AYI++ G V+A G  QEI+DN+ V+ +YLG  F
Sbjct: 182 HLTEREIGVLITDHNVRETLGICQYAYIVNEGEVIAKGKPQEILDNERVKEVYLGYNF 239


>gi|74316552|ref|YP_314292.1| ATPase component ABC-type transport system [Thiobacillus
           denitrificans ATCC 25259]
 gi|74056047|gb|AAZ96487.1| ATPase component ABC-type transport system [Thiobacillus
           denitrificans ATCC 25259]
          Length = 240

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 170/237 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S +S   L K Y    VV  V   VK GE+VGLLGPNGAGKTT FYM+ GL+ AD G++ 
Sbjct: 2   SQISVQGLRKTYGKRTVVHDVSFDVKSGEVVGLLGPNGAGKTTCFYMVVGLVAADGGTVH 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +D +++T M +++RARLG+SYLPQE SIFR +TVEENILA+LE+    +++R E LD+LL
Sbjct: 62  LDTHNLTHMAIHQRARLGLSYLPQEPSIFRKMTVEENILAILELKPYSEEEREEHLDNLL 121

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           ++ +I   R   A  LSGG+RRR+EIAR+L   P ++LLDEPFAGVDP+A+ DI  L+  
Sbjct: 122 EDLHIAHLREASAVSLSGGERRRVEIARALAINPRFVLLDEPFAGVDPIAVLDIQKLVHF 181

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  R IG+LITDHNV E L + DRAYII+ G VL  GT + II +++ R+ YLG+ F
Sbjct: 182 LVEREIGVLITDHNVRETLGICDRAYIINDGRVLTAGTPEHIIQDENARKFYLGENF 238


>gi|197287452|ref|YP_002153324.1| ABC transporter ATP-binding protein YhbG [Proteus mirabilis HI4320]
 gi|227358286|ref|ZP_03842627.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Proteus mirabilis ATCC 29906]
 gi|194684939|emb|CAR47124.1| putative ABC transporter ATP-binding protein [Proteus mirabilis
           HI4320]
 gi|227161622|gb|EEI46659.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Proteus mirabilis ATCC 29906]
          Length = 241

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 176/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           +LL A +L K Y    VV  V L V  GEIVGLLGPNGAGKTT FYM+ G++  D+GSI 
Sbjct: 2   ALLKAENLAKAYKGRTVVGDVSLNVNSGEIVGLLGPNGAGKTTTFYMVVGIVARDAGSIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID  DIT +P++ RAR GI YLPQEASIFR L+V +NI+ +LE+ ++   ++R ++ + L
Sbjct: 62  IDDEDITLLPLHERARKGIGYLPQEASIFRRLSVYDNIMGILEIRHDLTAEQRKDRAEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EFN++  R+ L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I+
Sbjct: 122 LEEFNVSHLRNSLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVLDIKKIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHG+ +EI+ N+ V+R+YLG+ F
Sbjct: 182 HLRDYGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGSPEEILANEQVKRVYLGEGF 239


>gi|95928724|ref|ZP_01311470.1| ABC transporter related [Desulfuromonas acetoxidans DSM 684]
 gi|95135069|gb|EAT16722.1| ABC transporter related [Desulfuromonas acetoxidans DSM 684]
          Length = 241

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 127/236 (53%), Positives = 169/236 (71%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           LL A  LTK Y    VV GVDL V+ G+++GLLGPNGAGKTT FYMM GL+  D G + I
Sbjct: 4   LLKATGLTKSYRRRTVVNGVDLEVRSGQVIGLLGPNGAGKTTSFYMMVGLVKPDQGQVFI 63

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           D  ++++ PMY+RA  G++YLPQE+S+FR LTVE+N+LA+LE +  D ++R E+L +LL 
Sbjct: 64  DDVEVSQWPMYQRAGAGVAYLPQESSVFRKLTVEQNLLAILEYHVSDVEQRRERLATLLG 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           +F +          LSGG+RRR EIAR+LV  P +ILLDEPFAG+DP+A+ DI  +I DL
Sbjct: 124 DFRLEHVAKSPGYALSGGERRRTEIARALVIDPRFILLDEPFAGIDPLAVIDIQNIILDL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             RGIG+LI+DHNV E L + D AYI++AG +L HGT +EI  +   R +YLG+ F
Sbjct: 184 KKRGIGVLISDHNVRETLGVCDSAYILNAGTILEHGTPEEIATSSTAREIYLGEDF 239


>gi|153208968|ref|ZP_01947174.1| ABC transporter, ATP-binding protein [Coxiella burnetii 'MSU Goat
           Q177']
 gi|165923979|ref|ZP_02219811.1| ABC transporter, ATP-binding protein [Coxiella burnetii RSA 334]
 gi|212219030|ref|YP_002305817.1| LPS ABC transporter ATP-binding protein [Coxiella burnetii
           CbuK_Q154]
 gi|120575568|gb|EAX32192.1| ABC transporter, ATP-binding protein [Coxiella burnetii 'MSU Goat
           Q177']
 gi|165916565|gb|EDR35169.1| ABC transporter, ATP-binding protein [Coxiella burnetii RSA 334]
 gi|212013292|gb|ACJ20672.1| LPS ABC transporter ATP-binding protein [Coxiella burnetii
           CbuK_Q154]
          Length = 249

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 173/238 (72%), Gaps = 2/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++LSA  L K Y S  VVK V L +   EIVGLLGPNGAGKTT FYM+ GLI  DSG + 
Sbjct: 3   AILSAKQLQKSYKSRRVVKDVSLAIT-NEIVGLLGPNGAGKTTSFYMIVGLITPDSGEVF 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           +D  +I+  PM++RARLGI YLPQE SIFR L+V +NI+A+L++     K++R EK +SL
Sbjct: 62  LDNQNISFQPMHKRARLGIGYLPQETSIFRKLSVAQNIMAILQLRNDLSKQQRQEKCESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+I+    +    LSGG++RR+EIAR+L   P +ILLDEPFAG+DP+++ DI  +I 
Sbjct: 122 MQEFHISHLHDIPGYSLSGGEKRRVEIARALAMDPKFILLDEPFAGIDPISVIDIKRIII 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIGILITDHNV E L +  RAYI++ G ++AHGT  EI+ N+DVR +YLGD F
Sbjct: 182 HLRERGIGILITDHNVRETLDICQRAYIVNDGAIIAHGTPGEILRNKDVRAVYLGDEF 239


>gi|262278512|ref|ZP_06056297.1| lipopolysaccharide ABC transporter ATP-binding protein LptB
           [Acinetobacter calcoaceticus RUH2202]
 gi|299770836|ref|YP_003732862.1| ABC transporter family protein [Acinetobacter sp. DR1]
 gi|262258863|gb|EEY77596.1| lipopolysaccharide ABC transporter ATP-binding protein LptB
           [Acinetobacter calcoaceticus RUH2202]
 gi|298700924|gb|ADI91489.1| ABC transporter family protein [Acinetobacter sp. DR1]
          Length = 248

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 169/232 (72%), Gaps = 1/232 (0%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K Y+  +VVK V   ++ G+IVGLLGPNGAGKTT FYM+ GL+  D G I +D  D++
Sbjct: 16  LGKNYSKRWVVKDVSFSMQSGQIVGLLGPNGAGKTTSFYMVVGLVRMDKGEIHLDDLDMS 75

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLKEFNIT 149
            + M+ RAR GI YLPQEASIFR LT+ ENI+++LE  +  +K++R ++L  LL +F I+
Sbjct: 76  DLAMHERARKGIGYLPQEASIFRKLTIAENIMSILETRKDLNKQQRQQRLTELLNDFKIS 135

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             +  L   +SGG+RRR EIAR+L + P ++LLDEPFAGVDP+++ DI  +I+ L  RGI
Sbjct: 136 HIKDSLGMSVSGGERRRAEIARALAADPKFMLLDEPFAGVDPISVGDIKDIIQTLKDRGI 195

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
           G+LITDHNV E L + +RAYI+  G V+A GT QEI+DN+ VR++YLGD F 
Sbjct: 196 GVLITDHNVRETLAICERAYIVSEGAVIAEGTPQEILDNEQVRKVYLGDDFT 247


>gi|325922180|ref|ZP_08183968.1| ABC-type (unclassified) transport system, ATPase component
           [Xanthomonas gardneri ATCC 19865]
 gi|325547350|gb|EGD18416.1| ABC-type (unclassified) transport system, ATPase component
           [Xanthomonas gardneri ATCC 19865]
          Length = 239

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 166/237 (70%), Gaps = 1/237 (0%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L KKY    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GL+ AD+G I++
Sbjct: 1   MLVATGLRKKYKQREVVKEFGLTLEAGEVVGLLGPNGAGKTTCFYMIVGLVEADAGRIEL 60

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLL 143
           DG D+T  PMY RA+LG+ YLPQE SIFR LTV +NI  VLE+ E  D   R ++L SLL
Sbjct: 61  DGRDLTAEPMYARAKLGVGYLPQEPSIFRKLTVADNIRLVLELREDLDSAGREKELTSLL 120

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +E  IT     L   LSGG+RRR EIAR+L + P  +LLDEPFAGVDP+++ +I  +I  
Sbjct: 121 EELQITHVADQLGASLSGGERRRCEIARALAAKPRMMLLDEPFAGVDPISVGEIQRIIIH 180

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L + DRAYI+  GGVLA G    ++ N DVRR+YLG+ F
Sbjct: 181 LKERGIGVLITDHNVRETLGICDRAYILAEGGVLAQGAPDALLANPDVRRVYLGETF 237


>gi|115352901|ref|YP_774740.1| ABC transporter-like protein [Burkholderia ambifaria AMMD]
 gi|115282889|gb|ABI88406.1| ABC transporter related protein [Burkholderia ambifaria AMMD]
          Length = 258

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 172/247 (69%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 10  AGATSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I ++G+ I+ +P+++RA LG+SYLPQEAS+FR LTVEENI AVLE+   D  KR  K 
Sbjct: 70  GEISLNGSSISLLPIHKRASLGLSYLPQEASVFRKLTVEENIRAVLELQHGDDGKRLSKD 129

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 + LL E  I   R   A  LSGG+RRR+EIAR+L + P++ILLDEPFAGVDP+A
Sbjct: 130 AIAARTEELLDELQIGHLRENPALSLSGGERRRVEIARALATSPNFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   EII+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPSEIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|86147579|ref|ZP_01065889.1| ABC transporter, ATP-binding protein [Vibrio sp. MED222]
 gi|218710676|ref|YP_002418297.1| putative ABC transporter ATP-binding protein [Vibrio splendidus
           LGP32]
 gi|85834618|gb|EAQ52766.1| ABC transporter, ATP-binding protein [Vibrio sp. MED222]
 gi|218323695|emb|CAV20032.1| Probable ABC transporter ATP-binding protein [Vibrio splendidus
           LGP32]
          Length = 241

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 176/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L+A +L K Y    VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G+I 
Sbjct: 2   AVLTAKNLAKTYGKRKVVTDVSLQVESGQIVGLLGPNGAGKTTSFYMIVGLVARDEGTIS 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           ID  DI+ +PM+ R+RLGI YLPQEASIFR L+VE+NI+AVL+   E    +R +KL+ L
Sbjct: 62  IDDRDISILPMHSRSRLGIGYLPQEASIFRKLSVEDNIMAVLQTRDEMTNAQRQDKLEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LEEFHIQHIRASNGMALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIV 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A GT +++++N+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGHLIAEGTPEDVLNNEQVKQVYLGEQF 239


>gi|163756917|ref|ZP_02164025.1| ABC transporter, ATP-binding protein [Kordia algicida OT-1]
 gi|161323153|gb|EDP94494.1| ABC transporter, ATP-binding protein [Kordia algicida OT-1]
          Length = 252

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 127/236 (53%), Positives = 170/236 (72%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A S+ K Y    VVKG+ L V  GEIVGLLGPNGAGKTT FYM+ GLI  + G I +
Sbjct: 2   ILRADSIMKSYKGRKVVKGISLEVNQGEIVGLLGPNGAGKTTSFYMIVGLIKPNGGKIFL 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           D  +ITK PMY+RA+ GI YL QEAS+FR L++EENIL+VL++ +  KK++H K++SL++
Sbjct: 62  DDMEITKFPMYKRAQNGIGYLAQEASVFRKLSIEENILSVLQLTKLSKKEQHMKMESLIE 121

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF +   R     LLSGG+RRR EIAR+L + P ++LLDEPFAGVDPVA+ DI  +I  L
Sbjct: 122 EFGLGHIRKNRGDLLSGGERRRTEIARALATDPKFVLLDEPFAGVDPVAVEDIQRIIAHL 181

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            ++ IGILITDHNV E L + DR Y++  G +L  G  +E+ +++ VR++YLG  F
Sbjct: 182 KNKNIGILITDHNVQETLAITDRTYLMFEGNILKAGKPKELAEDEMVRKVYLGQNF 237


>gi|170700375|ref|ZP_02891385.1| ABC transporter related [Burkholderia ambifaria IOP40-10]
 gi|170134719|gb|EDT03037.1| ABC transporter related [Burkholderia ambifaria IOP40-10]
          Length = 258

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 172/247 (69%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 10  AGATSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I ++G+ I+ +P+++RA LG+SYLPQEAS+FR LTVEENI AVLE+   D  KR  K 
Sbjct: 70  GEISLNGSSISLLPIHKRASLGLSYLPQEASVFRKLTVEENIRAVLELQHGDDGKRLSKD 129

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 + LL E  I   R   A  LSGG+RRR+EIAR+L + P++ILLDEPFAGVDP+A
Sbjct: 130 AIAARTEELLDELQIGHLRENPALSLSGGERRRVEIARALATSPNFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   EII+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPSEIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|89890395|ref|ZP_01201905.1| ABC transporter, ATPase component [Flavobacteria bacterium BBFL7]
 gi|89517310|gb|EAS19967.1| ABC transporter,  ATPase component [Flavobacteria bacterium BBFL7]
          Length = 248

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 127/237 (53%), Positives = 166/237 (70%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L K Y    VVKGV   V  GEIVGLLGPNGAGKTT FYM  GL+    G + +D
Sbjct: 4   LRADNLQKSYKGRPVVKGVSFEVNQGEIVGLLGPNGAGKTTSFYMTVGLVKPTGGDVWLD 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
              IT+ PMY+RA+ GI YL QEASIFR LTVE+NIL VL++ +  KK++ E+ + LL+E
Sbjct: 64  DKKITQYPMYKRAQNGIGYLAQEASIFRKLTVEQNILGVLQLTDLSKKEQKERCEMLLEE 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F++   R+    LLSGG+RRR EIAR+L + P++ILLDEPFAGVDPVA+ DI  ++  L 
Sbjct: 124 FSLEDRRNRNGDLLSGGERRRTEIARALATNPTFILLDEPFAGVDPVAVEDIQRIVAQLT 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            + IGILITDHNV E L + DR Y++  G +L HG+ +E+ +++ VRR+YLG  F  
Sbjct: 184 KKNIGILITDHNVQETLAITDRTYLMFEGNILKHGSPEELAEDEVVRRVYLGQNFEL 240


>gi|221070010|ref|ZP_03546115.1| ABC transporter related [Comamonas testosteroni KF-1]
 gi|220715033|gb|EED70401.1| ABC transporter related [Comamonas testosteroni KF-1]
          Length = 260

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 132/241 (54%), Positives = 172/241 (71%), Gaps = 6/241 (2%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y S  VVK V L V+ GE+VGLLGPNGAGKTT FYM+ GL+ +D G I ID
Sbjct: 18  LEAKHLAKSYGSRKVVKDVSLSVQKGEVVGLLGPNGAGKTTSFYMIVGLVRSDGGEIFID 77

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR------HEKL 139
           G  +  MP+++R+RLG+SYLPQEASIFR L+VE+N+ AVLE+ + ++ K        ++L
Sbjct: 78  GQPVGGMPIHQRSRLGLSYLPQEASIFRKLSVEDNVRAVLELQKDEQGKALTQGEIEKRL 137

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
             LL+E  +   R   A  LSGG+RRR+EIAR+L + P +ILLDEPFAG+DP+A+ +I  
Sbjct: 138 TGLLQELRVEHLRQSPALALSGGERRRVEIARALATQPRFILLDEPFAGIDPIAVIEIQR 197

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           +I  L  RGIG+LITDHNV E L + D A+II  G VLA GT +EI++N DVRR+YLG+ 
Sbjct: 198 IIGFLKERGIGVLITDHNVRETLGICDHAFIISDGHVLAEGTPEEIVENADVRRVYLGEH 257

Query: 260 F 260
           F
Sbjct: 258 F 258


>gi|78048673|ref|YP_364848.1| ABC transporter ATP-binding protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|289664522|ref|ZP_06486103.1| ABC transporter ATP-binding protein [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289667913|ref|ZP_06488988.1| ABC transporter ATP-binding protein [Xanthomonas campestris pv.
           musacearum NCPPB4381]
 gi|325926076|ref|ZP_08187439.1| ABC-type (unclassified) transport system, ATPase component
           [Xanthomonas perforans 91-118]
 gi|1543079|gb|AAB08067.1| ORF2 [Xanthomonas campestris]
 gi|78037103|emb|CAJ24848.1| ABC transporter ATP-binding protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325543534|gb|EGD14954.1| ABC-type (unclassified) transport system, ATPase component
           [Xanthomonas perforans 91-118]
          Length = 239

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 167/237 (70%), Gaps = 1/237 (0%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L KKY    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GL+ AD+G I++
Sbjct: 1   MLVATGLRKKYKQREVVKEFGLTLEAGEVVGLLGPNGAGKTTCFYMIVGLVEADAGRIEL 60

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLL 143
           DG D+T  PMY RA+LG+ YLPQE SIFR LTV +NI  VLE+ E+ D   R ++L SLL
Sbjct: 61  DGRDLTAEPMYARAKLGVGYLPQEPSIFRKLTVADNIRLVLELREELDNAGREKELVSLL 120

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +E  IT     L   LSGG+RRR EIAR+L + P  +LLDEPFAGVDP+++ +I  +I  
Sbjct: 121 EELQITHVADQLGASLSGGERRRCEIARALAAKPRMMLLDEPFAGVDPISVGEIQRIIIH 180

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L + DRAYI+  GGVLA G    ++ N DVRR+YLG+ F
Sbjct: 181 LKERGIGVLITDHNVRETLGICDRAYILAEGGVLAQGAPDTLLANPDVRRVYLGETF 237


>gi|312142809|ref|YP_003994255.1| ABC transporter related protein [Halanaerobium sp. 'sapolanicus']
 gi|311903460|gb|ADQ13901.1| ABC transporter related protein [Halanaerobium sp. 'sapolanicus']
          Length = 239

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 172/235 (73%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           + A  L K YN + VV  VD+ V+ G+IVGLLGPNGAGKTT FYM+ GLI  D G I  D
Sbjct: 3   IKAEGLVKVYNKLRVVDEVDIKVERGQIVGLLGPNGAGKTTTFYMILGLINPDGGKIFFD 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
            +DI+++P+++RARLG+ YLPQEASIFR LTV +N+ A+LE  +  K+K  +    LL+E
Sbjct: 63  EHDISELPVFKRARLGVGYLPQEASIFRKLTVADNLRAILEHKDYSKEKIEQITTDLLEE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F+I   R      LSGG+RRR+EIARSL + P +ILLDEPFAGVDP+A++DI  +IR L 
Sbjct: 123 FHIEGLRDRKGFQLSGGERRRVEIARSLAADPDFILLDEPFAGVDPIAVNDIQDIIRYLK 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            RG+G+LITDH+V E L++ DRAYI+H G +L  GT +EI +N+  R+ YLGD+F
Sbjct: 183 KRGLGVLITDHSVRETLSITDRAYIMHEGKILFSGTSEEISENELARKFYLGDKF 237


>gi|299532764|ref|ZP_07046151.1| ATP-binding protein of ABC transporter [Comamonas testosteroni S44]
 gi|298718988|gb|EFI59958.1| ATP-binding protein of ABC transporter [Comamonas testosteroni S44]
          Length = 260

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 132/241 (54%), Positives = 172/241 (71%), Gaps = 6/241 (2%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y S  VVK V L V+ GE+VGLLGPNGAGKTT FYM+ GL+ +D G I ID
Sbjct: 18  LEAKHLAKSYGSRKVVKDVSLSVQKGEVVGLLGPNGAGKTTSFYMIVGLVRSDGGEIFID 77

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR------HEKL 139
           G  +  MP+++R+RLG+SYLPQEASIFR L+VE+N+ AVLE+ + ++ K        ++L
Sbjct: 78  GQPVGGMPIHQRSRLGLSYLPQEASIFRKLSVEDNVRAVLELQKDEQGKTLTQGEIEKRL 137

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
             LL+E  +   R   A  LSGG+RRR+EIAR+L + P +ILLDEPFAG+DP+A+ +I  
Sbjct: 138 TGLLQELRVEHLRQSPALALSGGERRRVEIARALATQPRFILLDEPFAGIDPIAVIEIQR 197

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           +I  L  RGIG+LITDHNV E L + D A+II  G VLA GT +EI++N DVRR+YLG+ 
Sbjct: 198 IIGFLKERGIGVLITDHNVRETLGICDHAFIISDGHVLAEGTPEEIVENADVRRVYLGEH 257

Query: 260 F 260
           F
Sbjct: 258 F 258


>gi|88811872|ref|ZP_01127125.1| ABC transporter, ATP-binding protein, putative [Nitrococcus mobilis
           Nb-231]
 gi|88790756|gb|EAR21870.1| ABC transporter, ATP-binding protein, putative [Nitrococcus mobilis
           Nb-231]
          Length = 249

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 123/236 (52%), Positives = 170/236 (72%), Gaps = 1/236 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  LTK Y    VV+    Y++ GEIVGLLGPNGAGKTT FYM+ GL+  D G I +D
Sbjct: 12  LKAAGLTKHYRRQPVVRDASFYIRSGEIVGLLGPNGAGKTTCFYMVVGLVSTDGGRIALD 71

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
           G+DIT++PM+ RARLGI YLPQEAS+FR LTV +N++A+LE+     +  R   +++LL+
Sbjct: 72  GHDITRLPMHARARLGIGYLPQEASVFRKLTVAQNLMAILELRRGLSRDDRRHTMEALLE 131

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+++     L   LSGG+RRR+EIAR+L + P ++LLDEPFAGVDP+++ DI  ++R L
Sbjct: 132 EFHVSHLSDQLGISLSGGERRRVEIARALAADPRFVLLDEPFAGVDPISVGDIKDIVRHL 191

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             RGIG+LITDHNV + L ++DRAYI+ AG V+A G+   ++ +  V+ +YLG  F
Sbjct: 192 VERGIGVLITDHNVRDTLGIVDRAYILSAGRVIAEGSADAVLADDQVKAVYLGRNF 247


>gi|260062257|ref|YP_003195337.1| ABC transporter ATP-binding protein [Robiginitalea biformata
           HTCC2501]
 gi|88783819|gb|EAR14990.1| ABC transporter, ATP-binding protein [Robiginitalea biformata
           HTCC2501]
          Length = 246

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 170/235 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A ++ K Y    VVKG+ L V  GEIVGLLGPNGAGKTT FYM+ GLI  + G I +D
Sbjct: 3   LRAENIMKSYRGRQVVKGISLEVNQGEIVGLLGPNGAGKTTSFYMIVGLIKPNGGRIFLD 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             +ITK PMY+RA+ GI YL QEAS+FR L+VE+NIL+VL++ +  KK++H +++SLL+E
Sbjct: 63  QTEITKFPMYKRAQYGIGYLAQEASVFRKLSVEKNILSVLQLTDLSKKEQHMRMESLLEE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F I   R     LLSGG+RRR EIAR+L + P +ILLDEPFAGVDPVA+ DI  ++  L 
Sbjct: 123 FGIGHIRKNRGDLLSGGERRRTEIARALATDPKFILLDEPFAGVDPVAVEDIQRIVAQLK 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +R IGILITDHNV E L + +R+Y++  GG+L  G  +++  ++ VR++YLG  F
Sbjct: 183 NRNIGILITDHNVQETLAITERSYLMFEGGILKSGLPEDLAADEMVRKVYLGQNF 237


>gi|89899587|ref|YP_522058.1| ABC transporter-like protein [Rhodoferax ferrireducens T118]
 gi|89344324|gb|ABD68527.1| ABC transporter related [Rhodoferax ferrireducens T118]
          Length = 264

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 176/253 (69%), Gaps = 6/253 (2%)

Query: 14  EFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTG 73
           + + + A  +S L    L K Y S  VVK V L V  GE+VGLLGPNGAGKTT FYM+ G
Sbjct: 10  QLRSDGAQCESRLEVSHLQKFYGSRQVVKDVSLVVCKGEVVGLLGPNGAGKTTSFYMIVG 69

Query: 74  LICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD-- 131
           L+ A +G IKIDG  + +MP+++RARLG+SYLPQEASIFR L  E+N+ AVLE+   +  
Sbjct: 70  LVHASAGDIKIDGQSVERMPIHKRARLGLSYLPQEASIFRKLNAEDNVRAVLELQHDESG 129

Query: 132 ----KKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFA 187
               K +  ++L +LL++  +   R   A  LSGG+RRR+EIAR+L + P +ILLDEPFA
Sbjct: 130 QPLSKDEIEKRLTALLQDLRVEHLRETPALALSGGERRRVEIARALATQPRFILLDEPFA 189

Query: 188 GVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIID 247
           G+DP+A+ +I  +I  L +RGIG+LITDHNV E L + D AYII  G VLA GT  EI++
Sbjct: 190 GIDPIAVIEIQRIISFLKNRGIGVLITDHNVRETLGICDHAYIISDGSVLAQGTPAEIVN 249

Query: 248 NQDVRRLYLGDRF 260
           + +VRR+YLG+ F
Sbjct: 250 DAEVRRVYLGEHF 262


>gi|302345893|ref|YP_003814246.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Prevotella melaninogenica ATCC 25845]
 gi|302149985|gb|ADK96247.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Prevotella melaninogenica ATCC 25845]
          Length = 275

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 167/239 (69%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L    L K+Y    V  GV + VK GEIVGLLGPNGAGKTT FYM TGL+  + G + 
Sbjct: 16  SILRTDKLVKRYGKRTVANGVSINVKQGEIVGLLGPNGAGKTTSFYMTTGLVVPNEGHVY 75

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           ID  +IT  P+Y+RAR GI YLPQEAS+FR ++VE+NI++VLE+ +  K++R +K++SL+
Sbjct: 76  IDDQEITNFPVYKRARAGIGYLPQEASVFRKMSVEDNIMSVLEMTKLSKQERIDKMESLI 135

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EF + K R  L   LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  
Sbjct: 136 REFRLEKVRKNLGDRLSGGERRRCEIARCLAIDPKFIMLDEPFAGVDPIAVEDIQHIVWR 195

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  R IGILITDHNVHE L + DRAY++  G +L  GT +E+  N+ V+  YLG  F  
Sbjct: 196 LKFRNIGILITDHNVHETLNITDRAYLLFEGRILFKGTPEELAANKIVKEKYLGTDFVL 254


>gi|21243698|ref|NP_643280.1| ABC transporter ATP-binding protein [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|21109279|gb|AAM37816.1| ABC transporter ATP-binding protein [Xanthomonas axonopodis pv.
           citri str. 306]
          Length = 239

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 167/237 (70%), Gaps = 1/237 (0%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L KKY    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GL+ AD+G I++
Sbjct: 1   MLVATGLRKKYKQREVVKEFGLTLESGEVVGLLGPNGAGKTTCFYMIVGLVEADAGRIEL 60

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLL 143
           DG D+T  PMY RA+LG+ YLPQE SIFR LTV +NI  VLE+ E+ D   R ++L SLL
Sbjct: 61  DGRDLTAEPMYARAKLGVGYLPQEPSIFRKLTVADNIRLVLELREELDNAGREKELVSLL 120

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +E  IT     L   LSGG+RRR EIAR+L + P  +LLDEPFAGVDP+++ +I  +I  
Sbjct: 121 EELQITHVADQLGASLSGGERRRCEIARALAAKPRMMLLDEPFAGVDPISVGEIQRIIIH 180

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L + DRAYI+  GGVLA G    ++ N DVRR+YLG+ F
Sbjct: 181 LKERGIGVLITDHNVRETLGICDRAYILAEGGVLAQGAPDTLLANPDVRRVYLGETF 237


>gi|325105082|ref|YP_004274736.1| ABC transporter related protein [Pedobacter saltans DSM 12145]
 gi|324973930|gb|ADY52914.1| ABC transporter related protein [Pedobacter saltans DSM 12145]
          Length = 260

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 167/235 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L KKY    VV  V  +V  GEIVGLLGPNGAGKTT FYM+ GLI  + G + ++
Sbjct: 3   LRAENLVKKYKQRTVVNNVSFHVSQGEIVGLLGPNGAGKTTSFYMIVGLIKPNEGHVYLE 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             +IT+ PMYRRA+ GI YL QEAS+FR LTVEENI+AVLE+ +  K ++ +KL+ L+ E
Sbjct: 63  DLEITEDPMYRRAQKGIGYLAQEASVFRKLTVEENIMAVLEMTKLTKAEQKDKLEQLIDE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F++ K R     LLSGG+RRR EIAR+L + P +ILLDEPFAGVDP+A+ +I  ++  L 
Sbjct: 123 FSLHKVRKNRGDLLSGGERRRTEIARALAADPKFILLDEPFAGVDPIAVEEIQTIVARLK 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            R IGILITDHNV+E L++ DRAY++  G ++  GT QEI  N+  R+ YLG  F
Sbjct: 183 HRNIGILITDHNVNETLSITDRAYLLTEGKIMLSGTPQEIASNEMARKFYLGQHF 237


>gi|255037796|ref|YP_003088417.1| ABC transporter-like protein [Dyadobacter fermentans DSM 18053]
 gi|254950552|gb|ACT95252.1| ABC transporter related [Dyadobacter fermentans DSM 18053]
          Length = 243

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 167/238 (70%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L   +L KKY    V   V   V+ GEIVGLLGPNGAGKTT FYM  GL+  +SG++ +
Sbjct: 2   ILRTVNLVKKYGVRLVNNNVSYQVEQGEIVGLLGPNGAGKTTSFYMAVGLVKPNSGNVYL 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           D  DIT +PMY+RARLG+ YL QEAS+FR LTVEENI AVLE+    K  + +K++ L++
Sbjct: 62  DDKDITNLPMYKRARLGLGYLAQEASVFRTLTVEENIKAVLEMTNLSKADQKQKVEELIE 121

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF++   R     +LSGG+RRR EIARSL   P +ILLDEPFAGVDP+A+ DI  ++  L
Sbjct: 122 EFHLGHVRKSKGMVLSGGERRRTEIARSLAVDPKFILLDEPFAGVDPIAVEDIQSIVAKL 181

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             + IGILITDHNV+E L++ DRAY++  G +L  GT +E+ +++ VRR+YLG  F  
Sbjct: 182 KHKNIGILITDHNVNETLSITDRAYLLFEGKILKQGTAEELAEDEVVRRVYLGQNFEL 239


>gi|52425771|ref|YP_088908.1| hypothetical protein MS1716 [Mannheimia succiniciproducens MBEL55E]
 gi|52307823|gb|AAU38323.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 241

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 130/241 (53%), Positives = 175/241 (72%), Gaps = 3/241 (1%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L A +L K Y    VV  V   VK  EIVGLLGPNGAGKTT FYM+ GL+  D G I+
Sbjct: 2   SILYAENLAKSYKGRQVVSDVSFTVKSNEIVGLLGPNGAGKTTSFYMVVGLVRHDQGKIR 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD--KKKRHEKLDS 141
           ID  DI+ +PM+ RA+ G+ YLPQEASIFR L+V +N++AVLE+  KD  K++RH + + 
Sbjct: 62  IDDEDISLLPMHNRAQKGVGYLPQEASIFRRLSVYDNLMAVLEI-RKDLTKEQRHARAEE 120

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           L+ EFNI   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I
Sbjct: 121 LIDEFNIGHIRDNLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKII 180

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
           +DL  RG+G+LITDHNV E L + +RAYI+ AG ++A GT  +I++++ V+R+YLG+ F 
Sbjct: 181 KDLRDRGLGVLITDHNVRETLDVCERAYIVSAGKMIATGTPTDILNDEHVKRVYLGEEFK 240

Query: 262 F 262
            
Sbjct: 241 L 241


>gi|311109296|ref|YP_003982149.1| ABC transporter [Achromobacter xylosoxidans A8]
 gi|310763985|gb|ADP19434.1| ABC transporter family protein 98 [Achromobacter xylosoxidans A8]
          Length = 264

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 136/261 (52%), Positives = 175/261 (67%), Gaps = 6/261 (2%)

Query: 6   NYLGIEMPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKT 65
           N   +  P        K   L A  L K YN   VV+ V L V  GE+VGLLGPNGAGKT
Sbjct: 2   NQPSVPTPVTSAPSGVKQGSLRATGLRKTYNGRTVVQDVSLSVVSGEVVGLLGPNGAGKT 61

Query: 66  TFFYMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVL 125
           T FYM+ GL+ AD+G I+IDG+ IT MP+++RA +G+SYLPQ+AS+FR LTVE+NI AVL
Sbjct: 62  TSFYMIVGLVPADAGRIEIDGSVITSMPIHKRAHMGLSYLPQDASVFRRLTVEQNIRAVL 121

Query: 126 EVYEK------DKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSY 179
           E+            K +E++++LL+E  I   R   A  LSGG+RRR+EIAR+L + P +
Sbjct: 122 ELQTGPDGRPLSTPKINEQMEALLEELQIGHIRSNAAISLSGGERRRVEIARALATSPRF 181

Query: 180 ILLDEPFAGVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAH 239
           ILLDEPFAGVDP+A+ +I  ++R L  RGIG+LITDHNV E L + DRAYII  G VL  
Sbjct: 182 ILLDEPFAGVDPIAVIEIQRIVRFLKGRGIGVLITDHNVRETLGICDRAYIISEGKVLTD 241

Query: 240 GTVQEIIDNQDVRRLYLGDRF 260
           G   EI+ +  VRR+YLG+ F
Sbjct: 242 GHPDEIVGDPAVRRVYLGEHF 262


>gi|22138778|emb|CAD43111.1| hypothetical protein [Pseudomonas stutzeri]
          Length = 241

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 171/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K Y S  VV+ V L ++ G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   AVLKAQHLAKSYKSRQVVRDVSLSIESGQIVGLLGPNGAGKTTCFYMIVGLVNADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID ND+T +PM+ RAR G+ YLPQEASIFR L+V +NI+A+LE  +  D+  R + L+ L
Sbjct: 62  IDQNDVTHLPMHGRARAGMGYLPQEASIFRKLSVADNIMAILETRKDLDRGGRQQALEGL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHINHIRDSLGMSLSGGERRRVEIARALATAPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIG+LITDHNV E L + + AYI++ G ++A G  Q I+ NQ V+ +YLG  F
Sbjct: 182 HLKAKGIGVLITDHNVRETLDICETAYIVNDGQLIAEGDAQSILANQLVKEVYLGHEF 239


>gi|190573139|ref|YP_001970984.1| putative ABC transporter ATP-binding protein [Stenotrophomonas
           maltophilia K279a]
 gi|190011061|emb|CAQ44670.1| putative ABC transporter, ATP-binding protein [Stenotrophomonas
           maltophilia K279a]
          Length = 239

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 163/239 (68%), Gaps = 1/239 (0%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L KKY    VVK   L +  GE+VGLLGPNGAGKTT FYM+ GL+ AD+GSI +
Sbjct: 1   MLVAKGLRKKYKQREVVKDFGLTLDAGEVVGLLGPNGAGKTTCFYMIVGLVAADAGSIVL 60

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLL 143
           DG DIT  PMY RA+ G+ YLPQE S+FR LTV +NI  VLE+ E  D   R  +L+ LL
Sbjct: 61  DGKDITGDPMYTRAKQGVGYLPQEPSVFRKLTVADNIRLVLELREDLDSAGRERELNGLL 120

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            E  +      L   LSGG+RRR EIAR+L + P  ILLDEPFAGVDP+++ +I  ++  
Sbjct: 121 DELQLGHVADQLGASLSGGERRRCEIARALAAQPRLILLDEPFAGVDPISVGEIQRIVTH 180

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  RGIG+LITDHNV E L + DRAYI+  G VLA G+ + I+DN DVRR+YLGD F  
Sbjct: 181 LKQRGIGVLITDHNVRETLGICDRAYILAEGSVLAQGSPEAILDNADVRRVYLGDSFKL 239


>gi|84387808|ref|ZP_00990823.1| ABC transporter, ATP-binding protein [Vibrio splendidus 12B01]
 gi|84377323|gb|EAP94191.1| ABC transporter, ATP-binding protein [Vibrio splendidus 12B01]
          Length = 241

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 176/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A +L K Y+   VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G+I 
Sbjct: 2   AVLKAKNLAKTYSKRKVVTDVSLQVESGQIVGLLGPNGAGKTTSFYMIVGLVARDEGTIS 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           ID  DI+ +PM+ R+RLGI YLPQEASIFR L+VE NI+AVL+   E   ++R +KL+ L
Sbjct: 62  IDDRDISILPMHSRSRLGIGYLPQEASIFRKLSVENNIMAVLQTRDEMTNEQRQDKLEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LEEFHIQHIRTSNGMALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIV 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A GT +++++N+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGHLIAEGTPEDVLNNEQVKQVYLGEQF 239


>gi|264680672|ref|YP_003280582.1| ATP-binding protein of ABC transporter [Comamonas testosteroni
           CNB-2]
 gi|262211188|gb|ACY35286.1| ATP-binding protein of ABC transporter [Comamonas testosteroni
           CNB-2]
          Length = 260

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 132/241 (54%), Positives = 172/241 (71%), Gaps = 6/241 (2%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y S  VVK V L V+ GE+VGLLGPNGAGKTT FYM+ GL+ +D G I ID
Sbjct: 18  LEAKHLAKSYGSRKVVKDVSLSVQKGEVVGLLGPNGAGKTTSFYMIVGLVRSDGGEIFID 77

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR------HEKL 139
           G  +  MP+++R+RLG+SYLPQEASIFR L+VE+N+ AVLE+ + ++ K        ++L
Sbjct: 78  GQPVGGMPIHQRSRLGLSYLPQEASIFRKLSVEDNVRAVLELQKDEQGKTLTRDEIEKRL 137

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
             LL+E  +   R   A  LSGG+RRR+EIAR+L + P +ILLDEPFAG+DP+A+ +I  
Sbjct: 138 TGLLQELRVEHLRQSPALALSGGERRRVEIARALATQPRFILLDEPFAGIDPIAVIEIQR 197

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           +I  L  RGIG+LITDHNV E L + D A+II  G VLA GT +EI++N DVRR+YLG+ 
Sbjct: 198 IIGFLKERGIGVLITDHNVRETLGICDHAFIISDGHVLAEGTPEEIVENADVRRVYLGEH 257

Query: 260 F 260
           F
Sbjct: 258 F 258


>gi|282860202|ref|ZP_06269276.1| ABC transporter, ATP-binding protein [Prevotella bivia JCVIHMP010]
 gi|282587023|gb|EFB92254.1| ABC transporter, ATP-binding protein [Prevotella bivia JCVIHMP010]
          Length = 276

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 126/239 (52%), Positives = 169/239 (70%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L   +L K+Y    V  GV + V+ GEIVGLLGPNGAGKTT FYM TGL+  + G + 
Sbjct: 16  SVLHTENLVKRYGKRTVANGVSINVRQGEIVGLLGPNGAGKTTSFYMTTGLVVPNEGHVY 75

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           ID  +ITK P+Y+RA+ GI YLPQEAS+FR ++VE+NI++VLE+ + +++ R EK++SL+
Sbjct: 76  IDDKEITKYPVYKRAKAGIGYLPQEASVFRKMSVEDNIMSVLEMTKLNREARIEKMESLI 135

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EF + K R  L   LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  
Sbjct: 136 REFRLEKVRKNLGDRLSGGERRRCEIARCLAIDPKFIMLDEPFAGVDPIAVEDIQHIVWR 195

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  R IGILITDHNVHE L + DRAY++  G +L  GT +E+  N+ V+  YLG  F  
Sbjct: 196 LKFRNIGILITDHNVHETLNITDRAYLLFEGRILFKGTPEELASNKVVKEKYLGTDFVL 254


>gi|222055372|ref|YP_002537734.1| ABC transporter [Geobacter sp. FRC-32]
 gi|221564661|gb|ACM20633.1| ABC transporter related [Geobacter sp. FRC-32]
          Length = 246

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 168/240 (70%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
           S ++LL +  L K +N   VV GVDL V  GE++GLLGPNGAGKTT FYMM GL   DSG
Sbjct: 5   SPENLLHSSDLKKSFNRRTVVNGVDLQVASGEVIGLLGPNGAGKTTTFYMMVGLCRPDSG 64

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLD 140
            + ++G DIT+ PMY RAR GISYLPQE S+FR LTVEEN+LAVLE  +  K +   + +
Sbjct: 65  KVFLNGEDITEEPMYVRARKGISYLPQEPSVFRKLTVEENLLAVLETMKLSKSQCRLRAE 124

Query: 141 SLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVL 200
            LL EF IT         LSGG+RRR+EIAR+L + P +ILLDEPFAG+DP+A+ DI  +
Sbjct: 125 ELLTEFRITHIGKSKGFALSGGERRRVEIARALATEPRFILLDEPFAGIDPIAVIDIQNI 184

Query: 201 IRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           I  L  +G+G+LI+DHNV E L + D+AYI++AG VL  G    I +++  R LYLG++F
Sbjct: 185 ITALKGKGLGVLISDHNVRETLGVCDKAYILNAGEVLEFGDPIRIAESKKARELYLGEKF 244


>gi|117926610|ref|YP_867227.1| ABC transporter [Magnetococcus sp. MC-1]
 gi|117610366|gb|ABK45821.1| ABC transporter related protein [Magnetococcus sp. MC-1]
          Length = 250

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 171/245 (69%)

Query: 18  NRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICA 77
           N     S L + SL+K+Y    +V  V + V+PG++VGLLGPNGAGKTT FYM  GL+  
Sbjct: 6   NSGQPTSRLESRSLSKRYQGREIVANVSIGVEPGQVVGLLGPNGAGKTTTFYMFVGLVGP 65

Query: 78  DSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHE 137
           DSGSI ++G DI+  P+++RAR GI+YLPQE S+FR LTV +NIL++LE     ++KR +
Sbjct: 66  DSGSIVLNGRDISAEPVFKRARAGIAYLPQEPSVFRKLTVRDNILSILETLPLGREKRLQ 125

Query: 138 KLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDI 197
           KL+SL+ E  +          LSGG+RRR+E+AR+L   P YILLDEPFAGVDP+A+ DI
Sbjct: 126 KLESLMLELGVAHLARTKGYSLSGGERRRVEVARALAIEPRYILLDEPFAGVDPLAVGDI 185

Query: 198 HVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLG 257
             +IR L  RGIGILITDHNV E L + D +YI+  G VLA G   ++++++ V+++YLG
Sbjct: 186 QSIIRHLKERGIGILITDHNVRETLGICDHSYILSEGRVLASGEPSKVVEDERVKKMYLG 245

Query: 258 DRFAF 262
           + F  
Sbjct: 246 ENFKL 250


>gi|227537506|ref|ZP_03967555.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Sphingobacterium spiritivorum ATCC 33300]
 gi|300770903|ref|ZP_07080780.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Sphingobacterium spiritivorum ATCC 33861]
 gi|227242643|gb|EEI92658.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Sphingobacterium spiritivorum ATCC 33300]
 gi|300762176|gb|EFK58995.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Sphingobacterium spiritivorum ATCC 33861]
          Length = 244

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 168/236 (71%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L KKY    VV  V  +V+ GEIVGLLGPNGAGKTT FYM+ GLI  + G + +
Sbjct: 2   ILKAEHLIKKYKQRVVVNDVSFHVEQGEIVGLLGPNGAGKTTSFYMIVGLIKPNEGHVFL 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           D  +IT   MY+RA+ GI YL QEAS+FR L+VE NILAVLE++  +K++R  KL+ LL 
Sbjct: 62  DDQEITSDAMYQRAQKGIGYLAQEASVFRKLSVENNILAVLEIHYPNKEERLAKLEELLS 121

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF++ + R     LLSGG+RRR EIAR+L + PS+ILLDEPFAGVDP+A+ +I  ++  L
Sbjct: 122 EFSLHRVRKNRGDLLSGGERRRTEIARALAANPSFILLDEPFAGVDPIAVEEIQTIVSKL 181

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            +R IGILITDHNV E L++ DRAY++  G ++  GT +EI DN+  R+ YLG  F
Sbjct: 182 KTRNIGILITDHNVQETLSITDRAYLLTEGKIMLTGTPEEIADNELARKFYLGRHF 237


>gi|186475096|ref|YP_001856566.1| ABC transporter-like protein [Burkholderia phymatum STM815]
 gi|184191555|gb|ACC69520.1| ABC transporter related [Burkholderia phymatum STM815]
          Length = 260

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 173/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 12  AGTSSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 71

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I +DG  I+ +P+++RA LG+SYLPQEAS+FR L+VEENI AVLE+   D  KR  K 
Sbjct: 72  GEIDLDGKSISLLPIHKRASLGLSYLPQEASVFRKLSVEENIRAVLELQVGDDGKRLSKD 131

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL E  I+  R   A  LSGG+RRR+EIAR+L + PS+ILLDEPFAGVDP+A
Sbjct: 132 AIASRTEALLDELQISHLRENPALSLSGGERRRVEIARALATNPSFILLDEPFAGVDPIA 191

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   +II+N+ VRR
Sbjct: 192 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPGDIIENESVRR 251

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 252 VYLGEHF 258


>gi|59710995|ref|YP_203771.1| ABC transporter ATP-binding protein [Vibrio fischeri ES114]
 gi|197335683|ref|YP_002155145.1| ABC transporter ATP-binding protein [Vibrio fischeri MJ11]
 gi|59479096|gb|AAW84883.1| predicted transporter subunit: ATP-binding component of ABC
           superfamily [Vibrio fischeri ES114]
 gi|197317173|gb|ACH66620.1| ABC transporter ATP-binding protein [Vibrio fischeri MJ11]
          Length = 241

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 177/240 (73%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A +L K Y S  VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D GSI 
Sbjct: 2   AILEAKNLAKTYGSRKVVSDVSLTVESGKIVGLLGPNGAGKTTSFYMIVGLVARDEGSIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           IDG DI+  PM+ R+++GI YLPQEASIFR L+V +NI+AVL+  +  +K +R +KL+ L
Sbjct: 62  IDGVDISLQPMHNRSKMGIGYLPQEASIFRKLSVFDNIMAVLQTRKDLNKAERLDKLEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EFNI   R+     LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I+
Sbjct: 122 LDEFNIQHIRNSNGMALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L  RG+G+LITDHNV E L + + AYI+  G ++A+GT + +++++ V+R+YLGD+F  
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEHAYIVSQGHMIANGTPEHVLNDEHVKRVYLGDQFKL 241


>gi|295675416|ref|YP_003603940.1| ABC transporter related protein [Burkholderia sp. CCGE1002]
 gi|295435259|gb|ADG14429.1| ABC transporter related protein [Burkholderia sp. CCGE1002]
          Length = 265

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 172/247 (69%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 17  AGTSSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 76

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR---- 135
           G I +DG  I+ +P+++RA LG+SYLPQEAS+FR LTVE+NI AVLE+   +  KR    
Sbjct: 77  GEIDLDGKSISLLPIHKRASLGLSYLPQEASVFRKLTVEQNIRAVLELQHDENGKRLGKD 136

Query: 136 --HEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
               + ++LL E  I   R   A  LSGG+RRR+EIAR+L + PS+ILLDEPFAGVDP+A
Sbjct: 137 VITSRTEALLDELQIAHLRENPALSLSGGERRRVEIARALATNPSFILLDEPFAGVDPIA 196

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   +II+N+ VRR
Sbjct: 197 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPSDIIENESVRR 256

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 257 VYLGEHF 263


>gi|167855014|ref|ZP_02477788.1| putative ABC transporter ATP-binding protein [Haemophilus parasuis
           29755]
 gi|219870362|ref|YP_002474737.1| ABC transporter ATPase [Haemophilus parasuis SH0165]
 gi|167853862|gb|EDS25102.1| putative ABC transporter ATP-binding protein [Haemophilus parasuis
           29755]
 gi|219690566|gb|ACL31789.1| ABC-type (unclassified) transport system, ATPase component
           [Haemophilus parasuis SH0165]
          Length = 241

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 173/237 (72%), Gaps = 3/237 (1%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y S  VVK V L +K GEIVGLLGPNGAGKTT FYM+ GL+  D G I+ID
Sbjct: 4   LYAEYLAKSYKSRQVVKDVSLNIKSGEIVGLLGPNGAGKTTTFYMVVGLVRHDHGKIRID 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD--KKKRHEKLDSLL 143
             DI+ +PM+ RA+ GI YLPQEASIFR L+V +N++AVL++  KD    +R  + D L+
Sbjct: 64  DQDISVLPMHDRAKQGIGYLPQEASIFRRLSVYDNLMAVLQI-RKDLTDAERQARADELI 122

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            EF+I   RH L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I +
Sbjct: 123 AEFHIEHIRHSLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIVN 182

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RG+G+LITDHNV E L + +RAYI+  G ++A G  QEI+ N+DV+++YLG++F
Sbjct: 183 LKERGLGVLITDHNVRETLDVCERAYIVSNGQMIASGIPQEILHNEDVKKVYLGEQF 239


>gi|71891834|ref|YP_277563.1| ABC transporter ATP-binding protein [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
 gi|71795940|gb|AAZ40691.1| putative transport protein (ABC superfamily, atp_bind) [Candidatus
           Blochmannia pennsylvanicus str. BPEN]
          Length = 241

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 122/240 (50%), Positives = 179/240 (74%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L+  +L+K Y   YVVK + LY+  GEIVGLLGPNG+GKTT FYM+ G++  +SGSI 
Sbjct: 2   TTLTIKNLSKIYKGRYVVKNISLYITSGEIVGLLGPNGSGKTTTFYMILGIVQHNSGSIL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           I   DI+ +P+YRRARLGI YLPQE+SIFR LTV +N++A+L+     + KKR++ +  L
Sbjct: 62  IGEKDISTLPIYRRARLGIGYLPQESSIFRRLTVFDNLMAILQTQRNLNTKKRNKLIIEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           +  F+I+  ++ +   LSGG+R+R+EIAR+L + P +ILLDEPF+GVDP++I+DI  +I+
Sbjct: 122 MNNFHISHLKNNIGQTLSGGERKRVEIARALAANPKFILLDEPFSGVDPISITDIQKIIK 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L +R +G+LITDHNV E L + +RAYI++ G  +AHG+  EI++N+ V+++YLGD F  
Sbjct: 182 QLKTRKLGVLITDHNVRETLRICERAYIVNQGQSIAHGSPNEILNNKHVQQVYLGDIFKL 241


>gi|325473600|gb|EGC76791.1| ABC transporter [Treponema denticola F0402]
          Length = 245

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 129/240 (53%), Positives = 172/240 (71%), Gaps = 1/240 (0%)

Query: 22  KDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGS 81
           K S+L    L K +   + VK V   +  GEIVGLLGPNGAGKTT FYM+ G    +SG+
Sbjct: 4   KKSILKVEGLNKFFRKKHAVKDVGFSMYQGEIVGLLGPNGAGKTTTFYMIVGFYKPNSGN 63

Query: 82  IKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLD 140
           I +DGN IT +PMY+RA  GISYLPQEAS+FR LTVE+NI A+LE  +   K+++ E+L+
Sbjct: 64  IYLDGNSITNLPMYKRAHAGISYLPQEASVFRKLTVEQNIYAILETRKDLSKEQKMERLE 123

Query: 141 SLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVL 200
            LL+EF IT  R   A  LSGG+RRR EIAR+L   P ++LLDEPFAG+DP+A+ DI  +
Sbjct: 124 FLLEEFGITANRKQQAYTLSGGERRRTEIARALAIEPKFLLLDEPFAGIDPIAVHDIKSI 183

Query: 201 IRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +R LA +GIGILITDHNV + L + DRAYII +G ++  G+  EI++++  R++YLG+ F
Sbjct: 184 VRILADQGIGILITDHNVRDTLEITDRAYIIGSGEIVEQGSRDEILNSEVARKIYLGEEF 243


>gi|330818340|ref|YP_004362045.1| ABC-type transporter ATPase [Burkholderia gladioli BSR3]
 gi|327370733|gb|AEA62089.1| ABC-type transporter ATPase [Burkholderia gladioli BSR3]
          Length = 258

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 174/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 10  AGTTSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD------KK 133
           G I ++G+ I+ +P+++RA LG+SYLPQEAS+FR LTVEENI AVLE+   D      K 
Sbjct: 70  GDISLNGSPISLLPIHKRASLGLSYLPQEASVFRKLTVEENIRAVLELQHGDNGKLLGKD 129

Query: 134 KRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
           +   + ++LL E  I   R   A  LSGG+RRR+EIAR+L S PS+ILLDEPFAGVDP+A
Sbjct: 130 EIASRTEALLDELQIGHLRDNPALSLSGGERRRVEIARALASNPSFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G  Q+II+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPQDIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|256419914|ref|YP_003120567.1| ABC transporter [Chitinophaga pinensis DSM 2588]
 gi|256034822|gb|ACU58366.1| ABC transporter related [Chitinophaga pinensis DSM 2588]
          Length = 254

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 166/231 (71%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
            L K+Y    V   V + V  GEIVGLLGPNGAGKTT FYM+ GLI  D G + +D  +I
Sbjct: 9   QLVKRYGHRTVANHVSVEVTQGEIVGLLGPNGAGKTTTFYMVVGLIKPDEGQVYLDEVNI 68

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           TK+PMY+RA++GI YLPQEAS+FR L+VE+NI AVLE+    K ++ EKL+SLL+EF +T
Sbjct: 69  TKLPMYKRAKMGIGYLPQEASVFRKLSVEDNISAVLEMTGLKKAEQKEKLESLLEEFRLT 128

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             R     +LSGG+RRR EIAR+L   P +ILLDEPFAG+DP+A+ DI  ++  L  + I
Sbjct: 129 HVRKSPGDVLSGGERRRTEIARALAVDPKFILLDEPFAGIDPIAVEDIQSIVARLKYKNI 188

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           GILITDHNV E L++ DRAY++  G +L  GT +E+ +++ VR++YLG  F
Sbjct: 189 GILITDHNVQETLSITDRAYLLFEGKILKAGTAEELAEDEQVRKVYLGQNF 239


>gi|119946514|ref|YP_944194.1| ABC transporter ATP-binding protein [Psychromonas ingrahamii 37]
 gi|119865118|gb|ABM04595.1| ABC transporter ATP-binding protein [Psychromonas ingrahamii 37]
          Length = 241

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 169/238 (71%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y    VV GVDL VK GEIVGLLGPNGAGKTT FYM+ GL+  D GSI ID
Sbjct: 4   LIAQGLVKSYKGRTVVNGVDLTVKTGEIVGLLGPNGAGKTTSFYMVVGLVKQDEGSICID 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSLLK 144
           G DI+  PM+ RA+ GI YLPQEASIFR LTV ENI+ +L+   E +  +R EKL++LL 
Sbjct: 64  GEDISHHPMHIRAQKGIGYLPQEASIFRRLTVSENIMGILQTRKELNNTQREEKLNTLLD 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+I+  R+     LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I+ L
Sbjct: 124 EFHISHIRNNKGMSLSGGERRRVEIARALATEPKFILLDEPFAGVDPISVIDIKTIIQHL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            +RG+G+LITDHNV E L +   +YI+  G ++A G   EI+ N  V+++YLG+ F  
Sbjct: 184 RNRGLGVLITDHNVRETLDVCQHSYIVSHGEIIAVGNQDEILANAQVKQVYLGEEFKL 241


>gi|330446806|ref|ZP_08310457.1| lipopolysaccharide export system ATP-binding protein lptB
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328490997|dbj|GAA04954.1| lipopolysaccharide export system ATP-binding protein lptB
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 241

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 173/238 (72%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K YN   VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G+I 
Sbjct: 2   AILKAEHLAKSYNGRKVVSDVSLEVESGKIVGLLGPNGAGKTTSFYMIVGLVARDEGTIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           IDG DI+  PM+ R+R+GI YLPQEASIFR L+V +N++AVL+   E  K++R +K + L
Sbjct: 62  IDGEDISLQPMHNRSRMGIGYLPQEASIFRRLSVYDNLMAVLQTRKELTKEQRQDKAEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EFNI   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LDEFNIQHIRDSLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + + AYI+  G ++A+G+   +++++ V+R+YLGD+F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEHAYIVSQGHLIANGSPDHVLNDEHVKRVYLGDQF 239


>gi|118594085|ref|ZP_01551432.1| ATPase component ABC-type transport system [Methylophilales
           bacterium HTCC2181]
 gi|118439863|gb|EAV46490.1| ATPase component ABC-type transport system [Methylophilales
           bacterium HTCC2181]
          Length = 240

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 169/231 (73%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           ++ K Y    VVK + L V  GE++GLLGPNGAGKTT FYM+ GL+ ++ GSI ID  ++
Sbjct: 8   NIKKSYKKNIVVKDISLTVASGEVIGLLGPNGAGKTTSFYMIVGLVSSEHGSISIDKKNL 67

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           TK+P++ R+++GISYLPQE SIFR +TV+ENIL++LE+ +   K+R  KL+SLL E NI 
Sbjct: 68  TKLPIHHRSKMGISYLPQEPSIFRKMTVKENILSILELRKISDKERDIKLNSLLDELNIQ 127

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             +   A  LSGG+RRR+EIAR L + P +ILLDEPFAG+DP+A+ DI  +I  LAS  I
Sbjct: 128 HIKDSAAISLSGGERRRVEIARCLATDPKFILLDEPFAGIDPIAVLDIQKIIIHLASLNI 187

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           G+LITDHNV E L + DRAYI++ G + A G+  EI+ NQ+V+ +YLG  F
Sbjct: 188 GVLITDHNVRETLGICDRAYIVNQGLIFASGSPSEIVSNQNVKDVYLGKNF 238


>gi|37527892|ref|NP_931237.1| putative ABC transporter ATP-binding protein YhbG [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|36787328|emb|CAE16412.1| Probable ABC transporter ATP-binding protein yhbG [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 241

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 125/238 (52%), Positives = 178/238 (74%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L+A +L K Y    VV+ V L V  GEIVGLLGPNGAGKTT FYM+ G++  D+G+I 
Sbjct: 2   AILNAENLAKAYKGRKVVENVSLNVNSGEIVGLLGPNGAGKTTTFYMVVGIVSRDTGTIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V +N++AVLE+ +   +++R E+ + L
Sbjct: 62  IDNEDISLLPLHERARRGIGYLPQEASIFRRLSVFDNLMAVLEIRQDLTQEQRKERAEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+I+  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I+
Sbjct: 122 MEEFHISHLRDNLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT  +I++N+ V+R+YLG+ F
Sbjct: 182 HLRDYGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGTPNDILNNEQVKRVYLGEGF 239


>gi|254787688|ref|YP_003075117.1| ABC transporter ATP-binding protein [Teredinibacter turnerae T7901]
 gi|237685489|gb|ACR12753.1| ABC transporter, ATP-binding protein [Teredinibacter turnerae
           T7901]
          Length = 241

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 125/236 (52%), Positives = 171/236 (72%), Gaps = 1/236 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LSA  L K Y    VV  V L V  G+IVGLLGPNGAGKTT FYM+ G+I AD G I+I 
Sbjct: 4   LSAQHLAKSYKGRKVVIDVSLSVDSGQIVGLLGPNGAGKTTCFYMIAGIIKADHGDIQIG 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSLLK 144
              +T +PM+ RAR G+ YLPQEAS+FR LTV++NILA+LE   E  + +R E ++ LL+
Sbjct: 64  DKRVTHLPMHERARAGLGYLPQEASVFRKLTVQDNILAILETRKELSRNQRREAMEKLLE 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+I   R+ L   LSGG+RRR+EIAR+L + P ++LLDEPFAGVDP+++SDI  +++ L
Sbjct: 124 EFHIGHIRNSLGMALSGGERRRVEIARALATEPDFVLLDEPFAGVDPISVSDIKQIVQHL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            +RGIG+LITDHNV E L + ++AYI+  G ++A G+  ++++N+ VR +YLG  F
Sbjct: 184 KNRGIGVLITDHNVRETLDICEKAYIVSEGHIIAEGSANDVLNNKKVREVYLGQHF 239


>gi|34540434|ref|NP_904913.1| ABC transporter ATP-binding protein [Porphyromonas gingivalis W83]
 gi|188994533|ref|YP_001928785.1| ABC transporter ATP-binding protein [Porphyromonas gingivalis ATCC
           33277]
 gi|34396747|gb|AAQ65812.1| ABC transporter, ATP-binding protein [Porphyromonas gingivalis W83]
 gi|188594213|dbj|BAG33188.1| ABC transporter ATP-binding protein [Porphyromonas gingivalis ATCC
           33277]
          Length = 251

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 129/236 (54%), Positives = 166/236 (70%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L    L K+Y +  VV  V + V+ GEIVGLLGPNGAGKTT FYM TGL+  + G I +
Sbjct: 8   VLRTEDLVKRYRNRTVVNHVSIEVRQGEIVGLLGPNGAGKTTTFYMTTGLVVPNEGRIFL 67

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           +  DIT+ P+Y+RAR GI YL QEASIFR ++VE+NIL+VLE+    K  +HEKL+SL+ 
Sbjct: 68  NDQDITQYPVYKRARAGIGYLAQEASIFRKMSVEDNILSVLEMAGLPKTYQHEKLESLIA 127

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF++ K R  L   LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  L
Sbjct: 128 EFHLEKVRKNLGDRLSGGERRRAEIARCLAISPRFIMLDEPFAGVDPIAVQDIQAIVAKL 187

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             + IGILITDHNVHE L++ DRAY++  G VL  GT +E+  N+ VR  YLG  F
Sbjct: 188 KDKNIGILITDHNVHETLSITDRAYLLFEGKVLYQGTAEELAANEVVREKYLGRDF 243


>gi|166711212|ref|ZP_02242419.1| ABC transporter ATP-binding protein [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 239

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 167/237 (70%), Gaps = 1/237 (0%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L KKY    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GL+ AD+G I++
Sbjct: 1   MLVATGLRKKYKQREVVKEFGLTLEAGEVVGLLGPNGAGKTTCFYMIVGLVEADAGRIEL 60

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLL 143
           DG ++T  PMY RA+LG+ YLPQE SIFR LTV +NI  VLE+ E+ D   R ++L SLL
Sbjct: 61  DGRNLTAEPMYARAKLGVGYLPQEPSIFRKLTVADNIRLVLELREELDNAGRAKELVSLL 120

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +E  IT     L   LSGG+RRR EIAR+L + P  +LLDEPFAGVDP+++ +I  +I  
Sbjct: 121 EELQITHVADQLGASLSGGERRRCEIARALAAKPRMMLLDEPFAGVDPISVGEIQRIIIH 180

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L + DRAYI+  GGVLA G    ++ N DVRR+YLGD F
Sbjct: 181 LKERGIGVLITDHNVRETLGICDRAYILAEGGVLAQGAPDTLLANPDVRRVYLGDTF 237


>gi|261344902|ref|ZP_05972546.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Providencia rustigianii DSM 4541]
 gi|282567042|gb|EFB72577.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Providencia rustigianii DSM 4541]
          Length = 241

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 176/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L+A  L K Y    VV+ V L VK GEIVGLLGPNGAGKTT FYM+ G++  D+G I 
Sbjct: 2   ATLTAEHLAKSYKKRNVVEDVSLEVKSGEIVGLLGPNGAGKTTTFYMVVGIVQRDAGKIL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           IDG DI+ +P++ RAR GI YLPQEASIFR L+V +N++AVLE+    D ++R ++ + L
Sbjct: 62  IDGEDISLLPLHERARRGIGYLPQEASIFRRLSVYDNLMAVLEIRSDLDSQQRKDRAEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+IT  R  +   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I+
Sbjct: 122 MEEFSITHLRDNIGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVLDIKKIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT + I++N+ V+R+YLG+ F
Sbjct: 182 HLRDYGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGTPEMILENEQVKRVYLGEGF 239


>gi|238758315|ref|ZP_04619493.1| Uncharacterized ABC transporter ATP-binding protein [Yersinia
           aldovae ATCC 35236]
 gi|238703438|gb|EEP95977.1| Uncharacterized ABC transporter ATP-binding protein [Yersinia
           aldovae ATCC 35236]
          Length = 241

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 172/238 (72%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y    VV+ V L VK GEIVGLLGPNGAGKTT FYM+ G++  D+G I 
Sbjct: 2   ATLIAEKLAKAYKGRKVVEDVSLNVKSGEIVGLLGPNGAGKTTTFYMVVGIVQRDAGRIV 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V  N++AVLE+ +    ++R E+ D L
Sbjct: 62  IDDEDISLLPLHERARRGIGYLPQEASIFRRLSVFNNLMAVLEIRKDLSTEQRQERADEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+IT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 MEEFHITHLRDSLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT QEI+ ++ V+R+YLG+ F
Sbjct: 182 HLRDSGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGTPQEILADEQVKRVYLGEEF 239


>gi|197124680|ref|YP_002136631.1| ABC transporter [Anaeromyxobacter sp. K]
 gi|196174529|gb|ACG75502.1| ABC transporter-related protein [Anaeromyxobacter sp. K]
          Length = 255

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 127/241 (52%), Positives = 165/241 (68%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A  D+LL A  L K Y    VV GV  +V PGE+VGLLGPNGAGKTT F M+ GL+  + 
Sbjct: 4   AGGDALLRAEGLVKSYRGRRVVDGVSFHVAPGEVVGLLGPNGAGKTTSFNMVVGLVVPER 63

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G + +  +D+T++PM+RRARLG+ YLPQEASIFR LTV +N + VLE     + +R+E+ 
Sbjct: 64  GKVTLGEHDLTRLPMHRRARLGVGYLPQEASIFRKLTVRQNFVGVLEALGVGRAERNERA 123

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
            +LL E+ + K    L   LSGG+RRR E+ARSL+S P YIL DEPFAGVDP+A+ ++  
Sbjct: 124 AALLAEYRLEKVADSLGEQLSGGERRRAEVARSLLSSPRYILFDEPFAGVDPIAVGELQR 183

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           LI  L  RGIG+LITDHNV E L +  RAYI+ +G +L  GT  EI  +   R +YLGD+
Sbjct: 184 LIGGLRDRGIGVLITDHNVREALGICGRAYILSSGSILEQGTPVEIAASPRARAVYLGDK 243

Query: 260 F 260
           F
Sbjct: 244 F 244


>gi|58580908|ref|YP_199924.1| ABC transporter ATP-binding protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84622841|ref|YP_450213.1| ABC transporter ATP-binding protein [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|188578113|ref|YP_001915042.1| ABC transporter ATP-binding protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|58425502|gb|AAW74539.1| ABC transporter ATP-binding protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84366781|dbj|BAE67939.1| ABC transporter ATP-binding protein [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|188522565|gb|ACD60510.1| ABC transporter ATP-binding protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 239

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 167/237 (70%), Gaps = 1/237 (0%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L KKY    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GL+ AD+G I++
Sbjct: 1   MLVATGLRKKYKQREVVKEFGLTLEAGEVVGLLGPNGAGKTTCFYMIVGLVEADAGRIEL 60

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLL 143
           DG D+T  PMY RA+LG+ YLPQE SIFR LTV +NI  VLE+ E+ D   R ++L SLL
Sbjct: 61  DGRDLTAEPMYARAKLGVGYLPQEPSIFRKLTVADNIRLVLELREELDNAGRAKELVSLL 120

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +E  IT     L   LSGG+RRR EIAR+L + P  +LLDEPFAGVDP+++ +I  +I  
Sbjct: 121 EELQITHVADQLGASLSGGERRRCEIARALAAKPRMMLLDEPFAGVDPISVGEIQRIIIH 180

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L + DRAYI+  GGVLA G    ++ N DVRR+YLG+ F
Sbjct: 181 LKERGIGVLITDHNVRETLGICDRAYILAEGGVLAQGAPDMLLANPDVRRVYLGETF 237


>gi|238785093|ref|ZP_04629088.1| Uncharacterized ABC transporter ATP-binding protein [Yersinia
           bercovieri ATCC 43970]
 gi|238713985|gb|EEQ06002.1| Uncharacterized ABC transporter ATP-binding protein [Yersinia
           bercovieri ATCC 43970]
          Length = 241

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 131/239 (54%), Positives = 173/239 (72%), Gaps = 3/239 (1%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y    VV+ V L VK GEIVGLLGPNGAGKTT FYM+ G++  D+G I 
Sbjct: 2   ATLIAEKLAKAYKGRKVVEDVSLSVKSGEIVGLLGPNGAGKTTTFYMVVGIVQRDAGRIV 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD--KKKRHEKLDS 141
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V  N++AVLE+  KD   ++R E+ D 
Sbjct: 62  IDDEDISLLPLHERARRGIGYLPQEASIFRRLSVFNNLMAVLEI-RKDLTAEQRQERADE 120

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           L++EF+IT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I
Sbjct: 121 LMEEFHITHLRDSLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKII 180

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             L   G+G+LITDHNV E L + +RAYI+  G ++AHGT QEI+ ++ V+R+YLG+ F
Sbjct: 181 EHLRDSGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGTPQEILADEQVKRVYLGEEF 239


>gi|71897586|ref|ZP_00679831.1| ABC transporter [Xylella fastidiosa Ann-1]
 gi|71732489|gb|EAO34542.1| ABC transporter [Xylella fastidiosa Ann-1]
          Length = 240

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 167/238 (70%), Gaps = 2/238 (0%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L K+Y    VV+   L ++PGEIVGLLGPNGAGKTT FYM+ GL+  D+G I++
Sbjct: 1   MLVASGLRKRYKHREVVREFGLTLQPGEIVGLLGPNGAGKTTCFYMIVGLVNTDAGRIEL 60

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYE--KDKKKRHEKLDSL 142
           DG DIT  PM+ RA+LG+ YLPQE S+FR L+V +NI  VLE+ +  K  + R  +LDSL
Sbjct: 61  DGRDITAAPMHARAQLGVGYLPQEPSVFRKLSVTDNIRLVLELRQDLKTNQARQHELDSL 120

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L E  I+     L   LSGG+RRR EIAR+L + P  +LLDEPFAGVDP+++ +I  +I 
Sbjct: 121 LNELQISHVADQLGASLSGGERRRCEIARALAAQPRMMLLDEPFAGVDPISVGEIQRIIT 180

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIG+LITDHNV E L + +RAYI+  GGVLA GT   ++ N DVRR+YLG+ F
Sbjct: 181 HLKERGIGVLITDHNVRETLGICNRAYILAEGGVLAQGTPDALLTNTDVRRVYLGETF 238


>gi|325268717|ref|ZP_08135346.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Prevotella multiformis DSM
           16608]
 gi|324988961|gb|EGC20915.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Prevotella multiformis DSM
           16608]
          Length = 284

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 168/239 (70%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L    L K+Y    V  GV ++V+ GEIVGLLGPNGAGKTT FYM TGL+  + G + 
Sbjct: 22  SVLRTEKLVKRYGKRTVANGVSIHVRQGEIVGLLGPNGAGKTTSFYMTTGLVVPNEGHVY 81

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           ID  +IT  P+Y+RAR GI YLPQEAS+FR ++VE+NI++VLE+ +  K++R +K+++L+
Sbjct: 82  IDDREITNFPVYKRARAGIGYLPQEASVFRKMSVEDNIMSVLEMTKLSKQERIDKMEALI 141

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EF + K R  L   LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  
Sbjct: 142 REFRLEKVRRNLGDRLSGGERRRCEIARCLAIDPKFIMLDEPFAGVDPIAVEDIQHIVWR 201

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  R IGILITDHNVHE L + DRAY++  G +L  GT +E+  N+ V+  YLG  F  
Sbjct: 202 LKFRNIGILITDHNVHETLNITDRAYLLFEGRILFKGTPEELAANKIVKEKYLGTDFVL 260


>gi|237756118|ref|ZP_04584692.1| ABC transporter [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237691722|gb|EEP60756.1| ABC transporter [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 243

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 129/239 (53%), Positives = 168/239 (70%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   ++ K + +  VV GV LY +  EIVGLLGPNGAGKTT F  + G +  + GS+ 
Sbjct: 4   SRLELKNIEKSFKNRTVVNGVSLYAEEREIVGLLGPNGAGKTTTFKCLLGFLKPEKGSVL 63

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           ++G DIT +P++ RA+ GIS+LPQE+SIFR LTV +N++  LE       +   K   LL
Sbjct: 64  LNGEDITDLPVWERAKKGISFLPQESSIFRDLTVWDNLMMFLEFQNLTVSEMTSKAQELL 123

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           KEFNI   +H  A  LSGG+RRRLEIARSL+  PS++LLDEPFAGVDPV++ DI+ LI  
Sbjct: 124 KEFNIDHLKHQKASTLSGGERRRLEIARSLIINPSFLLLDEPFAGVDPVSVKDINQLILS 183

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L SR IGI+ITDHNV E L + DRAYII  G V+A GT QEI++NQ+V+R++LG+ F  
Sbjct: 184 LKSRNIGIIITDHNVRETLKITDRAYIIAHGRVIAEGTPQEIVENQEVKRVFLGEDFVL 242


>gi|294625296|ref|ZP_06703934.1| ABC transporter ATP-binding protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294665381|ref|ZP_06730670.1| ABC transporter ATP-binding protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292600417|gb|EFF44516.1| ABC transporter ATP-binding protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292604840|gb|EFF48202.1| ABC transporter ATP-binding protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 239

 Score =  258 bits (659), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 132/237 (55%), Positives = 167/237 (70%), Gaps = 1/237 (0%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L KKY    VV+   L ++ GE+VGLLGPNGAGKTT FYM+ GL+ AD+G I++
Sbjct: 1   MLVATGLRKKYKQREVVREFGLTLEAGEVVGLLGPNGAGKTTCFYMIVGLVEADAGRIEL 60

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLL 143
           DG D+T  PMY RA+LG+ YLPQE SIFR LTV +NI  VLE+ E+ D   R ++L SLL
Sbjct: 61  DGRDLTAEPMYARAKLGVGYLPQEPSIFRKLTVADNIRLVLELREELDNAGREKELVSLL 120

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +E  IT     L   LSGG+RRR EIAR+L + P  +LLDEPFAGVDP+++ +I  +I  
Sbjct: 121 EELQITHVADQLGASLSGGERRRCEIARALAAKPRMMLLDEPFAGVDPISVGEIQRIIIH 180

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L + DRAYI+  GGVLA G    ++ N DVRR+YLG+ F
Sbjct: 181 LKERGIGVLITDHNVRETLGICDRAYILAEGGVLAQGAPDTLLANPDVRRVYLGETF 237


>gi|257462578|ref|ZP_05626988.1| ABC transporter ATP-binding protein [Fusobacterium sp. D12]
 gi|317060230|ref|ZP_07924715.1| ABC transporter ATP-binding protein [Fusobacterium sp. D12]
 gi|313685906|gb|EFS22741.1| ABC transporter ATP-binding protein [Fusobacterium sp. D12]
          Length = 241

 Score =  258 bits (659), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 129/235 (54%), Positives = 167/235 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L+A +L K Y    VV  V L V  GEIVGLLGPNGAGKTT FYM+TG+I  ++GS+  +
Sbjct: 4   LTARNLVKAYKQRKVVDSVSLEVNKGEIVGLLGPNGAGKTTTFYMITGIIKPNAGSVICN 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G +IT  PMY+RA LGI YL QE S+FR LTVE+NI AVLE+    KK + E +  LL+E
Sbjct: 64  GQEITSYPMYKRANLGIGYLAQEPSVFRNLTVEDNIRAVLEMKNYSKKTQKEIVAKLLEE 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T     L   LSGG+RRR+EIAR++ + PS+ILLDEPFAGVDP+A+ DI   IR L 
Sbjct: 124 FKLTHVYQSLGYSLSGGERRRVEIARTIANNPSFILLDEPFAGVDPIAVEDIQQSIRYLQ 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            RG+GILITDH+V E L + ++AYI+  G V+  G+ QEI +N+  R++YLG+ F
Sbjct: 184 KRGLGILITDHSVRETLNITEKAYIMAQGKVIISGSPQEIAENEMARKIYLGENF 238


>gi|225849237|ref|YP_002729401.1| ABC transporter [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643479|gb|ACN98529.1| ABC transporter [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 243

 Score =  258 bits (659), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 171/239 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   ++ K +    VV GV LY + GEIVGLLGPNGAGKTT F  + G +  D G++ 
Sbjct: 4   SKLELKNIEKSFKGRTVVAGVSLYAEEGEIVGLLGPNGAGKTTTFKCLLGFLKPDRGNVV 63

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           ++G DIT +P+Y+RA+ GIS+LPQE+SIFR LTV EN++  LE  +    +R  K   LL
Sbjct: 64  LNGEDITNLPVYKRAKKGISFLPQESSIFRDLTVWENLMMFLEFQDISPSERERKAKDLL 123

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EF+I   +   A  LSGG+RRRLEIARSL++ PS++LLDEPFAGVDPV++ +I+ LI+ 
Sbjct: 124 EEFHILHLKDQKASTLSGGERRRLEIARSLITNPSFLLLDEPFAGVDPVSVKEINSLIKS 183

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  + IG++ITDHNV E L + DRAYII  G V+A GT QEI++N++VR+++LG+ F  
Sbjct: 184 LVEKEIGVIITDHNVRETLKITDRAYIIAHGKVIAEGTPQEIVENEEVRKVFLGEDFVL 242


>gi|78067589|ref|YP_370358.1| ABC transporter, ATPase subunit [Burkholderia sp. 383]
 gi|77968334|gb|ABB09714.1| ABC transporter, ATPase subunit [Burkholderia sp. 383]
          Length = 258

 Score =  258 bits (659), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 135/247 (54%), Positives = 173/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 10  AGTTSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I ++G+ I+ +P+++RA LG+SYLPQEAS+FR LTVEENI AVLE+   +  KR  K 
Sbjct: 70  GEISLNGSSISLLPIHKRASLGLSYLPQEASVFRKLTVEENIRAVLELQHGEDGKRLSKD 129

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL E  I   R   A  LSGG+RRR+EIAR+L + P++ILLDEPFAGVDP+A
Sbjct: 130 AISSRAEALLDELQIGHLRENPALSLSGGERRRVEIARALATNPNFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   EII+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPSEIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|28198546|ref|NP_778860.1| ABC transporter ATP-binding protein [Xylella fastidiosa Temecula1]
 gi|182681226|ref|YP_001829386.1| ABC transporter related [Xylella fastidiosa M23]
 gi|28056630|gb|AAO28509.1| ABC transporter ATP-binding protein [Xylella fastidiosa Temecula1]
 gi|182631336|gb|ACB92112.1| ABC transporter related [Xylella fastidiosa M23]
 gi|307579673|gb|ADN63642.1| ABC transporter related protein [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 240

 Score =  258 bits (659), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 167/238 (70%), Gaps = 2/238 (0%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L K+Y    VV+   L ++PGEIVGLLGPNGAGKTT FYM+ GL+  D+G I++
Sbjct: 1   MLVASGLRKRYKHREVVREFGLTLQPGEIVGLLGPNGAGKTTCFYMIVGLVNTDAGRIEL 60

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYE--KDKKKRHEKLDSL 142
           DG DIT  PM+ RA+LG+ YLPQE S+FR L+V +NI  VLE+ +  K  + R  +LDSL
Sbjct: 61  DGRDITAAPMHARAQLGVGYLPQEPSVFRKLSVTDNIRLVLELRQDLKTNQARQHELDSL 120

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L E  I+     L   LSGG+RRR EIAR+L + P  +LLDEPFAGVDP+++ +I  +I 
Sbjct: 121 LNELQISHVAGQLGASLSGGERRRCEIARALAAQPRMMLLDEPFAGVDPISVGEIQRIIT 180

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIG+LITDHNV E L + +RAYI+  GGVLA GT   ++ N DVRR+YLG+ F
Sbjct: 181 HLKERGIGVLITDHNVRETLGICNRAYILAEGGVLAQGTPDALLTNTDVRRVYLGETF 238


>gi|332531901|ref|ZP_08407785.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038528|gb|EGI74971.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 241

 Score =  258 bits (659), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 130/238 (54%), Positives = 173/238 (72%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A  L K Y    VVK V L V+ G IVGLLGPNGAGKTT FYM+ GL+ +D G I 
Sbjct: 2   STLKAELLAKSYKGREVVKNVGLEVQAGSIVGLLGPNGAGKTTTFYMIVGLVPSDKGKIS 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID NDIT +PM+ RARLGI YLPQE+SIFR LTV +N++A+LE   E +K+ R + L++L
Sbjct: 62  IDDNDITLLPMHSRARLGIGYLPQESSIFRKLTVYQNLMAILETRKELNKQAREDTLNNL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EF+I   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LDEFSIQHIRDSQGMALSGGERRRVEIARALAADPKFILLDEPFAGVDPISVLDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L +RGIG+LITDHNV E L + ++AYI+  G ++A GT + +++++ VR +YLG++F
Sbjct: 182 HLKNRGIGVLITDHNVRETLDVCEKAYIVSHGELIASGTPEHVLNDKTVRDVYLGEQF 239


>gi|212711081|ref|ZP_03319209.1| hypothetical protein PROVALCAL_02150 [Providencia alcalifaciens DSM
           30120]
 gi|212686249|gb|EEB45777.1| hypothetical protein PROVALCAL_02150 [Providencia alcalifaciens DSM
           30120]
          Length = 241

 Score =  258 bits (659), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 178/238 (74%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L+A +L K Y    VV  V L VK GEIVGLLGPNGAGKTT FYM+ G++  D+G I 
Sbjct: 2   ATLTAENLAKSYKKRSVVTDVSLEVKSGEIVGLLGPNGAGKTTTFYMVVGIVQRDAGKIL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           IDG DI+ +P++ RAR GI YLPQEASIFR L+V +N++AVLE+ ++ + ++R E+ + L
Sbjct: 62  IDGEDISLLPLHERARRGIGYLPQEASIFRRLSVYDNLMAVLEIRHDLNSEQRKERAEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+IT  R  +   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I+
Sbjct: 122 MEEFSITHLRDNVGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVLDIKKIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHG+ + I++N+ V+R+YLG+ F
Sbjct: 182 HLRDYGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGSPEMILENEQVKRVYLGEGF 239


>gi|171464191|ref|YP_001798304.1| ABC transporter related [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|171193729|gb|ACB44690.1| ABC transporter related [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 255

 Score =  258 bits (659), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 171/247 (69%), Gaps = 5/247 (2%)

Query: 19  RASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICAD 78
           +A+    LSA +L K+Y S  VV+ V + V+ GE+VGLLGPNGAGKTT FYM+ GL+  D
Sbjct: 7   QANNAPTLSAHNLQKRYGSRTVVRDVSVQVRCGEVVGLLGPNGAGKTTSFYMIVGLVPLD 66

Query: 79  SGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-----DKK 133
            G+I +DG DIT +P++ RAR+G+SYLPQEAS+FR L V ENI AVLE+  +      K 
Sbjct: 67  GGNIVLDGADITHLPIHERARMGLSYLPQEASVFRKLNVAENIQAVLELQVQGGKPLSKA 126

Query: 134 KRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
           +   +LD LL E  I+  R+  A  LSGG+RRR+E AR+L S P +ILLDEPFAGVDP+A
Sbjct: 127 EIANRLDELLGELQISHLRNNPALSLSGGERRRVETARALASQPKFILLDEPFAGVDPIA 186

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  ++R L  R IG+LITDHNV E L + D AYII  G VLA G   +II N  VRR
Sbjct: 187 VGEIQRIVRFLRDRQIGVLITDHNVRETLGICDHAYIISEGSVLAEGKPDQIIQNDAVRR 246

Query: 254 LYLGDRF 260
            YLG+ F
Sbjct: 247 FYLGENF 253


>gi|119469166|ref|ZP_01612150.1| putative transport protein (ABC superfamily, atp-binding protein)
           [Alteromonadales bacterium TW-7]
 gi|119447418|gb|EAW28686.1| putative transport protein (ABC superfamily, atp-binding protein)
           [Alteromonadales bacterium TW-7]
          Length = 241

 Score =  258 bits (659), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 172/238 (72%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A  L K Y    VVK V L VK G IVGLLGPNGAGKTT FYM+ GL+ +D G I 
Sbjct: 2   STLKAELLAKSYKGREVVKNVGLEVKAGSIVGLLGPNGAGKTTTFYMIVGLVPSDKGKIS 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID NDIT +PM+ RARLGI YLPQE+SIFR LTV +N++A+LE   E  K+ R + L++L
Sbjct: 62  IDDNDITLLPMHSRARLGIGYLPQESSIFRKLTVYQNLMAILETRKELTKQAREDTLNNL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EF+I   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LDEFSIQHIRDSKGMALSGGERRRVEIARALAADPKFILLDEPFAGVDPISVLDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L +RGIG+LITDHNV E L + ++AYI+  G ++A GT + +++++ VR +YLG++F
Sbjct: 182 HLKNRGIGVLITDHNVRETLDVCEKAYIVSHGELIASGTPEHVLNDKTVRDVYLGEQF 239


>gi|219815992|gb|ACL37110.1| ABC transporter ATP-binding protein [uncultured bacterium fCS1]
          Length = 274

 Score =  258 bits (659), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 170/238 (71%)

Query: 23  DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSI 82
           D  +   +L K Y S  VV  V   VK GEIVGLLGPNGAGKTT FY + GL+  DSG +
Sbjct: 12  DLTIQTNNLVKIYGSRTVVNDVSFNVKQGEIVGLLGPNGAGKTTSFYQVVGLVKPDSGEV 71

Query: 83  KIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSL 142
            ++  +IT +PMY+RA++GI YLPQEAS+FR L+VE+NI+AVLE+ +  K+++ +KL+ L
Sbjct: 72  FLNDINITNLPMYKRAKMGIGYLPQEASVFRKLSVEDNIMAVLEMTDLSKQEQKDKLERL 131

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF + K R      LSGG+RRR EIAR+L   P + LLDEPFAGVDP+A+ DI  ++ 
Sbjct: 132 LEEFRLQKVRKNNGDTLSGGERRRTEIARALAVDPKFFLLDEPFAGVDPIAVEDIQGIVA 191

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  + IGILITDHNV+E L++ DRAY++  G +  HGT +E+ +++ VRRLYLG  F
Sbjct: 192 RLKFQNIGILITDHNVNETLSICDRAYLLIDGKIFKHGTAEELANDEQVRRLYLGRNF 249


>gi|171318644|ref|ZP_02907790.1| ABC transporter related [Burkholderia ambifaria MEX-5]
 gi|171096152|gb|EDT41075.1| ABC transporter related [Burkholderia ambifaria MEX-5]
          Length = 258

 Score =  258 bits (659), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 135/247 (54%), Positives = 172/247 (69%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 10  AGATSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I ++G+ I+ +P+++RA LG+SYLPQEAS+FR LTVEENI AVLE+   +  KR  K 
Sbjct: 70  GEISLNGSSISLLPIHKRASLGLSYLPQEASVFRKLTVEENIRAVLELQHGEDGKRLSKD 129

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 + LL E  I   R   A  LSGG+RRR+EIAR+L + P++ILLDEPFAGVDP+A
Sbjct: 130 AIAARTEELLDELQIGHLRENPALSLSGGERRRVEIARALATSPNFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   EII+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPSEIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|315633786|ref|ZP_07889076.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Aggregatibacter segnis ATCC 33393]
 gi|315477828|gb|EFU68570.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Aggregatibacter segnis ATCC 33393]
          Length = 241

 Score =  258 bits (659), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 132/241 (54%), Positives = 174/241 (72%), Gaps = 3/241 (1%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A +L K Y +  VV  V L V  GEIVGLLGPNGAGKTT FYM+ GL+  D G I+
Sbjct: 2   AILYAENLAKSYKNRQVVSDVSLTVHSGEIVGLLGPNGAGKTTTFYMVVGLVNHDQGKIR 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKK--KRHEKLDS 141
           ID  DI+ +PM+ RA+ G+ YLPQEASIFR L+V EN++AVLE+  KD    +R EK D 
Sbjct: 62  IDDEDISLLPMHNRAQKGVGYLPQEASIFRRLSVYENLMAVLEI-RKDLTALQRQEKADE 120

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           L++EFNI   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I
Sbjct: 121 LIEEFNIGHIRDSLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKII 180

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
           +DL  RG+G+LITDHNV E L + +RAYI+ +G ++A GT  EI++N+ V+ +YLG  F 
Sbjct: 181 KDLRDRGLGVLITDHNVRETLDVCERAYIVSSGKMIATGTPTEIMNNKLVKDVYLGADFQ 240

Query: 262 F 262
            
Sbjct: 241 L 241


>gi|254440199|ref|ZP_05053693.1| ABC transporter, ATP-binding protein, putative [Octadecabacter
           antarcticus 307]
 gi|198255645|gb|EDY79959.1| ABC transporter, ATP-binding protein, putative [Octadecabacter
           antarcticus 307]
          Length = 254

 Score =  258 bits (659), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 177/238 (74%)

Query: 23  DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSI 82
           D  L   +L K Y    V++ V L + PGE+V LLGPNG+GKTT FY + GL+  ++G++
Sbjct: 14  DVGLKVVNLRKSYRKRMVIRDVSLELGPGEVVALLGPNGSGKTTCFYAIAGLVTPEAGNV 73

Query: 83  KIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSL 142
            +DG D+T +PMYRRA+LGI YLPQE SIFRGL+VE+NILA+LE+ E+D+ +R E+L+ L
Sbjct: 74  IVDGRDVTSLPMYRRAKLGIGYLPQEMSIFRGLSVEDNILAILEIAERDRTRRRERLEEL 133

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EF+I   R   A  LSGG+RRR EIAR L + P Y+LLDEPFAGVDP+A+ +I  L  
Sbjct: 134 LSEFSIEHLRRAPAMALSGGERRRAEIARCLAADPKYVLLDEPFAGVDPIAVDEIRHLTA 193

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           DL +RGIG+LITDHNV E L ++DRAYI+H G +L  GT  E++ +++VRR+YLG+ F
Sbjct: 194 DLKNRGIGVLITDHNVQETLQIVDRAYILHDGKILMSGTTDEVVRDENVRRVYLGNSF 251


>gi|225851381|ref|YP_002731615.1| ABC transporter [Persephonella marina EX-H1]
 gi|225646218|gb|ACO04404.1| ABC transporter [Persephonella marina EX-H1]
          Length = 244

 Score =  258 bits (659), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 128/239 (53%), Positives = 170/239 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L    + K+Y    V+ G+ LYVK GEIVGLLGPNGAGKTT F  + G I  D G I+
Sbjct: 5   SVLEVDRIKKRYKDRTVIDGISLYVKEGEIVGLLGPNGAGKTTTFRCLLGFIKPDEGRIR 64

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           ++G DIT +P+Y RA+ GIS+LPQE+SIFR LTV EN+   L+   +D  +  EK  +LL
Sbjct: 65  LNGEDITDLPVYERAKKGISFLPQESSIFRDLTVWENVAMFLQFRTEDPVEIEEKGRALL 124

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           ++F I   +   A  LSGG+RRRLEIARSLV  PS++LLDEPFAGVDPV++ DI+ LI+D
Sbjct: 125 EDFGIYHLKDQKASTLSGGERRRLEIARSLVINPSFLLLDEPFAGVDPVSVKDINNLIKD 184

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  R IG+++TDHNV E L + DRAYII  G V++ GT QEI+++  VR+++LG+ F  
Sbjct: 185 LVKRDIGVIVTDHNVRETLKITDRAYIIAHGKVISEGTPQEIVNDPTVRKIFLGEDFTL 243


>gi|189218923|ref|YP_001939564.1| ABC transporter ATPase [Methylacidiphilum infernorum V4]
 gi|189185781|gb|ACD82966.1| ABC-type (unclassified) transport system, ATPase component
           [Methylacidiphilum infernorum V4]
          Length = 223

 Score =  258 bits (659), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 119/223 (53%), Positives = 166/223 (74%)

Query: 40  VVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYRRAR 99
           +V G+DL V  GEIVGLLGPNGAGKTT FYM+ GL+    G + +D  D+T MPMY+RAR
Sbjct: 1   MVNGIDLVVNRGEIVGLLGPNGAGKTTTFYMLVGLVMPTKGKVYLDNEDVTTMPMYKRAR 60

Query: 100 LGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITKWRHVLAPLL 159
            G+ YLPQE S+FR LTVEEN++A+LE  +  K++R  +L++L+ +F + K +  LA  L
Sbjct: 61  KGLGYLPQEDSVFRKLTVEENLMAILEFLDISKEERLRRLETLIHDFGLEKVKKTLAMSL 120

Query: 160 SGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIGILITDHNVH 219
           SGG++RRL IAR+L + PS +LLDEPF+GVDP+A+ D+  L+  L  RG+ +LITDHNV 
Sbjct: 121 SGGEKRRLSIARALTTSPSILLLDEPFSGVDPLAVYDLQQLVLSLKERGVSVLITDHNVR 180

Query: 220 EILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           E L+++DRAY+I+ G V++HGT + +I++   R LYLG RF+ 
Sbjct: 181 ETLSIVDRAYLIYEGKVMSHGTSEFLINDPVTRELYLGPRFSM 223


>gi|257467999|ref|ZP_05632095.1| ABC transporter ATP-binding protein [Fusobacterium ulcerans ATCC
           49185]
 gi|317062285|ref|ZP_07926770.1| ABC transporter ATP-binding protein [Fusobacterium ulcerans ATCC
           49185]
 gi|313687961|gb|EFS24796.1| ABC transporter ATP-binding protein [Fusobacterium ulcerans ATCC
           49185]
          Length = 241

 Score =  258 bits (659), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 169/237 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L K Y    VV  V L V  GEIVGLLGPNGAGKTT FYM+TG+I  +SG +  D
Sbjct: 4   LVAQNLCKSYKKRTVVDNVSLEVNKGEIVGLLGPNGAGKTTTFYMITGIIKPESGKVYCD 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             D+T  PM++RA LGI YL QE S+FR LTVEENI AVLE+     K++ E ++ L++E
Sbjct: 64  NADVTTYPMFKRANLGIGYLAQEPSVFRNLTVEENIAAVLEMKGIAPKEQQEIIEKLMEE 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T  R  L   LSGG+RRR+EIAR++ + PS+ILLDEPFAGVDP+A+ DI  +IR L 
Sbjct: 124 FKLTHVRKSLGYSLSGGERRRIEIARTIANNPSFILLDEPFAGVDPIAVEDIQQIIRYLR 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           +RG+GILITDH+V E L + ++AYI+  G VL  GT +EI +++  R++YLG++F  
Sbjct: 184 NRGLGILITDHSVRETLRITEKAYIMANGKVLISGTPEEISNDETARKIYLGEKFKL 240


>gi|209519655|ref|ZP_03268445.1| ABC transporter related [Burkholderia sp. H160]
 gi|209499941|gb|EEA00007.1| ABC transporter related [Burkholderia sp. H160]
          Length = 265

 Score =  258 bits (659), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 135/247 (54%), Positives = 172/247 (69%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 17  AGTSSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 76

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I +DG  I+ +P+++RA LG+SYLPQEAS+FR L+VEENI AVLE+   +  KR  K 
Sbjct: 77  GEIDLDGKPISLLPIHKRASLGLSYLPQEASVFRKLSVEENIRAVLELQVDENGKRLSKD 136

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL E  I   R   A  LSGG+RRR+EIAR+L + PS+ILLDEPFAGVDP+A
Sbjct: 137 VITSRTEALLDELQIAHLRENPALSLSGGERRRVEIARALATNPSFILLDEPFAGVDPIA 196

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   +II+N+ VRR
Sbjct: 197 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPSDIIENESVRR 256

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 257 VYLGEHF 263


>gi|209694094|ref|YP_002262022.1| ABC transport protein, ATP-binding component [Aliivibrio
           salmonicida LFI1238]
 gi|208008045|emb|CAQ78184.1| ABC transport protein, ATP-binding component [Aliivibrio
           salmonicida LFI1238]
          Length = 241

 Score =  258 bits (659), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 176/240 (73%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A +L K Y S  VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D GSI 
Sbjct: 2   AILEAKNLAKTYGSRKVVSDVSLTVESGKIVGLLGPNGAGKTTSFYMIVGLVSRDEGSIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           IDG DI+  PM+ R+++GI YLPQEASIFR L+V +NI+AVL+  +   K +R +KL+ L
Sbjct: 62  IDGVDISLQPMHNRSKMGIGYLPQEASIFRKLSVFDNIMAVLQTRKDLSKAERLDKLEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EFNI   R+     LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I+
Sbjct: 122 LDEFNIQHIRNSNGMALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L  RG+G+LITDHNV E L + + AYI+  G ++A+GT + +++++ V+R+YLGD+F  
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEHAYIVSQGHMIANGTPEHVLNDEHVKRVYLGDQFKL 241


>gi|83950825|ref|ZP_00959558.1| ABC transporter, ATP-binding protein [Roseovarius nubinhibens ISM]
 gi|83838724|gb|EAP78020.1| ABC transporter, ATP-binding protein [Roseovarius nubinhibens ISM]
          Length = 252

 Score =  258 bits (659), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 130/241 (53%), Positives = 176/241 (73%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L+  +L K Y    V++ V L VK GE+  LLGPNG+GKTT FY + GL+  + 
Sbjct: 9   AHDASGLTIRNLRKSYRKRVVIRDVSLEVKQGEVAALLGPNGSGKTTTFYSIAGLVFPEG 68

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G ++IDG ++T +PMYRRA+LG+ YLPQE SIFRGL+VE+NI+A+L++    ++KR E+L
Sbjct: 69  GRVEIDGREVTHLPMYRRAKLGVGYLPQEMSIFRGLSVEDNIMAILDITHASRRKRRERL 128

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL EF+I   R   A  LSGG+RRR+EIAR L + P Y+LLDEPFAGVDP+++ DI  
Sbjct: 129 EELLSEFSIEHLRRAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDPISVGDIRH 188

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           L+ DL  RGIG+LITDHNV E L ++DRAYI+H G VL  GT  +++ N++VRR+YLG+ 
Sbjct: 189 LVADLKKRGIGVLITDHNVRETLEIVDRAYILHDGQVLMSGTADDVVANENVRRVYLGEN 248

Query: 260 F 260
           F
Sbjct: 249 F 249


>gi|71274807|ref|ZP_00651095.1| ABC transporter [Xylella fastidiosa Dixon]
 gi|71900939|ref|ZP_00683053.1| ABC transporter [Xylella fastidiosa Ann-1]
 gi|71164539|gb|EAO14253.1| ABC transporter [Xylella fastidiosa Dixon]
 gi|71729298|gb|EAO31415.1| ABC transporter [Xylella fastidiosa Ann-1]
          Length = 240

 Score =  258 bits (658), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 167/238 (70%), Gaps = 2/238 (0%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L K+Y    VV+   L ++PGEIVGLLGPNGAGKTT FYM+ GL+  D+G I++
Sbjct: 1   MLVASGLRKRYKHREVVREFGLTLQPGEIVGLLGPNGAGKTTCFYMIVGLVNTDAGRIEL 60

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYE--KDKKKRHEKLDSL 142
           DG DIT  PM+ RA+LG+ YLPQE S+FR L+V +NI  VLE+ +  K  + R  +LDSL
Sbjct: 61  DGRDITAAPMHARAQLGVGYLPQEPSVFRKLSVTDNIRLVLELRQDLKTNQARQHELDSL 120

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L E  I+     L   LSGG+RRR EIAR+L + P  +LLDEPFAGVDP+++ +I  +I 
Sbjct: 121 LNELQISHVADQLGTSLSGGERRRCEIARALAAQPRMMLLDEPFAGVDPISVGEIQRIIT 180

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIG+LITDHNV E L + +RAYI+  GGVLA GT   ++ N DVRR+YLG+ F
Sbjct: 181 HLKERGIGVLITDHNVRETLGICNRAYILAEGGVLAQGTPDALLTNPDVRRVYLGEAF 238


>gi|298506003|gb|ADI84726.1| cell envelope biogenesis ABC transporter, ATP-binding protein
           [Geobacter sulfurreducens KN400]
          Length = 246

 Score =  258 bits (658), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 164/240 (68%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
           S ++ L A  L K +    VV GVDL V PG +VGLLGPNGAGKTT FYM+ GL   D G
Sbjct: 5   SAETALRAYGLKKSFGKRTVVNGVDLLVAPGTVVGLLGPNGAGKTTTFYMVVGLCRPDGG 64

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLD 140
            + +   DIT +PMY+RAR GISYLPQE S+FR LTVEEN+LAVLE  +    +R E+ D
Sbjct: 65  QVVLGEEDITALPMYQRARRGISYLPQEPSVFRKLTVEENLLAVLETMDYSPSERRERAD 124

Query: 141 SLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVL 200
            LL EF I+         LSGG+RRR+EIAR+L + PSYILLDEPFAG+DP+A+ DI  +
Sbjct: 125 ELLVEFKISHIARSKGYSLSGGERRRVEIARALATNPSYILLDEPFAGIDPIAVIDIQGI 184

Query: 201 IRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           I  L   GIGILI+DHNV E L + D AYI+++G V+ HG    I +++  R +YLG+ F
Sbjct: 185 ITALKESGIGILISDHNVRETLGVCDSAYIMNSGEVIEHGDPVAIAESRTAREIYLGESF 244


>gi|260590588|ref|ZP_05856046.1| lipopolysaccharide ABC transporter, ATP-binding protein [Prevotella
           veroralis F0319]
 gi|260537461|gb|EEX20078.1| lipopolysaccharide ABC transporter, ATP-binding protein [Prevotella
           veroralis F0319]
          Length = 274

 Score =  258 bits (658), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 126/239 (52%), Positives = 168/239 (70%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L    L K+Y    V  GV + V+ GEIVGLLGPNGAGKTT FYM TGL+  + G + 
Sbjct: 16  SILHTDKLVKRYGKRTVANGVSISVRQGEIVGLLGPNGAGKTTSFYMTTGLVVPNEGHVY 75

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           ID  +IT  P+Y+RAR GI YLPQEAS+FR ++VE+NI++VLE+ + +K++R +K++SL+
Sbjct: 76  IDDKEITNYPVYKRARAGIGYLPQEASVFRKMSVEDNIMSVLEMTKLNKQERIDKMESLI 135

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EF + K R  L   LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  
Sbjct: 136 REFRLEKVRKNLGDRLSGGERRRCEIARCLAIDPKFIMLDEPFAGVDPIAVEDIQHIVWR 195

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  R IGILITDHNVHE L + DRAY++  G +L  GT +E+  N+ V+  YLG  F  
Sbjct: 196 LKFRNIGILITDHNVHETLNITDRAYLLFEGRILFKGTPEELAANKIVKEKYLGTDFVL 254


>gi|120434952|ref|YP_860638.1| ABC-type transporter ATP-binding protein [Gramella forsetii KT0803]
 gi|117577102|emb|CAL65571.1| ABC-type transporter ATP-binding protein [Gramella forsetii KT0803]
          Length = 246

 Score =  258 bits (658), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 167/237 (70%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y    VVKG+ + V  GEIVGLLGPNGAGKTT FYM+ GLI  + G I +D
Sbjct: 3   LRAEKLVKTYKGRDVVKGISVEVNQGEIVGLLGPNGAGKTTSFYMIVGLIKPNKGDIILD 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             +ITK PMY+RA+ GI YL QEAS+FR L++E+NI++VLE+    KK+R  K++SL++E
Sbjct: 63  KQNITKYPMYKRAQHGIGYLAQEASVFRKLSIEDNIMSVLELTSLSKKERVMKMESLIEE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +   R     LLSGG+RRR EIAR+L + P++ILLDEPFAGVDPVA+ DI  ++  L 
Sbjct: 123 FGLNHIRKNRGDLLSGGERRRTEIARALATDPNFILLDEPFAGVDPVAVEDIQRIVAQLK 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            + IGILITDHNV E L + DR Y++  G +L HG  +E+ +++ VR++YLG  F  
Sbjct: 183 DKNIGILITDHNVQETLAITDRTYLMFEGSILKHGMPEELAEDEMVRKVYLGQNFEL 239


>gi|15838010|ref|NP_298698.1| ABC transporter ATP-binding protein [Xylella fastidiosa 9a5c]
 gi|9106421|gb|AAF84218.1|AE003972_3 ABC transporter ATP-binding protein [Xylella fastidiosa 9a5c]
          Length = 240

 Score =  258 bits (658), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 167/238 (70%), Gaps = 2/238 (0%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L K+Y    VV+   L ++PGEIVGLLGPNGAGKTT FYM+ GL+  D+G I++
Sbjct: 1   MLVASGLRKRYKHREVVREFGLTLQPGEIVGLLGPNGAGKTTCFYMIVGLVNTDAGRIEL 60

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYE--KDKKKRHEKLDSL 142
           DG DIT  PM+ RA+LG+ YLPQE S+FR L+V +NI  VLE+ +  K  + R  +LDSL
Sbjct: 61  DGRDITAAPMHARAQLGVGYLPQEPSVFRKLSVTDNIRLVLELRQDLKTNQARQHELDSL 120

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L E  I+     L   LSGG+RRR EIAR+L + P  +LLDEPFAGVDP+++ +I  +I 
Sbjct: 121 LNELQISHVAGQLGASLSGGERRRCEIARALAAQPRMMLLDEPFAGVDPISVGEIQRIIT 180

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIG+LITDHNV E L + +RAYI+  GGVLA GT   ++ N DVRR+YLG+ F
Sbjct: 181 HLKERGIGVLITDHNVRETLGICNRAYILAEGGVLAQGTPDALLTNPDVRRVYLGETF 238


>gi|332291030|ref|YP_004429639.1| ABC transporter related protein [Krokinobacter diaphorus 4H-3-7-5]
 gi|332169116|gb|AEE18371.1| ABC transporter related protein [Krokinobacter diaphorus 4H-3-7-5]
          Length = 246

 Score =  258 bits (658), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 124/235 (52%), Positives = 169/235 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L K Y    VVKG+ + V  GEIVGLLGPNGAGKTT FYM+ GL+  + G+I ++
Sbjct: 3   LRAENLMKSYKGRKVVKGISVEVNQGEIVGLLGPNGAGKTTSFYMIVGLVKPNGGNIYLE 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             DITK PMY+RA+ GI YL QEAS+FR L++E+NIL+VL++ +  KK++  K++ L++E
Sbjct: 63  QQDITKYPMYKRAQNGIGYLAQEASVFRKLSIEDNILSVLQLTKLSKKEQLHKMEELIEE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F++   R     LLSGG+RRR EIAR+L + PS+ILLDEPFAGVDPVA+ DI  ++  L 
Sbjct: 123 FSLGHIRKSRGDLLSGGERRRTEIARALATSPSFILLDEPFAGVDPVAVEDIQRIVAQLK 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            + IGILITDHNV E L + DR Y++  G +L HG  +E+  ++ VR++YLG  F
Sbjct: 183 DKNIGILITDHNVQETLAITDRTYLMFEGSILKHGEPEELAADEMVRKVYLGQNF 237


>gi|134296986|ref|YP_001120721.1| ABC transporter-like protein [Burkholderia vietnamiensis G4]
 gi|134140143|gb|ABO55886.1| ABC transporter related protein [Burkholderia vietnamiensis G4]
          Length = 258

 Score =  258 bits (658), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 135/247 (54%), Positives = 173/247 (70%), Gaps = 6/247 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L   +L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D+
Sbjct: 10  AGTTSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVPLDA 69

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK- 138
           G I ++G+ I+ +P+++RA LG+SYLPQEAS+FR LTVEENI AVLE+   +  KR  K 
Sbjct: 70  GEISLNGSSISLLPIHKRASLGLSYLPQEASVFRKLTVEENIRAVLELQHGEDGKRLSKD 129

Query: 139 -----LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193
                 ++LL E  I   R   A  LSGG+RRR+EIAR+L + P++ILLDEPFAGVDP+A
Sbjct: 130 AIAARTEALLDELQIGHLRDNPALSLSGGERRRVEIARALATNPNFILLDEPFAGVDPIA 189

Query: 194 ISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRR 253
           + +I  +++ L  R IG+LITDHNV E L + D AYII  G VLA G   EII+N+ VRR
Sbjct: 190 VLEIQKIVKFLKQRNIGVLITDHNVRETLGICDHAYIISDGSVLAAGAPSEIIENESVRR 249

Query: 254 LYLGDRF 260
           +YLG+ F
Sbjct: 250 VYLGEHF 256


>gi|163787880|ref|ZP_02182326.1| ABC transporter, ATP-binding protein [Flavobacteriales bacterium
           ALC-1]
 gi|159876200|gb|EDP70258.1| ABC transporter, ATP-binding protein [Flavobacteriales bacterium
           ALC-1]
          Length = 246

 Score =  258 bits (658), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 169/235 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y+   VVK V L V  GEIVGLLGPNGAGKTT FYM+ G+I  + G+I +D
Sbjct: 3   LRAEHLMKSYSGRKVVKDVSLEVNQGEIVGLLGPNGAGKTTSFYMIVGIIKPNGGNIYLD 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             +ITK PMY+RA+ GI YL QEAS+FR L++E+NIL+VL++ +  KK +H+K++SL++E
Sbjct: 63  DTNITKYPMYKRAQNGIGYLAQEASVFRKLSIEDNILSVLQLTKLSKKAQHDKMESLIEE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +   R     LLSGG+RRR EIAR+L + P++ILLDEPFAGVDPVA+ DI  +I  L 
Sbjct: 123 FGLGHIRTNRGDLLSGGERRRTEIARALATDPNFILLDEPFAGVDPVAVEDIQRIIAKLT 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            + IGILITDHNV E L + DR Y++  GG+L  G  +E+  ++ VR++YLG  F
Sbjct: 183 KKNIGILITDHNVQETLAITDRTYLMFEGGILKAGKPEELASDEMVRKVYLGQNF 237


>gi|113866417|ref|YP_724906.1| ABC transporter ATPase [Ralstonia eutropha H16]
 gi|113525193|emb|CAJ91538.1| ABC-type transporter, ATPase component: HAAT family [Ralstonia
           eutropha H16]
          Length = 266

 Score =  258 bits (658), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 135/242 (55%), Positives = 169/242 (69%), Gaps = 5/242 (2%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L    L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D G I 
Sbjct: 23  STLVVRHLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMLVGLVALDEGDIV 82

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD-----KKKRHEK 138
           +DG+ I+ +P++ RAR+G+SYLPQEAS+FR L VEENI AVLE+   +     K +   +
Sbjct: 83  LDGDHISGLPIHERARMGLSYLPQEASVFRKLNVEENIRAVLELQVSNGKPLPKAEIERR 142

Query: 139 LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIH 198
           LDSLL +  I   R+  A  LSGG+RRR+EIAR+L S P +ILLDEPFAGVDP+A+ +I 
Sbjct: 143 LDSLLDDLQIAHLRNNPALSLSGGERRRVEIARALASSPRFILLDEPFAGVDPIAVGEIQ 202

Query: 199 VLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGD 258
            ++  L +R IG+LITDHNV E L + D AYII  G VLA G  +EII N  VRR+YLG+
Sbjct: 203 RIVSFLKARNIGVLITDHNVRETLGICDHAYIISEGTVLAAGQPEEIIANDAVRRVYLGE 262

Query: 259 RF 260
            F
Sbjct: 263 NF 264


>gi|325955321|ref|YP_004238981.1| sulfate-transporting ATPase [Weeksella virosa DSM 16922]
 gi|323437939|gb|ADX68403.1| Sulfate-transporting ATPase [Weeksella virosa DSM 16922]
          Length = 244

 Score =  258 bits (658), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 121/238 (50%), Positives = 170/238 (71%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L   +L K Y   +VVK V   V+ GEI+GLLGPNGAGKTT FYM+ GL+ A  G + +
Sbjct: 4   VLKGENLVKDYGKKHVVKNVSFQVEQGEIIGLLGPNGAGKTTSFYMIVGLVKATQGRVFL 63

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           D +DIT+ PMY+RA+ GI YL QEAS+FR L+VE+NI +VL+  +   K++ ++ D+L++
Sbjct: 64  DKHDITQDPMYKRAQKGIGYLAQEASVFRKLSVEDNIKSVLQFTKLSSKEQQKRTDALIE 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF++   RH    LLSGG+RRR EIAR L + P +ILLDEPFAGVDP+A+ DI  ++R L
Sbjct: 124 EFSLEHVRHNRGDLLSGGERRRTEIARCLATEPKFILLDEPFAGVDPIAVEDIQKIVRSL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             + IGILITDHNV + L + D+ YI+  G +L  G+ +++ ++ DVRR+YLG+ F F
Sbjct: 184 KDKNIGILITDHNVSQTLAITDKTYIMFEGKILKEGSPEDLANDPDVRRVYLGENFQF 241


>gi|323491751|ref|ZP_08096928.1| ABC-type transport system, ATPase component [Vibrio brasiliensis
           LMG 20546]
 gi|323314007|gb|EGA67094.1| ABC-type transport system, ATPase component [Vibrio brasiliensis
           LMG 20546]
          Length = 241

 Score =  258 bits (658), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 177/238 (74%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K Y S  VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D GSI 
Sbjct: 2   AILKAEHLAKTYGSRTVVTDVSLQVESGQIVGLLGPNGAGKTTSFYMIVGLVARDQGSIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR-HEKLDSL 142
           ID  DI+ +PM+ R+R+GI YLPQEASIFR L+VE+NI+AVLE  E+  ++   +KL+ L
Sbjct: 62  IDDKDISILPMHSRSRMGIGYLPQEASIFRKLSVEDNIMAVLETREEMTREERQDKLEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   RH     LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LEEFHIQHIRHSAGMALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A GT +++++N+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGHLIAEGTPEQVLNNEQVKQVYLGEQF 239


>gi|302392909|ref|YP_003828729.1| ABC transporter [Acetohalobium arabaticum DSM 5501]
 gi|302204986|gb|ADL13664.1| ABC transporter related protein [Acetohalobium arabaticum DSM 5501]
          Length = 238

 Score =  257 bits (657), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 168/235 (71%), Gaps = 1/235 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           + A +L K Y+ V VV  V+  V PGEIVG+LGPNGAGKTT FYM+ GLI  + G I ++
Sbjct: 3   IRAENLVKTYDGVDVVDQVNFKVDPGEIVGILGPNGAGKTTTFYMVVGLIRPNQGRIYLN 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             D+T + M++RAR GI YL QEASIFR LTVEENI A+LE+ ++ K++  E L+SLL E
Sbjct: 63  DQDVTDLSMHKRARAGIGYLAQEASIFRKLTVEENIRAILEMIDR-KEEDEEILNSLLDE 121

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F I   RH     LSGG+RRR EIAR+LV+ P YILLDEPFAGVDP+A++DI  +I  L 
Sbjct: 122 FGIQDIRHQKGYTLSGGERRRAEIARALVTDPDYILLDEPFAGVDPIAVNDIQDIISYLK 181

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
               G+L+TDH+V E L + DRAYI+H G +L  GT +EI D++  R+ YLGD+F
Sbjct: 182 ENDFGVLVTDHSVRETLEITDRAYIMHEGEILLSGTSEEIADSEIARKFYLGDKF 236


>gi|170729945|ref|YP_001775378.1| ABC transporter ATP-binding protein [Xylella fastidiosa M12]
 gi|167964738|gb|ACA11748.1| ABC transporter ATP-binding protein [Xylella fastidiosa M12]
          Length = 240

 Score =  257 bits (657), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 167/238 (70%), Gaps = 2/238 (0%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L K+Y    VV+   L ++PGEIVGLLGPNGAGKTT FYM+ GL+  D+G I++
Sbjct: 1   MLVASGLRKRYKHREVVREFGLTLQPGEIVGLLGPNGAGKTTCFYMIVGLMNTDAGRIEL 60

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYE--KDKKKRHEKLDSL 142
           DG DIT  PM+ RA+LG+ YLPQE S+FR L+V +NI  VLE+ +  K  + R  +LDSL
Sbjct: 61  DGRDITAAPMHARAQLGVGYLPQEPSVFRKLSVTDNIRLVLELRQDLKTNQARQHELDSL 120

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L E  I+     L   LSGG+RRR EIAR+L + P  +LLDEPFAGVDP+++ +I  +I 
Sbjct: 121 LNELQISHVADQLGTSLSGGERRRCEIARALAAQPRMMLLDEPFAGVDPISVGEIQRIIT 180

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIG+LITDHNV E L + +RAYI+  GGVLA GT   ++ N DVRR+YLG+ F
Sbjct: 181 HLKERGIGVLITDHNVRETLGICNRAYILAEGGVLAQGTPDALLTNPDVRRVYLGEAF 238


>gi|187250998|ref|YP_001875480.1| leucine/isoleucine/valine porter [Elusimicrobium minutum Pei191]
 gi|186971158|gb|ACC98143.1| Leucine/isoleucine/valine porter [Elusimicrobium minutum Pei191]
          Length = 239

 Score =  257 bits (657), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 167/235 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L + ++ K Y    VVKGVD+ VK GEIVGLLGPNGAGKTT FYM+ G I   +G + ID
Sbjct: 3   LRSKAIEKVYKQRRVVKGVDINVKSGEIVGLLGPNGAGKTTSFYMLVGFIEPTAGQVFID 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             D+T++PM+ RAR G+ YL QE +IF+GLTVEEN+LAVLE  E D  KR E++  LL+E
Sbjct: 63  DTDVTQLPMFERARHGLGYLAQEPTIFKGLTVEENLLAVLERIEPDVNKRKERVAGLLEE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +TK     A  LSGG++RR+EIAR ++S P  ILLDEPF G+DP+ +SD+  +I  L 
Sbjct: 123 FGLTKLTKQKAWTLSGGEKRRMEIARCMISDPKIILLDEPFVGIDPITVSDLRQMIFKLK 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            +GIG+LITDHNV E L L +RAY+I+ G +L  G    ++++ + R+LYLG+ F
Sbjct: 183 DKGIGVLITDHNVRETLPLTERAYLIYDGQILVEGDQDTLLNDSNARKLYLGEDF 237


>gi|253991152|ref|YP_003042508.1| ABC transporter ATP-binding protein YhbG [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253782602|emb|CAQ85766.1| probable abc transporter atp-binding protein yhbg [Photorhabdus
           asymbiotica]
          Length = 241

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 179/239 (74%), Gaps = 3/239 (1%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L+A +L K Y    VV+ V L V  GEIVGLLGPNGAGKTT FYM+ G++  D+G+I 
Sbjct: 2   AILNAENLAKAYKGRKVVENVSLNVNSGEIVGLLGPNGAGKTTTFYMVVGIVSRDTGTIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD--KKKRHEKLDS 141
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V +N++AVLE+  KD  +++R E+ + 
Sbjct: 62  IDDEDISLLPLHERARRGIGYLPQEASIFRRLSVFDNLMAVLEI-RKDLTQEQRKERAEE 120

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           L++EF+I+  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I
Sbjct: 121 LMEEFHISHLRDNLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKII 180

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           + L   G+G+LITDHNV E L + +RAYI+  G ++AHGT  +I++N+ V+R+YLG+ F
Sbjct: 181 QHLRDYGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGTPNDILNNEQVKRVYLGEGF 239


>gi|78777347|ref|YP_393662.1| ABC transporter-related protein [Sulfurimonas denitrificans DSM
           1251]
 gi|78497887|gb|ABB44427.1| ABC transporter-related protein [Sulfurimonas denitrificans DSM
           1251]
          Length = 240

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 168/236 (71%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A +L K+   + +VKG+ L VK GE+VGLLGPNGAGKTT FYM+ GL+ +  G +  
Sbjct: 3   ILKAVNLQKRIKDLEIVKGMSLEVKSGEVVGLLGPNGAGKTTTFYMICGLVESSGGEVFF 62

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           D  +++ MP+++RA  GI YLPQEASIF+ L+VEEN+L   EV  KDK  + +++  LL 
Sbjct: 63  DDENLSGMPLHQRALKGIGYLPQEASIFKDLSVEENLLIAAEVKIKDKDAQEKRILELLD 122

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
            FNI   R+     LSGG+RRR+EIAR+LV+ P ++LLDEPFAGVDP+A+ DI  +I+ L
Sbjct: 123 MFNIEPIRYRKGVSLSGGERRRVEIARALVNEPKFLLLDEPFAGVDPIAVMDIQTVIKQL 182

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            S GIG+LITDHNV E L++ DRAY+I AG +LA GT  EI  N DVR  YLG  F
Sbjct: 183 VSYGIGVLITDHNVRETLSVCDRAYVIKAGSLLASGTSDEIGQNADVRTHYLGQEF 238


>gi|121998904|ref|YP_001003691.1| ABC transporter-like protein [Halorhodospira halophila SL1]
 gi|121590309|gb|ABM62889.1| ABC transporter related protein [Halorhodospira halophila SL1]
          Length = 241

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 170/236 (72%), Gaps = 1/236 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  LTK+Y    VV G  L V  GEIVGLLGPNGAGKTT FYM+ GL+ AD G I ++
Sbjct: 4   LRAEGLTKRYRGRTVVNGAGLEVANGEIVGLLGPNGAGKTTCFYMVVGLVQADEGRITLE 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSLLK 144
           G+D+T++P++ RARLGI YLPQE S+FR L+V +N+ A+L++  +    +R ++LD LL+
Sbjct: 64  GDDLTRLPIHARARLGIGYLPQEPSVFRKLSVADNVRAILQLRGDLGGAEREQELDRLLE 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF +T  R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ +I  ++R L
Sbjct: 124 EFGVTHVRDSPGIALSGGERRRVEIARALAAAPRFILLDEPFAGVDPISVGEIQRIVRQL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           A RGIG+LITDHNV E L ++ RAYI+  G VLA G  + ++ N  VR +YLG+ F
Sbjct: 184 AQRGIGVLITDHNVRETLGIVQRAYILSDGEVLAAGDAESVLANPRVREVYLGEDF 239


>gi|323343313|ref|ZP_08083540.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Prevotella oralis ATCC 33269]
 gi|323095132|gb|EFZ37706.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Prevotella oralis ATCC 33269]
          Length = 275

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 129/248 (52%), Positives = 166/248 (66%)

Query: 15  FQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGL 74
            QE       +L    L KKY    VV  V + VK GEIVGLLGPNGAGKTT FYM TGL
Sbjct: 7   MQEGNREGGMVLRTEGLVKKYGKRTVVNDVSINVKQGEIVGLLGPNGAGKTTSFYMTTGL 66

Query: 75  ICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKK 134
           I  ++G I ++  DIT  P+Y+RAR GI YLPQEAS+FR ++VE+NI+AVLE+ + ++++
Sbjct: 67  IVPNAGHIYLNNTDITNYPVYKRARAGIGYLPQEASVFRKMSVEDNIMAVLEMTKLNRQE 126

Query: 135 RHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAI 194
           R +KL+SL+ EF + K R      LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+
Sbjct: 127 REDKLESLIGEFRLNKVRKNKGDQLSGGERRRTEIARCLAIDPKFIMLDEPFAGVDPIAV 186

Query: 195 SDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRL 254
            DI  ++  L  R IGILITDHNV E LT+ DRAY++  G +L  G   E+  N+ VR  
Sbjct: 187 EDIQHIVWKLKYRNIGILITDHNVQETLTITDRAYLLFEGKILFQGNPDELASNKIVREK 246

Query: 255 YLGDRFAF 262
           YL + F  
Sbjct: 247 YLSNSFVL 254


>gi|39996986|ref|NP_952937.1| ABC transporter ATP-binding protein [Geobacter sulfurreducens PCA]
 gi|39983874|gb|AAR35264.1| ABC transporter, ATP-binding protein [Geobacter sulfurreducens PCA]
          Length = 246

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 164/240 (68%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
           S ++ L A  L K +    VV GVDL V PG +VGLLGPNGAGKTT FYM+ GL   D G
Sbjct: 5   SVETALRAHGLKKSFGKRTVVNGVDLLVAPGTVVGLLGPNGAGKTTTFYMVVGLCRPDGG 64

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLD 140
            + +   DIT +PMY+RAR GISYLPQE S+FR LTVEEN+LAVLE  +    +R E+ D
Sbjct: 65  QVVLGEEDITALPMYQRARRGISYLPQEPSVFRKLTVEENLLAVLETMDYSPSERRERAD 124

Query: 141 SLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVL 200
            LL EF I+         LSGG+RRR+EIAR+L + PSYILLDEPFAG+DP+A+ DI  +
Sbjct: 125 ELLVEFKISHIARSKGYSLSGGERRRVEIARALATSPSYILLDEPFAGIDPIAVIDIQGI 184

Query: 201 IRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           I  L   GIGILI+DHNV E L + D AYI+++G V+ HG    I +++  R +YLG+ F
Sbjct: 185 ITALKESGIGILISDHNVRETLGVCDSAYIMNSGEVIEHGDPVAIAESRTAREIYLGESF 244


>gi|288803884|ref|ZP_06409309.1| ABC transporter, ATP-binding protein [Prevotella melaninogenica
           D18]
 gi|288333649|gb|EFC72099.1| ABC transporter, ATP-binding protein [Prevotella melaninogenica
           D18]
          Length = 275

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 126/239 (52%), Positives = 166/239 (69%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L    L K+Y    V  GV + VK GEIVGLLGPNGAGKTT FYM TGL+  + G + 
Sbjct: 16  SILRTDKLVKRYGKRTVANGVSINVKQGEIVGLLGPNGAGKTTSFYMTTGLVVPNEGHVY 75

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           ID  +IT  P+Y+RAR GI YLPQEAS+FR ++VE+NI++VLE+ +  K++R + ++SL+
Sbjct: 76  IDDQEITNFPVYKRARAGIGYLPQEASVFRKMSVEDNIMSVLEMTKLSKQERIDNMESLI 135

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EF + K R  L   LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  
Sbjct: 136 REFRLEKVRKNLGDRLSGGERRRCEIARCLAIDPKFIMLDEPFAGVDPIAVEDIQHIVWR 195

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  R IGILITDHNVHE L + DRAY++  G +L  GT +E+  N+ V+  YLG  F  
Sbjct: 196 LKFRNIGILITDHNVHETLNITDRAYLLFEGRILFKGTPEELAANKIVKEKYLGTDFVL 254


>gi|237809672|ref|YP_002894112.1| ABC transporter-like protein [Tolumonas auensis DSM 9187]
 gi|237501933|gb|ACQ94526.1| ABC transporter related [Tolumonas auensis DSM 9187]
          Length = 241

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 172/240 (71%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           +LL A  L K Y    VV+ V L V  G++VGLLGPNGAGKTT FYM+ GL+  D G++ 
Sbjct: 2   TLLQASGLKKSYKGRQVVQNVSLQVATGQVVGLLGPNGAGKTTSFYMIVGLVPQDGGTVM 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID  DIT MPM++RAR GI YLPQEASIFR LTVEEN+L VL++  E  + ++ EK+++L
Sbjct: 62  IDQLDITAMPMHQRARHGIGYLPQEASIFRRLTVEENLLGVLQLRSELSRAEQKEKMEAL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R      LSGG+RRR+EIAR+L   P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LEEFHIGHIRKNTGMSLSGGERRRVEIARALAVEPRFILLDEPFAGVDPISVIDIKRIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L  RG+G+LITDHNV E L + ++AYI+  G ++A G+  EI+ N+ V+++YLG+ F  
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSHGNLIAEGSPAEILQNEHVKQVYLGEGFTL 241


>gi|260770979|ref|ZP_05879908.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           furnissii CIP 102972]
 gi|260614216|gb|EEX39406.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           furnissii CIP 102972]
 gi|315179025|gb|ADT85939.1| ABC transporter, ATP-binding protein [Vibrio furnissii NCTC 11218]
          Length = 241

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 175/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K Y    VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G+I 
Sbjct: 2   AILKAEHLAKSYKKRKVVSDVSLQVESGQIVGLLGPNGAGKTTSFYMIVGLVARDEGTIC 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR-HEKLDSL 142
           ID  DI+ +PM+ R+RLGI YLPQEASIFR L+VE+NI+AVLE  E+  ++   +KL+ L
Sbjct: 62  IDDKDISVLPMHSRSRLGIGYLPQEASIFRKLSVEDNIMAVLETREEMTREERQDKLEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LEEFHIQHIRQSAGMALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A GT QE++DN+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGRLIAEGTPQEVLDNEQVKQVYLGEQF 239


>gi|42526160|ref|NP_971258.1| ABC transporter, ATP-binding protein [Treponema denticola ATCC
           35405]
 gi|41816272|gb|AAS11139.1| ABC transporter, ATP-binding protein [Treponema denticola ATCC
           35405]
          Length = 245

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 129/240 (53%), Positives = 171/240 (71%), Gaps = 1/240 (0%)

Query: 22  KDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGS 81
           K S+L    L K +   + VK V   +  GEIVGLLGPNGAGKTT FYM+ G    +SG+
Sbjct: 4   KKSILKVEGLNKFFRKKHAVKDVGFSMYQGEIVGLLGPNGAGKTTTFYMIVGFYKPNSGN 63

Query: 82  IKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLD 140
           I +DGN IT +PMY+RA  GISYLPQEAS+FR LTVE+NI A+LE  +   K+++ E+L+
Sbjct: 64  IYLDGNRITNLPMYKRAHAGISYLPQEASVFRKLTVEQNIYAILETRKDLSKEQKMERLE 123

Query: 141 SLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVL 200
            LL+EF IT  R   A  LSGG+RRR EIAR+L   P ++LLDEPFAG+DP+A+ DI  +
Sbjct: 124 FLLEEFGITANRKQQAYTLSGGERRRTEIARALAIEPKFLLLDEPFAGIDPIAVHDIKSI 183

Query: 201 IRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +R LA +GIGILITDHNV + L + DRAYII +G ++  G+  EI++++  R++YLG  F
Sbjct: 184 VRILADQGIGILITDHNVRDTLEITDRAYIIGSGEIVEQGSRDEILNSEIARKIYLGQEF 243


>gi|240949438|ref|ZP_04753779.1| putative ABC transporter ATP-binding protein [Actinobacillus minor
           NM305]
 gi|257465174|ref|ZP_05629545.1| putative ABC transporter ATP-binding protein [Actinobacillus minor
           202]
 gi|240296187|gb|EER46843.1| putative ABC transporter ATP-binding protein [Actinobacillus minor
           NM305]
 gi|257450834|gb|EEV24877.1| putative ABC transporter ATP-binding protein [Actinobacillus minor
           202]
          Length = 241

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 176/240 (73%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y +  VVK V L+VK GEIVGLLGPNGAGKTT FYM+ GL+  D+G+I+
Sbjct: 2   ATLYAEHLAKSYKNRKVVKDVSLHVKTGEIVGLLGPNGAGKTTTFYMVVGLVRHDNGTIR 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +PM+ RA+ GI YLPQEASIFR L+V +N++AVL+V +  + K+R  + D L
Sbjct: 62  IDNEDISVLPMHDRAKQGIGYLPQEASIFRRLSVYDNLMAVLQVRKDLNDKERKARADEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           + EF+I   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 IAEFHIEHIRDSLGQSLSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIV 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           +L  RG+G+LITDHNV E L + +RAYI+ +G ++A GT  E+++N  V+ +YLG++F  
Sbjct: 182 NLKERGLGVLITDHNVRETLDVCERAYIVGSGEMIATGTPSEVLNNPKVKEVYLGEQFKL 241


>gi|33591885|ref|NP_879529.1| ABC transporter [Bordetella pertussis Tohama I]
 gi|33603479|ref|NP_891039.1| ABC transporter [Bordetella bronchiseptica RB50]
 gi|33571529|emb|CAE41007.1| ABC transporter [Bordetella pertussis Tohama I]
 gi|33577603|emb|CAE34868.1| ABC transporter [Bordetella bronchiseptica RB50]
 gi|332381302|gb|AEE66149.1| ABC transporter [Bordetella pertussis CS]
          Length = 263

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 170/239 (71%), Gaps = 6/239 (2%)

Query: 28  ACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGN 87
           A  L K YN   VV+ V L V  GE+VGLLGPNGAGKTT FYM+ GL+ ADSG I+IDG+
Sbjct: 23  ATGLRKTYNGRTVVQDVSLSVVSGEVVGLLGPNGAGKTTSFYMIVGLVPADSGRIEIDGS 82

Query: 88  DITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR------HEKLDS 141
           +IT MP+++RAR+G+SYLPQ+AS+FR LTVE+NI AVLE+      K        + L++
Sbjct: 83  NITSMPIHKRARMGLSYLPQDASVFRRLTVEQNIRAVLELQLGPNGKPLPEARIRDNLEA 142

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           LL+E  I   R   A  LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+A+ +I  ++
Sbjct: 143 LLEELQIGHIRANTAISLSGGERRRVEIARALATSPRFILLDEPFAGVDPIAVIEIQRIV 202

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           R L  RGIG+LITDHNV E L + DRAYII  G VL  G   EI+ +  VRR+YLG+ F
Sbjct: 203 RFLKGRGIGVLITDHNVRETLGICDRAYIISEGKVLTDGHPDEIVGDPAVRRVYLGEHF 261


>gi|332521098|ref|ZP_08397556.1| ABC transporter related protein [Lacinutrix algicola 5H-3-7-4]
 gi|332043191|gb|EGI79388.1| ABC transporter related protein [Lacinutrix algicola 5H-3-7-4]
          Length = 246

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 170/235 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y    VVK V L V  GEIVGLLGPNGAGKTT FYM+ GLI  + GSI ++
Sbjct: 3   LKAEHLMKSYGGRKVVKDVSLEVNTGEIVGLLGPNGAGKTTSFYMIVGLIKPNGGSIHLE 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G +ITK PMY+RA+ GI YL QEAS+FR L++E+NIL+VL++ +  KK++  K++SL++E
Sbjct: 63  GTNITKYPMYKRAQSGIGYLAQEASVFRKLSIEDNILSVLQLTKLSKKEQLHKMESLIEE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F++   R     LLSGG+RRR EIAR+L + P++ILLDEPFAGVDPVA+ DI  +I  LA
Sbjct: 123 FSLGHIRKSRGDLLSGGERRRTEIARALATDPNFILLDEPFAGVDPVAVEDIQRIIARLA 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            + IGILITDHNV E L + DR Y++  GG+L  G  +++  ++ VR++YLG  F
Sbjct: 183 KKNIGILITDHNVQETLAITDRTYLMFEGGILKAGIPEDLAADEMVRKVYLGQNF 237


>gi|238793710|ref|ZP_04637332.1| Uncharacterized ABC transporter ATP-binding protein [Yersinia
           intermedia ATCC 29909]
 gi|238726951|gb|EEQ18483.1| Uncharacterized ABC transporter ATP-binding protein [Yersinia
           intermedia ATCC 29909]
          Length = 241

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 171/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y    VV+ V L VK GEIVGLLGPNGAGKTT FYM+ G++  D+G I 
Sbjct: 2   ATLIAEKLAKAYKGRKVVEDVSLNVKSGEIVGLLGPNGAGKTTTFYMVVGIVQRDAGRIV 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V  N++AVLE+      ++R E+ D L
Sbjct: 62  IDDEDISLLPLHERARRGIGYLPQEASIFRRLSVFNNLMAVLEIRNDLSAEQREERADEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+IT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 MEEFHITHLRDNLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT QEI+ ++ V+R+YLG+ F
Sbjct: 182 HLRDSGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGTPQEILADEQVKRVYLGEEF 239


>gi|257454873|ref|ZP_05620124.1| unclassified ABC-type transport system, ATPase component
           [Enhydrobacter aerosaccus SK60]
 gi|257447806|gb|EEV22798.1| unclassified ABC-type transport system, ATPase component
           [Enhydrobacter aerosaccus SK60]
          Length = 247

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 124/231 (53%), Positives = 166/231 (71%), Gaps = 1/231 (0%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K+Y   +VVK V   V+ G++VGLLGPNGAGKTT FYM+ GL+  D G I++   D++
Sbjct: 15  LAKRYGKRWVVKDVSFSVEQGQVVGLLGPNGAGKTTSFYMVVGLVNMDKGQIQLGNQDLS 74

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSLLKEFNIT 149
            + M+ RA  GI YLPQEASIFR LTVEENIL++L+   + DK  + ++L+ L+ EFN+ 
Sbjct: 75  ALSMHERAAAGIGYLPQEASIFRKLTVEENILSILQTRTDLDKAGQQQQLEQLIGEFNLG 134

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             RH L   +SGG+RRR EIARSL S P +ILLDEPFAGVDP+++ DI  +I  L  RGI
Sbjct: 135 HVRHSLGMSVSGGERRRCEIARSLASNPKFILLDEPFAGVDPISVGDIKEVIIKLKQRGI 194

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           G+LITDHNV E L + + AYI+  G ++A GT + I+DN+ VR++YLG+ F
Sbjct: 195 GVLITDHNVRETLAICEHAYIVSEGQIIAAGTPEHILDNELVRKVYLGENF 245


>gi|85859057|ref|YP_461259.1| ABC transporter ATP-binding protein [Syntrophus aciditrophicus SB]
 gi|85722148|gb|ABC77091.1| ABC transporter ATP-binding protein [Syntrophus aciditrophicus SB]
          Length = 240

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 126/239 (52%), Positives = 172/239 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S LSA  L K Y+   VV  +DL ++PGE+VGLLGPNGAGKTT FYM+ GLI  D G+I 
Sbjct: 2   SELSANGLVKIYSGRRVVDEIDLRIQPGEVVGLLGPNGAGKTTTFYMIVGLIRPDGGNIL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           ++G D+T  PMY RAR G+SYLPQE S+FR LTVE+NILA+LE  +   +++ ++L  LL
Sbjct: 62  LNGEDVTHEPMYIRARKGLSYLPQEPSVFRKLTVEDNILAILETLKLSAEEKEKRLQELL 121

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            E  +T      A  LSGG+RRR+EI R+LV+ P YILLDEPFAG+DP+A++DI  +I  
Sbjct: 122 GELVLTHLAKNKAYSLSGGERRRVEITRALVTSPRYILLDEPFAGIDPLAVADIQKIILK 181

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L S+GIG++I+DHNV E L++ DRAYI++AG +L  G  ++I  ++  R++Y G+ F  
Sbjct: 182 LRSKGIGVVISDHNVRETLSVCDRAYIVNAGKILVEGKPEDIASSEMARKIYFGEDFTL 240


>gi|220932586|ref|YP_002509494.1| ABC transporter related [Halothermothrix orenii H 168]
 gi|219993896|gb|ACL70499.1| ABC transporter related [Halothermothrix orenii H 168]
          Length = 239

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 169/235 (71%)

Query: 28  ACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGN 87
           A +L K Y+   VV  V+L VK GEIVGLLGPNGAGKTT FYM+ GLI  D G I +D +
Sbjct: 5   AKNLLKIYSRQKVVNKVNLKVKKGEIVGLLGPNGAGKTTTFYMVVGLIKPDGGEIYLDDD 64

Query: 88  DITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFN 147
           +IT +P+Y+RAR GI YL QE S+FR LTV ENILA+L+      ++   KL+ L++EFN
Sbjct: 65  NITHLPVYKRARKGIGYLSQEPSVFRKLTVRENILAILQARGFSPQESESKLNELMEEFN 124

Query: 148 ITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASR 207
           I      L   LSGG+RRR+EIAR+L + PS+ILLDEPFAGVDP+A++DI  +I  L  R
Sbjct: 125 IGHLEDRLGYQLSGGERRRVEIARALATDPSFILLDEPFAGVDPIAVTDIQNIISYLKKR 184

Query: 208 GIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           G+G+LITDH+V E L++ DRAYI+H G +L  G+ +E+ +++  R+ YLG+RF  
Sbjct: 185 GLGVLITDHSVRETLSITDRAYIMHQGQILLSGSSEEVAESELARKFYLGERFTM 239


>gi|238796184|ref|ZP_04639694.1| Uncharacterized ABC transporter ATP-binding protein [Yersinia
           mollaretii ATCC 43969]
 gi|238719877|gb|EEQ11683.1| Uncharacterized ABC transporter ATP-binding protein [Yersinia
           mollaretii ATCC 43969]
          Length = 241

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 173/239 (72%), Gaps = 3/239 (1%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y    VV+ V L VK GEIVGLLGPNGAGKTT FYM+ G++  D+G I 
Sbjct: 2   ATLIAEKLAKAYKGRKVVEDVSLSVKSGEIVGLLGPNGAGKTTTFYMVVGIVQRDAGRIV 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD--KKKRHEKLDS 141
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V  N++AVLE+  KD   ++R E+ + 
Sbjct: 62  IDDEDISLLPLHERARRGIGYLPQEASIFRRLSVFNNLMAVLEI-RKDLTNEQRQERAEE 120

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           L++EF+IT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I
Sbjct: 121 LMEEFHITHLRDSLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKII 180

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             L   G+G+LITDHNV E L + +RAYI+  G ++AHGT QEI+ ++ V+R+YLG+ F
Sbjct: 181 EHLRDSGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGTPQEILADEQVKRVYLGEEF 239


>gi|308051147|ref|YP_003914713.1| ABC transporter [Ferrimonas balearica DSM 9799]
 gi|307633337|gb|ADN77639.1| ABC transporter related protein [Ferrimonas balearica DSM 9799]
          Length = 243

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 136/239 (56%), Positives = 176/239 (73%), Gaps = 1/239 (0%)

Query: 23  DSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSI 82
           DS+L A  L K YN   VVK V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G I
Sbjct: 3   DSILKADQLAKSYNGRQVVKSVGLEVRTGQIVGLLGPNGAGKTTTFYMVVGLVQNDKGQI 62

Query: 83  KIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDS 141
            ID  DIT +PM+ RAR GI YLPQE+SIFR L+V +N++AVL++  E  K +R EKL+ 
Sbjct: 63  TIDDRDITALPMHSRARQGIGYLPQESSIFRKLSVYDNLMAVLQIRKELTKAQREEKLEQ 122

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           LL+EFNIT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I
Sbjct: 123 LLEEFNITHIRDSLGMSLSGGERRRVEIARALAADPKFILLDEPFAGVDPISVIDIKKII 182

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           + L  RG+G+LITDHNV E L + + AYI+  G ++A G  QE+++N+ VR +YLGD+F
Sbjct: 183 QQLKDRGLGVLITDHNVRETLDVCEYAYIVSHGEMIARGAPQEVLENKLVRSVYLGDQF 241


>gi|328949213|ref|YP_004366550.1| Sulfate-transporting ATPase [Treponema succinifaciens DSM 2489]
 gi|328449537|gb|AEB15253.1| Sulfate-transporting ATPase [Treponema succinifaciens DSM 2489]
          Length = 248

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 133/250 (53%), Positives = 172/250 (68%), Gaps = 7/250 (2%)

Query: 17  ENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLIC 76
           E++    + L   SL K +    VVKGVD  ++ GE++GLLGPNGAGKTT FYM+ G   
Sbjct: 2   ESQNKDKNTLRVSSLYKSFGKKSVVKGVDFSMQTGEVLGLLGPNGAGKTTTFYMIVGFYK 61

Query: 77  ADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD----K 132
             +G + +D   IT++PMY+RAR GISYLPQE S+FR LTVEENI A+LE   KD    +
Sbjct: 62  PTAGDVFLDEECITQLPMYKRARAGISYLPQEPSVFRKLTVEENIWAILET-RKDLTRIE 120

Query: 133 KKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPV 192
           KKR   LD L++EFNI + R   A  LSGG+RRR EIARSL   P ++LLDEPFAG+DP+
Sbjct: 121 KKRE--LDQLIEEFNIGRIRKQQAYTLSGGERRRTEIARSLAIEPKFLLLDEPFAGIDPI 178

Query: 193 AISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVR 252
           A++DI  +IR LA RGIG+LITDHNV + L + DRA II  G +L  G  +EI+ +Q+ R
Sbjct: 179 AVADIKGIIRLLAKRGIGVLITDHNVRDTLEITDRAIIISTGTILVSGGKEEILKSQEAR 238

Query: 253 RLYLGDRFAF 262
            +YLG  F+ 
Sbjct: 239 EIYLGKDFSM 248


>gi|148265012|ref|YP_001231718.1| ABC transporter related [Geobacter uraniireducens Rf4]
 gi|146398512|gb|ABQ27145.1| ABC transporter related protein [Geobacter uraniireducens Rf4]
          Length = 246

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 124/230 (53%), Positives = 168/230 (73%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K +N   VV  VDL V  GE++GLLGPNGAGKTT FYM+ GL   DSG++ +DG+ IT
Sbjct: 15  LKKSFNRRMVVNSVDLKVSSGEVIGLLGPNGAGKTTTFYMVVGLCRPDSGAVYLDGDAIT 74

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITK 150
            +PMY RAR GISYLPQE S+FR LTVEEN++AVLE  +  + +  E+++ LL EF IT 
Sbjct: 75  DLPMYLRARKGISYLPQEPSVFRKLTVEENLMAVLETMKLSRSRCRERVEELLAEFRITH 134

Query: 151 WRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIG 210
                   LSGG+RRR+EIAR+L + P++ILLDEPFAG+DP+A+ DI  +I DL ++G+G
Sbjct: 135 IARSKGFALSGGERRRVEIARALATDPAFILLDEPFAGIDPLAVIDIQGIITDLKNKGLG 194

Query: 211 ILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +LI+DHNV E L + D+AYI++AG VL  G   +I +++  R +YLG++F
Sbjct: 195 VLISDHNVRETLGVCDKAYILNAGEVLEFGDPVQIAESRKAREIYLGEKF 244


>gi|260072702|gb|ACX30599.1| ABC-type transporter ATPase component [uncultured SUP05 cluster
           bacterium]
 gi|269468477|gb|EEZ80138.1| ABC-type transport system, ATPase component [uncultured SUP05
           cluster bacterium]
          Length = 245

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 124/234 (52%), Positives = 168/234 (71%), Gaps = 1/234 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L   ++ KKY    VV  V   VK GEIVGLLGPNGAGKTT FY+  GL+ AD G + ID
Sbjct: 7   LEVKNIRKKYAQREVVSDVSFEVKSGEIVGLLGPNGAGKTTCFYIACGLVSADKGEVFID 66

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
              + K+PM++RA LG+ YLPQE SIFR L+VE+NI+AVL+V +  +KK+R  +L+ LL 
Sbjct: 67  HRKVGKLPMHKRAHLGLGYLPQEPSIFRKLSVEDNIMAVLQVNKDLEKKQRKHRLEELLA 126

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+I   RH+    LSGG+RRR+EIAR+L   P ++LLDEPFAGVDP+++ DI  +I  L
Sbjct: 127 EFHIEHIRHIDGLSLSGGERRRVEIARALAMDPKFVLLDEPFAGVDPISVGDIQQIIYHL 186

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGD 258
             RGIG+LITDHN  E+L   D +Y++H G ++A G  QEI+ N++V+++YLG+
Sbjct: 187 KDRGIGVLITDHNYREMLDTCDHSYVLHGGKIIAQGNKQEILSNEEVKKVYLGE 240


>gi|33151775|ref|NP_873128.1| putative ABC transporter ATP-binding protein [Haemophilus ducreyi
           35000HP]
 gi|6969427|gb|AAF33771.1|AF219259_4 YhbG [Haemophilus ducreyi]
 gi|33147996|gb|AAP95517.1| putative ABC transporter ATP-binding protein [Haemophilus ducreyi
           35000HP]
          Length = 241

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 173/238 (72%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y +  VVK V L VK GEI+GLLGPNGAGKTT FYM+ GL+  D G I+ID
Sbjct: 4   LYAEHLAKSYKNRQVVKDVSLNVKAGEIIGLLGPNGAGKTTTFYMVVGLVRHDQGKIRID 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
             DI+ +PM+ RA+ GI YLPQEASIF  L+V +N++AVL+V +  + ++R ++ + L+ 
Sbjct: 64  DQDISVLPMHDRAKYGIGYLPQEASIFHRLSVYDNLMAVLQVRKDLNNQQRKDRAEELIS 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+I   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I  L
Sbjct: 124 EFHIEHIRDNLGQALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIVHL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             RG+G+LITDHNV E L +  RAYI+ +G ++A+GT ++I++N DV+R+YLGD F  
Sbjct: 184 KQRGLGVLITDHNVRETLNVCQRAYIVGSGQMIANGTPEQILNNPDVKRVYLGDEFKL 241


>gi|319954185|ref|YP_004165452.1| fe(3+)-transporting atpase [Cellulophaga algicola DSM 14237]
 gi|319422845|gb|ADV49954.1| Fe(3+)-transporting ATPase [Cellulophaga algicola DSM 14237]
          Length = 245

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 124/235 (52%), Positives = 170/235 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A ++ K Y    VVKG+ L V  GEIVGLLGPNGAGKTT FYM+ GL+  + G+I +D
Sbjct: 3   LRADNIMKSYRGRPVVKGISLEVNQGEIVGLLGPNGAGKTTSFYMIVGLVKPNGGNIYLD 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             DITK PMY+RA+ GI YL QEAS+FR L++EENIL+VL++ +  KK++  K++SL++E
Sbjct: 63  DKDITKFPMYKRAQNGIGYLAQEASVFRKLSIEENILSVLQLTKLSKKEQEMKMESLIEE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F++   R     LLSGG+RRR EIAR+L + P +ILLDEPFAGVDPVA+ DI  ++  L 
Sbjct: 123 FSLGHIRKNRGDLLSGGERRRTEIARALATDPKFILLDEPFAGVDPVAVEDIQRIVSQLK 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            + IGILITDHNV E L + +R+Y++  GG+L  G  +++  ++ VR++YLG  F
Sbjct: 183 EKNIGILITDHNVQETLAITERSYLMFEGGILKSGIPEDLAADEMVRKVYLGQNF 237


>gi|325280331|ref|YP_004252873.1| Sulfate-transporting ATPase [Odoribacter splanchnicus DSM 20712]
 gi|324312140|gb|ADY32693.1| Sulfate-transporting ATPase [Odoribacter splanchnicus DSM 20712]
          Length = 243

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 170/238 (71%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L KKY S  VVK V + V+ GEIVGLLGPNGAGKTT FYM+ GLI  + G I +
Sbjct: 2   ILKAEHLIKKYKSRTVVKDVSVQVEQGEIVGLLGPNGAGKTTSFYMIVGLITPNGGRIFL 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           D  +ITK P+Y+RA+LG+ YL QEAS+FR L+VE+NI AVLE+ +  K+++ ++L+ +L 
Sbjct: 62  DDQEITKEPVYKRAQLGVGYLAQEASVFRRLSVEDNIRAVLEMTKMTKEEQKDRLEEMLD 121

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF +   R  L   LSGG+RRR EIAR+L   P +ILLDEPFAGVDP+A+ DI  +++ L
Sbjct: 122 EFGLQHIRKSLGIQLSGGERRRTEIARALSIRPKFILLDEPFAGVDPIAVEDIQNIVQKL 181

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             + IGILITDHNV E L++ DRAY+++ G +L  GT + +  + +VRR+YLG  F  
Sbjct: 182 KDKNIGILITDHNVQETLSITDRAYLLYDGRILQAGTAEHLAADPEVRRVYLGKNFEL 239


>gi|225010692|ref|ZP_03701162.1| ABC transporter-related protein [Flavobacteria bacterium MS024-3C]
 gi|225005245|gb|EEG43197.1| ABC transporter-related protein [Flavobacteria bacterium MS024-3C]
          Length = 246

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 169/235 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LSA ++ K Y    VVKG+ L V  GEIVGLLGPNGAGKTT FYM+ GLI  + G+I +D
Sbjct: 3   LSATNIMKSYRGRTVVKGISLEVNQGEIVGLLGPNGAGKTTSFYMIVGLIKPNGGAIHLD 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             +IT  PMY+RA+ GI YL QEAS+FR L++EENI++VL++    KK++  K++SL++E
Sbjct: 63  QTNITNYPMYKRAQSGIGYLAQEASVFRKLSIEENIMSVLQLTNLTKKEQEMKMESLIEE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F++   R     LLSGG+RRR EIAR+L + P +ILLDEPFAGVDPVA+ DI  ++  L 
Sbjct: 123 FSLGHIRKNRGDLLSGGERRRTEIARALATDPKFILLDEPFAGVDPVAVEDIQRIVAQLK 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            + IGILITDHNV E L + +R+Y++  GG+L  G  +++  ++ VR++YLG  F
Sbjct: 183 DKNIGILITDHNVQETLAITERSYLMFEGGILKAGIPEDLAKDEMVRKVYLGQNF 237


>gi|94309249|ref|YP_582459.1| ABC transporter-related protein [Cupriavidus metallidurans CH34]
 gi|11933007|emb|CAC19345.1| hypothetical protein [Cupriavidus necator]
 gi|93353101|gb|ABF07190.1| Probable ABC transporter ATP-binding protein [Cupriavidus
           metallidurans CH34]
          Length = 263

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 171/246 (69%), Gaps = 5/246 (2%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           ++  S L    L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D 
Sbjct: 16  STDSSTLVVRHLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVALDE 75

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD-----KKK 134
           G I +DG  I+ + ++ RAR+G+SYLPQEAS+FR L VEENI AVLE+   +     K++
Sbjct: 76  GDIVLDGQHISGLAIHERARMGLSYLPQEASVFRKLNVEENIRAVLELQVVNGKPLPKQE 135

Query: 135 RHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAI 194
              +LDSLL +  I   R+  A  LSGG+RRR+EIAR+L S P +ILLDEPFAGVDP+A+
Sbjct: 136 IDRRLDSLLDDLQIAHLRNNPALSLSGGERRRVEIARALASAPRFILLDEPFAGVDPIAV 195

Query: 195 SDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRL 254
            +I  ++  L +R IG+LITDHNV E L + D AYII  G VLA G  +EII N+ VRR+
Sbjct: 196 GEIQRIVSFLKARNIGVLITDHNVRETLGICDHAYIISEGTVLAEGQPEEIIANESVRRV 255

Query: 255 YLGDRF 260
           YLG+ F
Sbjct: 256 YLGENF 261


>gi|152978602|ref|YP_001344231.1| ABC transporter related [Actinobacillus succinogenes 130Z]
 gi|150840325|gb|ABR74296.1| ABC transporter related [Actinobacillus succinogenes 130Z]
          Length = 241

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 175/241 (72%), Gaps = 3/241 (1%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K Y +  VV  V   V+  EIVGLLGPNGAGKTT FYM+ GL+  D G I+
Sbjct: 2   TVLYAEHLAKSYKARKVVSDVSFTVRSNEIVGLLGPNGAGKTTSFYMVVGLVRHDEGKIR 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD--KKKRHEKLDS 141
           ID  DI+ +PM+ RA+ GI YLPQEASIFR L+V +N++AVLE+  KD   ++RH++   
Sbjct: 62  IDDEDISLLPMHNRAQKGIGYLPQEASIFRRLSVYDNLMAVLEI-RKDLTPEQRHDRAQE 120

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           L++EFNI   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I
Sbjct: 121 LIEEFNIEHIRDSLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKII 180

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
           +DL  RG+G+LITDHNV E L + +RAYI+ AG ++A GT  E+++N+ V+++YLG+ F 
Sbjct: 181 KDLRDRGLGVLITDHNVRETLDVCERAYIVSAGQMIATGTPAEVMNNEHVKQVYLGEGFK 240

Query: 262 F 262
            
Sbjct: 241 L 241


>gi|260655761|ref|ZP_05861230.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Jonquetella anthropi E3_33 E1]
 gi|260629377|gb|EEX47571.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Jonquetella anthropi E3_33 E1]
          Length = 245

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 166/242 (68%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
           S +  L+A +LTK +    VV  V +    GE+VGLLGPNGAGKTT FYM+ GLI ADSG
Sbjct: 4   SHNKRLAARNLTKSFRRRKVVDNVSIDFACGEVVGLLGPNGAGKTTSFYMIVGLISADSG 63

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLD 140
            + +   D+TKM +Y RAR GI YLPQEAS+FR LTV +N+  VLE     K +   + D
Sbjct: 64  EVYLGDTDVTKMKVYERARAGIGYLPQEASVFRDLTVRQNLELVLEERGASKSEIASERD 123

Query: 141 SLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVL 200
            LL+EF +T+        LSGG+RRR+EIAR+LV+ P +ILLDEPF+G+DP+A+S+I  +
Sbjct: 124 RLLEEFGLTRLADEFGYSLSGGERRRVEIARALVNKPDFILLDEPFSGIDPIAVSEIQEI 183

Query: 201 IRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           IR L SRG G++ITDHNV + L + DRAY+IH G +L  G   EI  N+  R+ YLG+RF
Sbjct: 184 IRQLKSRGFGVMITDHNVRDTLAITDRAYLIHLGQILVQGKPSEIASNEMARKFYLGERF 243

Query: 261 AF 262
           + 
Sbjct: 244 SL 245


>gi|310778163|ref|YP_003966496.1| ABC transporter related protein [Ilyobacter polytropus DSM 2926]
 gi|309747486|gb|ADO82148.1| ABC transporter related protein [Ilyobacter polytropus DSM 2926]
          Length = 241

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 166/235 (70%)

Query: 28  ACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGN 87
           A  L K Y    VV GV L VK GEIVGLLGPNGAGKTT FYMMTG++  +SG +  +  
Sbjct: 6   AQDLCKSYKKRRVVNGVSLEVKKGEIVGLLGPNGAGKTTTFYMMTGIVKPESGKVWCNEM 65

Query: 88  DITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFN 147
           DIT +PMY+RA +G+ YL QE S+FR LTVEENI A+LE+    K +  E ++ LL+EF 
Sbjct: 66  DITGLPMYKRANMGMGYLAQEPSVFRNLTVEENIYAILEMRNISKPEMKETMEKLLEEFK 125

Query: 148 ITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASR 207
           ++     L   LSGG+RRR+EIAR++ + P +ILLDEPFAGVDP+A+ DI  +IR L  +
Sbjct: 126 LSHVSKSLGYSLSGGERRRVEIARTIANNPDFILLDEPFAGVDPIAVEDIQQIIRYLKEK 185

Query: 208 GIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           G+GILITDH+V E L++ ++AYI+  G VL  GT +EI +N+  R++YLG+ F  
Sbjct: 186 GLGILITDHSVRETLSITEKAYIMAQGQVLISGTPKEITENEMARKIYLGEGFKL 240


>gi|226943408|ref|YP_002798481.1| LPS transport protein LptB [Azotobacter vinelandii DJ]
 gi|226718335|gb|ACO77506.1| LPS transport protein LptB [Azotobacter vinelandii DJ]
          Length = 241

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 125/238 (52%), Positives = 174/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y    VV+ V L ++ G+IVGLLGPNGAGKTT FYM+ GL+ AD G I 
Sbjct: 2   ATLKAQHLAKSYKGRQVVRDVSLSIESGQIVGLLGPNGAGKTTCFYMIVGLVRADQGRIL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           +D +D+T +PM+ RAR+GI YLPQEASIFR LTV +NI+A+LE  +  DK+ R + L++L
Sbjct: 62  VDQDDVTHLPMHGRARVGIGYLPQEASIFRKLTVADNIMAILETRKDLDKEGRRQALEAL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I+  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP++++DI  +I 
Sbjct: 122 LQEFHISHIRDSLGMSLSGGERRRVEIARALATTPKFILLDEPFAGVDPISVNDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIG+LITDHNV E L + + AYI++ G ++A G  + ++ N+ V+ +YLG  F
Sbjct: 182 HLKNKGIGVLITDHNVRETLDICETAYIVNDGQLIAEGDAEAVLTNKLVQEVYLGHEF 239


>gi|113461319|ref|YP_719388.1| ABC transporter ATP-binding protein [Haemophilus somnus 129PT]
 gi|112823362|gb|ABI25451.1| ABC transporter, ATP-binding protein [Haemophilus somnus 129PT]
          Length = 241

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 127/240 (52%), Positives = 173/240 (72%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L A  L K Y +  VV  V L V   EIVGLLGPNGAGKTT FYM+ GLI  D G I 
Sbjct: 2   SILHAEHLAKSYKNRQVVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMIVGLIRHDQGKIH 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +PM++RA+ G+ YLPQEASIFR L+V EN++AVLE+ +  + ++R  + D L
Sbjct: 62  IDNEDISLLPMHKRAQRGMGYLPQEASIFRRLSVYENLMAVLEIRKDLNMQQRRTRADEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EFNI      L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I+
Sbjct: 122 IEEFNIGHIYDNLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           DL +RG+G+LITDHNV E L + +RAYI+ +G ++A GT  E+++N+ V+++YLG  F  
Sbjct: 182 DLRNRGLGVLITDHNVRETLDVCERAYIVSSGKMIATGTPAEVMNNEQVKQVYLGKEFKL 241


>gi|315125504|ref|YP_004067507.1| ABC transporter ATP-binding protein [Pseudoalteromonas sp. SM9913]
 gi|315014017|gb|ADT67355.1| ABC transporter ATP-binding protein [Pseudoalteromonas sp. SM9913]
          Length = 241

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 129/240 (53%), Positives = 173/240 (72%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A  L K Y    VVK V L V+ G IVGLLGPNGAGKTT FYM+ GL+ +D G I 
Sbjct: 2   STLKAELLAKSYKGREVVKNVGLEVEAGSIVGLLGPNGAGKTTTFYMIVGLVPSDKGKIS 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID  DIT +PM+ RARLGI YLPQE+SIFR LTV +N++A+LE   E +K++R + L++L
Sbjct: 62  IDDKDITLLPMHSRARLGIGYLPQESSIFRKLTVYQNLMAILETRKELNKQQREDTLNNL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EF+I   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LDEFSIQHIRDSQGMALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVLDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L +RGIG+LITDHNV E L + ++AYI+  G ++A GT + +++++ VR +YLG++F  
Sbjct: 182 HLKNRGIGVLITDHNVRETLDVCEKAYIVSHGELIASGTPEYVLNDKTVRDVYLGEQFKL 241


>gi|170717855|ref|YP_001784913.1| ABC transporter [Haemophilus somnus 2336]
 gi|168825984|gb|ACA31355.1| ABC transporter related [Haemophilus somnus 2336]
          Length = 241

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 127/240 (52%), Positives = 173/240 (72%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L A  L K Y +  VV  V L V   EIVGLLGPNGAGKTT FYM+ GLI  D G I 
Sbjct: 2   SILHAEHLAKSYKNRQVVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMIVGLIRHDQGKIH 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +PM++RA+ G+ YLPQEASIFR L+V EN++AVLE+ +  + ++R  + D L
Sbjct: 62  IDNEDISLLPMHKRAQRGMGYLPQEASIFRRLSVYENLMAVLEIRKDLNMQQRRTRADEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EFNI      L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I+
Sbjct: 122 IEEFNIGHICDNLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           DL +RG+G+LITDHNV E L + +RAYI+ +G ++A GT  E+++N+ V+++YLG  F  
Sbjct: 182 DLRNRGLGVLITDHNVRETLDVCERAYIVSSGKMIATGTPAEVMNNEQVKQVYLGKEFKL 241


>gi|188532473|ref|YP_001906270.1| putative ABC transporter ATP-binding protein YhbG [Erwinia
           tasmaniensis Et1/99]
 gi|188027515|emb|CAO95362.1| Putative ABC superfamily transport protein [Erwinia tasmaniensis
           Et1/99]
          Length = 241

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 173/238 (72%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A +L K Y    VV+ V L VK GEIVGLLGPNGAGKTT FYM+ G++  D+G I 
Sbjct: 2   ATLIAENLAKAYKGRRVVEDVSLQVKSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGRIV 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHE-KLDSL 142
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V +N++AVL++ E   K++HE + + L
Sbjct: 62  IDDEDISILPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIREDLTKEQHEDRANEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EFNI   R+ L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LAEFNIEHLRNSLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT + ++ ++ V+R+YLG+ F
Sbjct: 182 HLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPEAVLADEQVKRVYLGEEF 239


>gi|318604034|emb|CBY25532.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 241

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 171/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y    VV+ V L VK GEIVGLLGPNGAGKTT FYM+ G++  D+G I 
Sbjct: 2   ATLIAEKLAKAYKGRKVVENVSLKVKSGEIVGLLGPNGAGKTTTFYMVVGIVQRDAGRIV 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +P++ RA  GI YLPQEASIFR L+V  N++AVLE+ +    ++R E+ D L
Sbjct: 62  IDDEDISLLPLHERALRGIGYLPQEASIFRRLSVFNNLMAVLEIRKDLSSEQRQERADEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+IT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 MEEFHITHLRDSLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT QEI+ ++ V+R+YLG+ F
Sbjct: 182 HLRDSGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGTPQEILADEQVKRVYLGEEF 239


>gi|302877524|ref|YP_003846088.1| ABC transporter related [Gallionella capsiferriformans ES-2]
 gi|302580313|gb|ADL54324.1| ABC transporter related [Gallionella capsiferriformans ES-2]
          Length = 240

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 171/237 (72%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A +L KKY    VV    L VK GE+VGLLGPNGAGKTT FYM+ GL+ AD G I 
Sbjct: 2   SELRAVALKKKYGLRTVVHDASLSVKSGEVVGLLGPNGAGKTTSFYMIVGLVAADGGKIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           ID  DIT +P++RRARLG+ YLPQEASIFR +TV +NI AVLE+ +   ++   +L+ LL
Sbjct: 62  IDDQDITHLPIHRRARLGLGYLPQEASIFRRMTVAQNIQAVLELQDLSDEEIERRLEELL 121

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + +I   R+  A  LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+A+ DI  +IR 
Sbjct: 122 HDLHIQGIRNNPAISLSGGERRRVEIARALATNPRFILLDEPFAGVDPIAVLDIQKIIRF 181

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  R IG+LITDHNV E L + DRAYII+AG V+A G   EII N+ VR++YLG+ F
Sbjct: 182 LKERNIGVLITDHNVRETLGICDRAYIINAGAVMAEGKPDEIIYNEGVRKVYLGENF 238


>gi|224826289|ref|ZP_03699391.1| ABC transporter related protein [Lutiella nitroferrum 2002]
 gi|224601390|gb|EEG07571.1| ABC transporter related protein [Lutiella nitroferrum 2002]
          Length = 242

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 130/237 (54%), Positives = 170/237 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L+   L K++    VVK V L ++ GE++GLLGPNGAGKTT FYM+ GL+ AD G I+
Sbjct: 4   SVLNVTGLKKRFKKRTVVKDVSLNIESGEVIGLLGPNGAGKTTSFYMIVGLVSADDGRIQ 63

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +D  DIT  PM++RARLG+ YLPQEASIFR +TV+EN+ A+LE+     ++  ++L  LL
Sbjct: 64  LDQQDITHFPMHQRARLGLGYLPQEASIFRKMTVDENVRAILEIAGLKGEELEQELTLLL 123

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI   R   A  LSGG+RRR+EIAR L + P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 124 DDLNIAHLRESNALALSGGERRRVEIARVLATRPRFILLDEPFAGVDPIAVIDIQKIISF 183

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L + DRAYII  G VLA G  Q ++DN+ VR++YLG+ F
Sbjct: 184 LKERGIGVLITDHNVRETLRICDRAYIISDGAVLASGKPQALVDNEKVRQVYLGEHF 240


>gi|221134721|ref|ZP_03561024.1| ABC transporter related protein [Glaciecola sp. HTCC2999]
          Length = 241

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 125/238 (52%), Positives = 167/238 (70%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y S  VV+ V + V+ G+IVGLLGPNGAGKTT FYM+ GL+  D G I 
Sbjct: 2   ATLKATHLAKSYKSRKVVRDVSIEVESGQIVGLLGPNGAGKTTTFYMIVGLVPLDHGEIL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           +D  ++T  PM+ RAR GI YLPQEASIFR LTV ENI+A+L+   E   ++R    D+L
Sbjct: 62  LDQTELTLQPMHERARQGIGYLPQEASIFRKLTVYENIMAILQTRKELSNQQRESHADAL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EFNI   R+     LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I+
Sbjct: 122 LDEFNINHIRNSAGMALSGGERRRVEIARALAADPKFILLDEPFAGVDPISVGDIKQIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIG+LITDHNV E L + ++AYI+  G ++A GT  +++ N+ V+ +YLG+ F
Sbjct: 182 QLKQRGIGVLITDHNVRETLDVCEKAYIVSHGELIAAGTASQVLQNKKVKEVYLGEEF 239


>gi|21232232|ref|NP_638149.1| ABC transporter ATP-binding protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66767639|ref|YP_242401.1| ABC transporter ATP-binding protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188990755|ref|YP_001902765.1| ABC transporter ATP-binding protein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21113991|gb|AAM42073.1| ABC transporter ATP-binding protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66572971|gb|AAY48381.1| ABC transporter ATP-binding protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167732515|emb|CAP50709.1| ABC transporter ATP-binding protein [Xanthomonas campestris pv.
           campestris]
          Length = 239

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 167/237 (70%), Gaps = 1/237 (0%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L KKY    VVK   L ++ GE+VGLLGPNGAGKTT FYM+ GL+ AD+G I++
Sbjct: 1   MLVATGLRKKYKQREVVKEFGLTLEAGEVVGLLGPNGAGKTTCFYMIVGLVEADAGRIEL 60

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLL 143
           DG D+T  PMY RA+LG+ YLPQE S+FR L+V +NI  VLE+ +  D   + ++L SLL
Sbjct: 61  DGRDLTAEPMYARAKLGVGYLPQEPSVFRKLSVADNIRLVLELRDDLDGPGQEKELASLL 120

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +E  IT     L   LSGG+RRR EIAR+L + P  +LLDEPFAGVDP+++ +I  ++  
Sbjct: 121 EELQITHVADQLGASLSGGERRRCEIARALAAKPRMMLLDEPFAGVDPISVGEIQRIVIH 180

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L + DRAYI+  GGVLA G    +++N DVRR+YLGD F
Sbjct: 181 LKERGIGVLITDHNVRETLGICDRAYILAEGGVLAQGAPDALLNNPDVRRVYLGDTF 237


>gi|33598534|ref|NP_886177.1| ABC transporter [Bordetella parapertussis 12822]
 gi|33574663|emb|CAE39315.1| ABC transporter [Bordetella parapertussis]
          Length = 263

 Score =  255 bits (652), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 133/238 (55%), Positives = 169/238 (71%), Gaps = 6/238 (2%)

Query: 29  CSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGND 88
             L K YN   VV+ V L V  GE+VGLLGPNGAGKTT FYM+ GL+ ADSG I+IDG++
Sbjct: 24  TGLRKTYNGRTVVQDVSLSVVSGEVVGLLGPNGAGKTTSFYMIVGLVPADSGRIEIDGSN 83

Query: 89  ITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR------HEKLDSL 142
           IT MP+++RAR+G+SYLPQ+AS+FR LTVE+NI AVLE+      K        + L++L
Sbjct: 84  ITSMPIHKRARMGLSYLPQDASVFRRLTVEQNIRAVLELQLGPNGKPLPEARIRDNLEAL 143

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+E  I   R   A  LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+A+ +I  ++R
Sbjct: 144 LEELQIGHIRANTAISLSGGERRRVEIARALATSPRFILLDEPFAGVDPIAVIEIQRIVR 203

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIG+LITDHNV E L + DRAYII  G VL  G   EI+ +  VRR+YLG+ F
Sbjct: 204 FLKGRGIGVLITDHNVRETLGICDRAYIISEGKVLTDGHPDEIVGDPAVRRVYLGEHF 261


>gi|285018903|ref|YP_003376614.1| ABC transporter ATP-binding protein [Xanthomonas albilineans GPE
           PC73]
 gi|283474121|emb|CBA16622.1| probable abc transporter atp-binding protein [Xanthomonas
           albilineans]
          Length = 239

 Score =  255 bits (652), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 167/237 (70%), Gaps = 1/237 (0%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L K+Y    VV+   L +  GE+VGLLGPNGAGKTT FYM+ GL+ AD+G I +
Sbjct: 1   MLLAEGLRKRYKQREVVRDFGLTLDAGEVVGLLGPNGAGKTTCFYMIVGLVEADAGRIVL 60

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLL 143
           DGNDIT +PMY+RA+LG+ YLPQE S+FR L+V +NI  VLE+ E  D+  +  +L SLL
Sbjct: 61  DGNDITALPMYKRAKLGVGYLPQEPSVFRKLSVADNIRLVLELREDLDEAGQERELLSLL 120

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            E  I      L   LSGG+RRR EIAR+L + P  +LLDEPFAGVDP+++ +I  ++  
Sbjct: 121 DELQIGHVAEQLGASLSGGERRRCEIARALAAKPRLMLLDEPFAGVDPISVGEIQRIVTH 180

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L + DRAYI++ GGVLA G  + ++ N DVRR+YLG+ F
Sbjct: 181 LKQRGIGVLITDHNVRETLGICDRAYILNEGGVLAQGAPEALLANSDVRRVYLGETF 237


>gi|238756130|ref|ZP_04617451.1| Uncharacterized ABC transporter ATP-binding protein [Yersinia
           ruckeri ATCC 29473]
 gi|238705669|gb|EEP98065.1| Uncharacterized ABC transporter ATP-binding protein [Yersinia
           ruckeri ATCC 29473]
          Length = 241

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 172/238 (72%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y    VV GV L V  GEIVGLLGPNGAGKTT FYM+ G++  D+G I 
Sbjct: 2   ATLIAEKLAKAYKGRKVVDGVSLKVNSGEIVGLLGPNGAGKTTTFYMVVGIVQRDAGRIV 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V  N++AVLE+ ++   ++R E+ + L
Sbjct: 62  IDDEDISLLPLHERARRGIGYLPQEASIFRRLSVYNNLMAVLEIRHDLSTEQRKERAEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+IT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 MEEFHITHLRDSLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT Q+I+ ++ V+R+YLG+ F
Sbjct: 182 HLRDSGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGTPQDILADEQVKRVYLGEEF 239


>gi|238789760|ref|ZP_04633542.1| Uncharacterized ABC transporter ATP-binding protein [Yersinia
           frederiksenii ATCC 33641]
 gi|238722119|gb|EEQ13777.1| Uncharacterized ABC transporter ATP-binding protein [Yersinia
           frederiksenii ATCC 33641]
          Length = 241

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 171/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y    VV+ V L VK GEIVGLLGPNGAGKTT FYM+ G++  D+G I 
Sbjct: 2   ATLIAEKLAKAYKGRKVVEDVSLTVKSGEIVGLLGPNGAGKTTTFYMVVGIVQRDAGRIV 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +P++ RA  GI YLPQEASIFR L+V  N++AVLE+ +    ++R E+ D L
Sbjct: 62  IDDEDISLLPLHERALRGIGYLPQEASIFRRLSVFNNLMAVLEIRKDLSSEQRQERADEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+IT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 MEEFHITHLRDSLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT QEI+ ++ V+R+YLG+ F
Sbjct: 182 HLRDSGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGTPQEILADEQVKRVYLGEEF 239


>gi|290476793|ref|YP_003469704.1| putative ABC transporter ATP-binding protein [Xenorhabdus bovienii
           SS-2004]
 gi|289176137|emb|CBJ82942.1| putative transport protein (ABC superfamily, atp_bind) [Xenorhabdus
           bovienii SS-2004]
          Length = 241

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 126/239 (52%), Positives = 180/239 (75%), Gaps = 3/239 (1%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L+A +L K Y    VV+ V L VK GEIVGLLGPNGAGKTT FYM+ G++  D+G+I 
Sbjct: 2   AILNAENLAKAYKGRRVVEDVSLTVKSGEIVGLLGPNGAGKTTTFYMVVGIVPRDTGTIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD--KKKRHEKLDS 141
           ID  DI+ +P++ RAR GI YLPQE SIFR L+V +N++AVLE+  KD  +++R E+ + 
Sbjct: 62  IDDEDISLLPLHERARRGIGYLPQEPSIFRRLSVFDNLMAVLEI-RKDITQEQRKERAEE 120

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           L++EF+I+  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I
Sbjct: 121 LMEEFHISHLRDNLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVLDIKKII 180

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           + L   G+G+LITDHNV E L + +RAYI+  G ++AHG+ ++I++N+ V+R+YLG+ F
Sbjct: 181 QHLRDYGLGVLITDHNVRETLDVCERAYIVSQGQLIAHGSPEDILNNEQVKRVYLGEGF 239


>gi|223558001|gb|ACM91007.1| ABC transporter ATP-binding protein [uncultured bacterium URE4]
          Length = 286

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 120/228 (52%), Positives = 165/228 (72%)

Query: 33  KKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKM 92
           KKY    VVKGV + V  GEIVG LGPNGAGKTT FYM+TG I  + G I ID +++T +
Sbjct: 2   KKYGVRTVVKGVSMEVSQGEIVGFLGPNGAGKTTSFYMITGQIVPNEGRIFIDDDELTGL 61

Query: 93  PMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITKWR 152
           PMY+R++ G+ YLPQEAS+FR ++VE+NI++V+E+ +  +++R  +L+ L+ EFN++K R
Sbjct: 62  PMYKRSQKGVGYLPQEASVFRKMSVEDNIMSVMEMTQMTREQREARLEQLIDEFNLSKVR 121

Query: 153 HVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIGIL 212
             L   LSGG+RRR EIAR+L   P +ILLDEPFAGVDP+A+ DI  +I  L  R IG++
Sbjct: 122 KSLGIQLSGGERRRCEIARALAVDPKFILLDEPFAGVDPIAVEDIQYIIAKLKFRNIGVI 181

Query: 213 ITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           ITDHNV E L + DRAY+++ G +L  GT +++  + DVR  YLG  F
Sbjct: 182 ITDHNVGETLAITDRAYLLYEGTILQEGTPEQLAADDDVRTKYLGSGF 229


>gi|192361409|ref|YP_001983263.1| ABC transporter ATP-binding protein [Cellvibrio japonicus Ueda107]
 gi|190687574|gb|ACE85252.1| ABC transporter, ATP-binding protein [Cellvibrio japonicus Ueda107]
          Length = 257

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 132/245 (53%), Positives = 174/245 (71%), Gaps = 3/245 (1%)

Query: 19  RASKDSL--LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLIC 76
           + S D +  L A +L K Y    VV  V + V  G IVGLLGPNGAGKTT FYM+ GL+ 
Sbjct: 11  KPSTDPMPRLHAQNLAKSYKKRTVVVDVSMTVDSGTIVGLLGPNGAGKTTCFYMIAGLVP 70

Query: 77  ADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKR 135
           AD G + ID  DIT +P++ RAR GI YLPQEASIFR L+V +NI+A+LE  +  D+K+R
Sbjct: 71  ADKGRVLIDDLDITPLPIHGRARAGIGYLPQEASIFRKLSVADNIMAILETRKDLDRKQR 130

Query: 136 HEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAIS 195
            EKL+SLL EF+IT  R+ L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++S
Sbjct: 131 LEKLESLLGEFHITHIRNSLGMSLSGGERRRVEIARALATDPQFILLDEPFAGVDPISVS 190

Query: 196 DIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLY 255
           DI  ++R L  RGIG+LITDHNV E L + + AYI+  G ++A G  + ++ +  VR +Y
Sbjct: 191 DIKEIVRHLKDRGIGVLITDHNVRETLDICETAYIVSEGHIIASGQPETVLAHPRVREVY 250

Query: 256 LGDRF 260
           LG+ F
Sbjct: 251 LGEHF 255


>gi|160872575|ref|ZP_02062707.1| ABC transporter, ATP-binding protein [Rickettsiella grylli]
 gi|160872760|ref|ZP_02062892.1| ABC transporter, ATP-binding protein [Rickettsiella grylli]
 gi|159121374|gb|EDP46712.1| ABC transporter, ATP-binding protein [Rickettsiella grylli]
 gi|159121559|gb|EDP46897.1| ABC transporter, ATP-binding protein [Rickettsiella grylli]
          Length = 241

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 124/236 (52%), Positives = 173/236 (73%), Gaps = 1/236 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L+A  LTK+Y+S  VV+ V L ++ GE++GLLGPNGAGKTT FY++ GL+    G I ++
Sbjct: 4   LNAIHLTKRYHSRIVVENVSLELETGEVIGLLGPNGAGKTTSFYLIVGLVTCTQGKILLN 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSLLK 144
             +IT +PM+ RA+ GI YLPQE SIFR LTV +NILA+L++ ++  K++R + L++LL+
Sbjct: 64  NQNITHLPMHARAKAGIGYLPQEPSIFRKLTVADNILAILQLRHDLSKEQRKQHLENLLR 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+IT  R  L   LSGG+RRR+EIAR+L   P ++LLDEPFAG+DP+++ DI  +I  L
Sbjct: 124 EFHITPIRDTLGIRLSGGERRRVEIARALAMEPKFMLLDEPFAGIDPISVVDIKRMIIHL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           + RGIG+LITDHNV E L +  RAYI++ G  +  GT QE++ NQ VR +YLG  F
Sbjct: 184 SQRGIGVLITDHNVRETLAICKRAYIVNEGKTIYVGTPQEVLKNQRVREIYLGHEF 239


>gi|123443941|ref|YP_001007912.1| putative ABC transporter ATP-binding protein YhbG [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|238764278|ref|ZP_04625230.1| Uncharacterized ABC transporter ATP-binding protein [Yersinia
           kristensenii ATCC 33638]
 gi|332163086|ref|YP_004299663.1| putative ABC transporter ATP-binding protein YhbG [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|122090902|emb|CAL13784.1| probable ABC transporter ATP-binding protein [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|238697559|gb|EEP90324.1| Uncharacterized ABC transporter ATP-binding protein [Yersinia
           kristensenii ATCC 33638]
 gi|325667316|gb|ADZ43960.1| putative ABC transporter ATP-binding protein YhbG [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
          Length = 241

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 171/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y    VV+ V L VK GEIVGLLGPNGAGKTT FYM+ G++  D+G I 
Sbjct: 2   ATLIAEKLAKAYKGRKVVEDVSLKVKSGEIVGLLGPNGAGKTTTFYMVVGIVQRDAGRIV 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +P++ RA  GI YLPQEASIFR L+V  N++AVLE+ +    ++R E+ D L
Sbjct: 62  IDDEDISLLPLHERALRGIGYLPQEASIFRRLSVFNNLMAVLEIRKDLSSEQRQERADEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+IT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 MEEFHITHLRDSLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT QEI+ ++ V+R+YLG+ F
Sbjct: 182 HLRDSGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGTPQEILADEQVKRVYLGEEF 239


>gi|262373035|ref|ZP_06066314.1| urea ABC transporter, ATP-binding protein UrtE [Acinetobacter junii
           SH205]
 gi|262313060|gb|EEY94145.1| urea ABC transporter, ATP-binding protein UrtE [Acinetobacter junii
           SH205]
          Length = 248

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 127/245 (51%), Positives = 174/245 (71%), Gaps = 1/245 (0%)

Query: 17  ENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLIC 76
           E  A +   L    L K Y+  +VVK V   ++ G+IVGLLGPNGAGKTT FYM+ GL+ 
Sbjct: 2   EQSAQQPQTLCIKHLAKNYSKRWVVKDVSFTMQSGQIVGLLGPNGAGKTTSFYMVVGLVR 61

Query: 77  ADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKR 135
            D G I +D  D++ + M+ RAR GI YLPQEASIFR LT+ ENI+A+LE  +  +K++R
Sbjct: 62  MDKGEIHLDDLDLSDLAMHERARKGIGYLPQEASIFRKLTISENIMAILETRKDLNKQQR 121

Query: 136 HEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAIS 195
            ++L+ LL +F I+  +  L   +SGG+RRR EIAR+L + P ++LLDEPFAGVDP+++ 
Sbjct: 122 QQRLNELLNDFKISHIKDSLGMSVSGGERRRAEIARALAADPKFMLLDEPFAGVDPISVG 181

Query: 196 DIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLY 255
           DI  +I+ L  RGIG+LITDHNV E L + ++AYI+  G V+A GT QEI+DN+ VR++Y
Sbjct: 182 DIKDIIQTLKERGIGVLITDHNVRETLAICEKAYIVSEGAVIAEGTPQEILDNEQVRKVY 241

Query: 256 LGDRF 260
           LGD F
Sbjct: 242 LGDDF 246


>gi|325284950|ref|YP_004260740.1| Fe(3+)-transporting ATPase [Cellulophaga lytica DSM 7489]
 gi|324320404|gb|ADY27869.1| Fe(3+)-transporting ATPase [Cellulophaga lytica DSM 7489]
          Length = 249

 Score =  255 bits (651), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 122/235 (51%), Positives = 172/235 (73%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A ++ K Y    VVKG+ L V  GEIVGLLGPNGAGKTT FYM+ GL+  + G+I ++
Sbjct: 6   LRADNIMKSYKGRQVVKGISLEVNQGEIVGLLGPNGAGKTTSFYMIVGLVKPNGGNIYLN 65

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             +IT+ PMY+RA+ GI YL QEAS+FR L++E+NIL+VL++ +  KK++H K++SL++E
Sbjct: 66  DMNITQFPMYKRAQNGIGYLAQEASVFRKLSIEKNILSVLQLTKLSKKEQHMKMESLIEE 125

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F++   R     LLSGG+RRR EIAR+L + P +ILLDEPFAGVDPVA+ DI  ++  L 
Sbjct: 126 FSLGHIRKNRGDLLSGGERRRTEIARALATDPKFILLDEPFAGVDPVAVEDIQRIVAQLK 185

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           ++ IGILITDHNV E L + +R+Y++  GG+L  G  +E+  ++ VR++YLG  F
Sbjct: 186 NKNIGILITDHNVQETLAITERSYLMFEGGILKSGEPEELAADEMVRQVYLGQNF 240


>gi|332664515|ref|YP_004447303.1| Fe(3+)-transporting ATPase [Haliscomenobacter hydrossis DSM 1100]
 gi|332333329|gb|AEE50430.1| Fe(3+)-transporting ATPase [Haliscomenobacter hydrossis DSM 1100]
          Length = 258

 Score =  255 bits (651), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 121/236 (51%), Positives = 168/236 (71%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L + +L K Y   +VVKGV + V  GEIVGLLGPNGAGKTT FYM+ G I  + G + +
Sbjct: 2   ILRSDNLIKVYGRRHVVKGVSINVNQGEIVGLLGPNGAGKTTTFYMVVGFIQPNEGKVFL 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           +  +IT +PMY+RA+ GI YLPQE S+FR LTVE+N+ AVLE+    K ++ +KL+ L+ 
Sbjct: 62  NDEEITNLPMYKRAQKGIGYLPQEPSVFRKLTVEDNVKAVLEMTNLSKAEQKDKLEELMD 121

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF + K R      LSGG+RRR EIAR+L + P++ILLDEPFAG+DP+A+ DI  ++  L
Sbjct: 122 EFGLHKVRKSRGDTLSGGERRRTEIARALATSPTFILLDEPFAGIDPIAVEDIQYIVAKL 181

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            ++ IGILITDHNV E L++ DRAY++  G +L  GT +E+  ++ VR++YLG  F
Sbjct: 182 KTKNIGILITDHNVQETLSITDRAYLMFEGNILKAGTAEELAADEMVRKVYLGQHF 237


>gi|330752409|emb|CBL87360.1| ABC transporter [uncultured Flavobacteria bacterium]
          Length = 243

 Score =  255 bits (651), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 125/238 (52%), Positives = 165/238 (69%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L   +++K Y    VV  V L VK GEIVGLLGPNGAGKTT FY++ GLI   SG I I
Sbjct: 2   VLDIKNISKSYGKKIVVDNVSLNVKQGEIVGLLGPNGAGKTTSFYIVVGLIKPKSGDIFI 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           +  +ITK PMY+R++ GI YL QEAS+FR LTVEENI  VLE+ +  KK++  +++ LL 
Sbjct: 62  NKQNITKFPMYKRSQNGIGYLSQEASVFRKLTVEENIRGVLELTKLTKKQQKNRVELLLN 121

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF +++ R     LLSGGQRRR EIAR+L + P ++LLDEPFAGVDP+A+ DI  +I  L
Sbjct: 122 EFGLSEIRKTRGDLLSGGQRRRTEIARALATEPKFVLLDEPFAGVDPLAVEDIQQIISQL 181

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             + IGILITDHNV E L + DR Y++  G +L  G  QE++ ++ VR++YLG  F  
Sbjct: 182 KEKNIGILITDHNVQETLAITDRTYLMFEGKILKSGKPQELVSDEIVRKVYLGQNFEL 239


>gi|311277826|ref|YP_003940057.1| ABC transporter related protein [Enterobacter cloacae SCF1]
 gi|308747021|gb|ADO46773.1| ABC transporter related protein [Enterobacter cloacae SCF1]
          Length = 241

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 176/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L+A +L K Y    VV+ V L V  GEIVGLLGPNGAGKTT FYM+ G++  D+G+I 
Sbjct: 2   ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNII 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           IDG+DI+ +P++ RAR GI YLPQEASIFR L+V +N++AVL++ +    ++R ++ + L
Sbjct: 62  IDGDDISLLPLHARARRGIGYLPQEASIFRRLSVFDNLMAVLQIRDDLSNEQREDRANEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+I   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 MEEFHIEHLRDSLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT +EI+ ++ V+R+YLG+ F
Sbjct: 182 HLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPEEILQDEQVKRVYLGEDF 239


>gi|257457963|ref|ZP_05623122.1| ABC transporter, ATP-binding protein [Treponema vincentii ATCC
           35580]
 gi|257444676|gb|EEV19760.1| ABC transporter, ATP-binding protein [Treponema vincentii ATCC
           35580]
          Length = 303

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 170/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L A  L K +     VK V   +  GE+VGLLGPNGAGKTT FYM+ G    +SG I 
Sbjct: 64  SILRAEGLNKSFRKKQAVKDVSFSMAQGEVVGLLGPNGAGKTTSFYMIVGFYTPNSGGIY 123

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           +D   IT++PMY+RAR+GISYLPQEAS+FR L+VE+NI A+LE  +   + +R EKL+SL
Sbjct: 124 LDDRRITELPMYKRARIGISYLPQEASVFRKLSVEQNIDAILETRKDLSRAERKEKLNSL 183

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF IT  R   A  LSGG+RRR EIAR+L   P ++LLDEPFAG+DP+A+ DI ++IR
Sbjct: 184 LEEFGITANRKQPAYTLSGGERRRTEIARALAIEPKFLLLDEPFAGIDPIAVHDIKLIIR 243

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            LA + IG+LITDHNV + L + DRAYII+ G ++  G   +I++++  R++YLG+ F
Sbjct: 244 LLARQNIGVLITDHNVRDTLEITDRAYIINKGEIVEQGPRDKILESEIARKVYLGEEF 301


>gi|126175862|ref|YP_001052011.1| ABC transporter-like protein [Shewanella baltica OS155]
 gi|152999226|ref|YP_001364907.1| ABC transporter-like protein [Shewanella baltica OS185]
 gi|160873839|ref|YP_001553155.1| ABC transporter-like protein [Shewanella baltica OS195]
 gi|217971899|ref|YP_002356650.1| ABC transporter-like protein [Shewanella baltica OS223]
 gi|125999067|gb|ABN63142.1| ABC transporter related [Shewanella baltica OS155]
 gi|151363844|gb|ABS06844.1| ABC transporter related [Shewanella baltica OS185]
 gi|160859361|gb|ABX47895.1| ABC transporter related [Shewanella baltica OS195]
 gi|217497034|gb|ACK45227.1| ABC transporter related [Shewanella baltica OS223]
 gi|315266066|gb|ADT92919.1| ABC transporter related protein [Shewanella baltica OS678]
          Length = 243

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 136/236 (57%), Positives = 174/236 (73%), Gaps = 1/236 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L K Y S  VVK V L VK G++VGLLGPNGAGKTT FYM+ GL+ +D G I ID
Sbjct: 6   LRAQNLAKSYKSRQVVKDVSLTVKTGQVVGLLGPNGAGKTTTFYMVVGLVKSDKGHIFID 65

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSLLK 144
            +D+T  PM+ RAR GI YLPQEASIFR LTV +NI+AVL+   E  K++R E+L+ LL+
Sbjct: 66  DDDLTADPMHLRARKGIGYLPQEASIFRKLTVHDNIMAVLQTRKELKKEQREEELEHLLE 125

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+IT  R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I  L
Sbjct: 126 EFHITHIRDSQGMSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIEQL 185

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            SRG+G+LITDHNV E L + + AYI+  G ++A GT  EI+DNQ VR +YLG++F
Sbjct: 186 KSRGLGVLITDHNVRETLDVCEHAYIVSHGNLIAEGTPAEILDNQQVRAVYLGEQF 241


>gi|149378029|ref|ZP_01895753.1| ABC transporter, ATP-binding protein [Marinobacter algicola DG893]
 gi|149357684|gb|EDM46182.1| ABC transporter, ATP-binding protein [Marinobacter algicola DG893]
          Length = 241

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 172/238 (72%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A +L K Y    VV  V L ++ GEIVGLLGPNGAGKTT FYM+ GL+ AD+G I 
Sbjct: 2   AVLRASNLAKSYKQKKVVIDVSLEIRSGEIVGLLGPNGAGKTTCFYMIVGLVSADNGRIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKK-RHEKLDSL 142
           ID  DIT +PM+ RAR GI YLPQEAS+FR LTV +NILA+LE   + K+  R  KL+ L
Sbjct: 62  IDNQDITPLPMHGRARKGIGYLPQEASVFRKLTVRDNILAILETRRELKRADREAKLEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+IT  R  +   LSGG+RRR+EIAR+L   P++ILLDEPFAGVDP+++SDI  +IR
Sbjct: 122 LEEFHITHIRDSVGMALSGGERRRVEIARALAMEPAFILLDEPFAGVDPISVSDIKQIIR 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  +GIG+LITDHNV E L + + AYI+  G ++A G   +I+ NQ V+ +YLG+ F
Sbjct: 182 HLRDKGIGVLITDHNVRETLDICENAYIVSGGHIIASGNSDDILANQQVKEVYLGNEF 239


>gi|86140392|ref|ZP_01058951.1| ABC transporter, ATP-binding protein [Leeuwenhoekiella blandensis
           MED217]
 gi|85832334|gb|EAQ50783.1| ABC transporter, ATP-binding protein [Leeuwenhoekiella blandensis
           MED217]
          Length = 246

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 167/235 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L K Y    VVK + + V+ GEIVGLLGPNGAGKTT FYM+ GL+  + G+I +D
Sbjct: 3   LRAENLMKSYKGRKVVKSISVEVEQGEIVGLLGPNGAGKTTSFYMIVGLVKPNGGTIYLD 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             DITK PMY+RA+ GI YL QEAS+FR L++EENIL+VL++ +  KK++  K++ L+ E
Sbjct: 63  NKDITKYPMYKRAQNGIGYLAQEASVFRKLSIEENILSVLQMTKLSKKEQLAKMEELIDE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F++   R     LLSGG+RRR EIAR+L + P++ILLDEPFAGVDPVA+ DI  ++  L 
Sbjct: 123 FSLGHIRKNRGDLLSGGERRRTEIARALATNPNFILLDEPFAGVDPVAVEDIQRIVAQLK 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            + IGILITDHNV E L + D  Y++  G +L HG  +E+  ++ VR++YLG  F
Sbjct: 183 QKNIGILITDHNVQETLAITDHTYLMFEGSILKHGVPEELAADEMVRKVYLGQNF 237


>gi|303230201|ref|ZP_07316969.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Veillonella atypica ACS-134-V-Col7a]
 gi|303230982|ref|ZP_07317725.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Veillonella atypica ACS-049-V-Sch6]
 gi|302514364|gb|EFL56363.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Veillonella atypica ACS-049-V-Sch6]
 gi|302515127|gb|EFL57101.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Veillonella atypica ACS-134-V-Col7a]
          Length = 239

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 127/233 (54%), Positives = 165/233 (70%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           +L K +N   VV GV L+V+ G++VGLLGPNGAGKTT FYM+ G+    +G I +DG DI
Sbjct: 7   NLVKTFNGRNVVDGVSLHVEKGQVVGLLGPNGAGKTTSFYMIVGIEKPTTGIITVDGKDI 66

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           T +PMY+RA  GI YLPQEASIFR +TVEENI A+LE   K++ +  + ++SL+ EFNI 
Sbjct: 67  TMLPMYKRAAEGIGYLPQEASIFRSMTVEENIRAMLETTNKNRDEIDQIVNSLIDEFNIG 126

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             R      LSGG+RRR+EIAR L   P++ILLDEPFAGVDP+A++DI  +I  + +RGI
Sbjct: 127 HVRDRKGMQLSGGERRRVEIARCLALEPNFILLDEPFAGVDPIAVADIQQIILQVKNRGI 186

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           GILITDHNV E L ++D+AYI+  G +L  GT  EI +N   R  YLG+ F  
Sbjct: 187 GILITDHNVRETLGIVDKAYILSTGKILLEGTPDEIANNPIAREHYLGNNFKL 239


>gi|38784|emb|CAA47286.1| ORF280 [Ralstonia eutropha H16]
          Length = 280

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 134/242 (55%), Positives = 168/242 (69%), Gaps = 5/242 (2%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L    L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D G I 
Sbjct: 37  STLVVRHLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVALDEGDIV 96

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD-----KKKRHEK 138
           +DG+ I+ +P++ RA +G+SYLPQEAS+FR L VEENI AVLE+   +     K +   +
Sbjct: 97  LDGDHISGLPIHERAPMGLSYLPQEASVFRKLNVEENIRAVLELQVSNGKPLPKAEIERR 156

Query: 139 LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIH 198
           LDSLL +  I   R+  A  LSGG+RRR+EIAR+L S P +ILLDEPFAGVDP+A+ +I 
Sbjct: 157 LDSLLDDLQIAHLRNNPALSLSGGERRRVEIARALASSPRFILLDEPFAGVDPIAVGEIQ 216

Query: 199 VLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGD 258
            ++  L +R IG+LITDHNV E L + D AYII  G VLA G  +EII N  VRR+YLG+
Sbjct: 217 RIVSFLKARNIGVLITDHNVRETLGICDHAYIISEGTVLAAGQPEEIIANDAVRRVYLGE 276

Query: 259 RF 260
            F
Sbjct: 277 NF 278


>gi|154494357|ref|ZP_02033677.1| hypothetical protein PARMER_03712 [Parabacteroides merdae ATCC
           43184]
 gi|154085801|gb|EDN84846.1| hypothetical protein PARMER_03712 [Parabacteroides merdae ATCC
           43184]
          Length = 256

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 164/238 (68%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L    L KKY +  VV  V + VK GEIVGLLGPNGAGKTT FYM  GL+  + G I +
Sbjct: 14  VLRTEDLVKKYKTRTVVNHVSINVKQGEIVGLLGPNGAGKTTTFYMTVGLVTPNEGKIFL 73

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           +  +ITK P+Y+RAR GI YL QEASIFR +TVE+NI +VLE+ E   + + EKL+SL+ 
Sbjct: 74  NDMEITKFPVYKRARNGIGYLAQEASIFRKMTVEDNIRSVLEMTETTSEYQKEKLESLIA 133

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF + K R  L   LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  L
Sbjct: 134 EFGLNKVRKNLGDQLSGGERRRAEIARCLAIDPKFIMLDEPFAGVDPIAVQDIQSIVAKL 193

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             + IGILITDHNV+E L++ DRAY++  G VL  GT +++ +N+ VR  YLG  F  
Sbjct: 194 KHKNIGILITDHNVYETLSICDRAYLLFEGKVLFQGTAEQLAENEIVREKYLGKDFVL 251


>gi|238751361|ref|ZP_04612854.1| Uncharacterized ABC transporter ATP-binding protein [Yersinia
           rohdei ATCC 43380]
 gi|238710419|gb|EEQ02644.1| Uncharacterized ABC transporter ATP-binding protein [Yersinia
           rohdei ATCC 43380]
          Length = 241

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 172/239 (71%), Gaps = 3/239 (1%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y    VV+ V L VK GEIVGLLGPNGAGKTT FYM+ G++  D+G I 
Sbjct: 2   ATLIAEKLAKAYKGRKVVEDVSLTVKSGEIVGLLGPNGAGKTTTFYMVVGIVQRDAGRIV 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD--KKKRHEKLDS 141
           ID  DI+ +P++ RA  GI YLPQEASIFR L+V  N++AVLE+  KD   ++R E+ D 
Sbjct: 62  IDDEDISLLPLHERALRGIGYLPQEASIFRRLSVFNNLMAVLEI-RKDLTSEQRQERADE 120

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           L++EF+IT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I
Sbjct: 121 LMEEFHITHLRDNLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKII 180

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             L   G+G+LITDHNV E L + +RAYI+  G ++AHGT QEI+ ++ V+R+YLG+ F
Sbjct: 181 EHLRDSGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGTPQEILADEQVKRVYLGEEF 239


>gi|325295348|ref|YP_004281862.1| sulfate-transporting ATPase [Desulfurobacterium thermolithotrophum
           DSM 11699]
 gi|325065796|gb|ADY73803.1| Sulfate-transporting ATPase [Desulfurobacterium thermolithotrophum
           DSM 11699]
          Length = 246

 Score =  254 bits (650), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 131/239 (54%), Positives = 168/239 (70%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A ++TK YN   VV GV + V  GE+VGLLGPNGAGKTT FY + GLI  D G + 
Sbjct: 8   NVLRAENITKIYNKRKVVNGVTIKVMEGEVVGLLGPNGAGKTTTFYCIVGLIKPDGGRVL 67

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +   D+T  P Y RAR GISYLPQE SIFR LTVEENI A+LE++   +++  EK D LL
Sbjct: 68  LGEEDVTNDPTYIRARKGISYLPQEPSIFRKLTVEENIKAILEMHGFSEREIKEKTDWLL 127

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           + F IT  R   A  LSGG+RRRLEIAR+L   P ++LLDEPFAG+DP+A+ +I  LI +
Sbjct: 128 ERFGITHLRKQKANSLSGGERRRLEIARALTINPKFLLLDEPFAGIDPIAVYEIQELIEE 187

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L    IGILITDHNV E L +IDRAYII  G V+A G+ Q++   + V+++YLG++F F
Sbjct: 188 LKEMNIGILITDHNVRETLRIIDRAYIIGHGKVIASGSPQQVAKQEIVKKIYLGEQFTF 246


>gi|145297405|ref|YP_001140246.1| ABC-type transporter, ATP binding protein [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142850177|gb|ABO88498.1| ABC-type transporter, ATP binding protein [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 241

 Score =  254 bits (650), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 174/240 (72%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K Y    VV  V L V  G+IVGLLGPNGAGKTT FYM+ GL+ +D+G I 
Sbjct: 2   AVLKAAGLQKSYKRRMVVSDVSLEVGTGQIVGLLGPNGAGKTTSFYMIVGLVQSDAGLIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI++ PM+ RAR GI YLPQEASIFR L+V +N++ V++  +   +++R +K++ L
Sbjct: 62  IDDQDISQQPMHIRARNGIGYLPQEASIFRRLSVFDNLMGVMQTRKGLSREEREDKVEQL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EFNIT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I+
Sbjct: 122 LEEFNITHIRDNLGQSLSGGERRRVEIARALAAEPRFILLDEPFAGVDPISVIDIKKIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L  RG+G+LITDHNV E L + ++AYI+  G ++A G   EI+ ++ V+R+YLGD+F+ 
Sbjct: 182 HLKDRGLGVLITDHNVRETLDVCEKAYIVSHGKMIAEGAPAEILADEQVKRVYLGDQFSL 241


>gi|281356234|ref|ZP_06242727.1| ABC transporter related protein [Victivallis vadensis ATCC BAA-548]
 gi|281317603|gb|EFB01624.1| ABC transporter related protein [Victivallis vadensis ATCC BAA-548]
          Length = 247

 Score =  254 bits (650), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 124/241 (51%), Positives = 167/241 (69%)

Query: 22  KDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGS 81
           ++ L+SA +L K Y+   VV  V + VK GE+VGLLGPNGAGKTT FYM+ GLI  DSG 
Sbjct: 7   QEVLISARNLVKTYHGRRVVSDVSITVKAGEVVGLLGPNGAGKTTSFYMVMGLIRPDSGE 66

Query: 82  IKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDS 141
           I     DIT MPMY+RAR+G+ YL QE SIFR LTVEENI+A+LE       +R ++   
Sbjct: 67  ITFRDVDITHMPMYKRARMGMGYLAQEPSIFRKLTVEENIMAILETLAISAAERRQRCKE 126

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           LL E  +T+     A  LSGG+RRRLEI R+LV+ PS+I+LDEPF+GVDP+A+ D+  +I
Sbjct: 127 LLDELELTRLARQKAMTLSGGERRRLEITRALVTNPSFIMLDEPFSGVDPLAVYDVQQII 186

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
             L  R +GILITDHNV E L+++DRAY++  G +L  G    +++++  R +YLG +F+
Sbjct: 187 LQLKQRNLGILITDHNVRETLSVVDRAYLMCQGKILVEGPSDFLVNDEQAREIYLGPQFS 246

Query: 262 F 262
            
Sbjct: 247 M 247


>gi|300724971|ref|YP_003714296.1| putative ABC transporter ATP-binding protein [Xenorhabdus
           nematophila ATCC 19061]
 gi|297631513|emb|CBJ92220.1| putative transport protein (ABC superfamily, atp_bind) [Xenorhabdus
           nematophila ATCC 19061]
          Length = 241

 Score =  254 bits (649), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 177/239 (74%), Gaps = 3/239 (1%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L+A +L K Y    VV+ V L VK GEIVGLLGPNGAGKTT FYM+ G++  D+GSI 
Sbjct: 2   AILNAENLAKAYKGRKVVENVSLEVKSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGSIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL--DS 141
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V  N++AVLE+  KD  +  +K+  + 
Sbjct: 62  IDQEDISLLPLHERARRGIGYLPQEASIFRRLSVFNNLMAVLEI-RKDLNQEQQKVRAEE 120

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           L++EF+I+  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I
Sbjct: 121 LMEEFHISHLRDSLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVLDIKKII 180

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           + L   G+G+LITDHNV E L + +RAYI+  G ++AHG+  +I++N+ V+R+YLG+ F
Sbjct: 181 QHLRDYGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGSPDDILNNEQVKRVYLGEGF 239


>gi|188591123|ref|YP_001795723.1| ABC transporter ATP-binding protein [Cupriavidus taiwanensis LMG
           19424]
 gi|170938017|emb|CAP63001.1| putative ABC transport protein, atp_binding component [Cupriavidus
           taiwanensis LMG 19424]
          Length = 266

 Score =  254 bits (649), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 172/243 (70%), Gaps = 7/243 (2%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L    L K+Y S  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D G I 
Sbjct: 23  STLVVRHLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVALDEGDIV 82

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKK---RHE--- 137
           +DG+ I+ +P++ RAR+G+SYLPQEAS+FR L VEENI AVLE+ + DK K   R E   
Sbjct: 83  LDGDHISGLPIHERARMGLSYLPQEASVFRKLNVEENIRAVLEL-QLDKGKPLARAEIER 141

Query: 138 KLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDI 197
           +LD+LL +  I   R+  A  LSGG+RRR+EIAR+L S P +ILLDEPFAGVDP+A+ +I
Sbjct: 142 RLDALLDDLQIAHLRNNPALSLSGGERRRVEIARALASSPRFILLDEPFAGVDPIAVGEI 201

Query: 198 HVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLG 257
             ++  L +R IG+LITDHNV E L + D AYII  G VLA G  ++II N  VRR+YLG
Sbjct: 202 QRIVSFLKARNIGVLITDHNVRETLGICDHAYIISEGTVLAAGQPEDIIANDAVRRVYLG 261

Query: 258 DRF 260
           + F
Sbjct: 262 ENF 264


>gi|260222573|emb|CBA32269.1| Probable ABC transporter ATP-binding protein AZC_3926 [Curvibacter
           putative symbiont of Hydra magnipapillata]
          Length = 258

 Score =  254 bits (649), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 167/246 (67%), Gaps = 6/246 (2%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
           S    L A  L K Y    VVK V L V+ GE+VGLLGPNGAGKTT FYM+ GL+ A +G
Sbjct: 11  SATGRLEARHLQKFYGKRQVVKDVSLAVRTGEVVGLLGPNGAGKTTSFYMIVGLLRASAG 70

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDK------KK 134
            I IDG  I  MP++RRARLG+ YLPQEASIFR L VE+N+ AVLE+   D        +
Sbjct: 71  DITIDGQSIEHMPIHRRARLGLGYLPQEASIFRKLNVEDNVRAVLELQRDDAGAPLKPAE 130

Query: 135 RHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAI 194
              +L  LL+E  +   R   +  LSGG+RRR+EIAR+L + P +ILLDEPFAG+DP+A+
Sbjct: 131 IEHRLTDLLQELRVEHLRESPSLALSGGERRRVEIARALATRPRFILLDEPFAGIDPIAV 190

Query: 195 SDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRL 254
            +I  +I  L +RGIG+LITDHNV E L + D AYII  G VLA GT  +I++N DVRR+
Sbjct: 191 IEIQRIINFLKARGIGVLITDHNVRETLGICDHAYIISDGHVLAEGTPADIVNNADVRRV 250

Query: 255 YLGDRF 260
           YLG+ F
Sbjct: 251 YLGENF 256


>gi|297170495|gb|ADI21525.1| ABC-type (unclassified) transport system, ATPase component
           [uncultured verrucomicrobium HF0070_15G23]
          Length = 240

 Score =  254 bits (649), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 124/237 (52%), Positives = 169/237 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + LS  SL+K+Y+   VV  V +YV+PGEIVGLLGPNGAGKTT F M+ G++  DSG + 
Sbjct: 2   NFLSTESLSKEYSGHRVVDDVSIYVQPGEIVGLLGPNGAGKTTTFNMVVGIVRPDSGCVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
            + N+IT+ PM+ RAR+GI YL QE S+FR LTV ENILA+LE  +  + +R  +L SLL
Sbjct: 62  FEKNEITRKPMHERARVGIGYLTQEPSVFRKLTVAENILAILETCDISRPEREIRLQSLL 121

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            E ++ K     A  LSGG++RRLEI RSLV+ P  +LLDEPFAGVDP+A+ ++  +I  
Sbjct: 122 DELDLRKVADNKAYQLSGGEKRRLEITRSLVTSPKLLLLDEPFAGVDPIAVYEVQKIILR 181

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RG+GILITDHNV E L ++DRAY+IH G V+  G  +++ ++ + R++YLG  F
Sbjct: 182 LKQRGMGILITDHNVRETLKMVDRAYLIHQGSVILEGNAEKLANDSNARKIYLGPEF 238


>gi|153869736|ref|ZP_01999270.1| ABC transporter, ATP-binding protein [Beggiatoa sp. PS]
 gi|152073792|gb|EDN70724.1| ABC transporter, ATP-binding protein [Beggiatoa sp. PS]
          Length = 241

 Score =  254 bits (649), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 171/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S LSA  L K+Y S  VVK V L V  GE+VGLLGPNGAGKTT FYM+ GLI  + G+I 
Sbjct: 2   STLSANHLAKQYKSRSVVKDVSLSVTSGEVVGLLGPNGAGKTTSFYMIVGLIGCEQGTIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           +   DIT+ PM++RA++G+ YLPQE S+FR LTV +NI+A+LEV +   K +R ++L+SL
Sbjct: 62  LGKQDITRYPMHKRAQMGLGYLPQEPSVFRKLTVADNIIAILEVQQHLTKAQRKQRLESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+E +I   R  L   LSGG+RRR+EIAR+L S P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LEELHIQHLRDNLGMSLSGGERRRVEIARALASDPRFILLDEPFAGVDPLSVLDIQRIIA 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L    IGILITDHNV E L + +RAYI++ G ++A GT + ++ N+ VR +YLG  F
Sbjct: 182 HLCRLDIGILITDHNVRETLDICNRAYIVNDGTLIAEGTPENVLHNEHVREVYLGHDF 239


>gi|171912112|ref|ZP_02927582.1| putative ABC transporter ATP-binding component [Verrucomicrobium
           spinosum DSM 4136]
          Length = 292

 Score =  254 bits (649), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 133/250 (53%), Positives = 169/250 (67%), Gaps = 3/250 (1%)

Query: 16  QEN---RASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMT 72
           QEN    A+ + LL    L K Y+   VV GVD+ V+ GEIVGLLGPNGAGKTT FYM+ 
Sbjct: 43  QENFDTSANGEVLLFTRGLKKVYDGRTVVNGVDIEVRRGEIVGLLGPNGAGKTTSFYMIV 102

Query: 73  GLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDK 132
           GL+  + G +  DG D T  PM++RARLG+ YLPQE SIFR L+V ENILAV+E      
Sbjct: 103 GLVQPNDGKVFFDGLDTTNEPMFKRARLGMGYLPQEESIFRKLSVRENILAVMETQNYTP 162

Query: 133 KKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPV 192
           ++R  +   L+++F I      LA  LSGG++RRL IARSLV+ P  I+LDEPF+GVDP+
Sbjct: 163 EEREMQCQQLMEKFGIDHVADNLALTLSGGEKRRLTIARSLVTEPKLIMLDEPFSGVDPL 222

Query: 193 AISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVR 252
           A+ DI  +I  L S G+ ILITDHNV E L ++DRAY+IH G VL HGT  EI++N   R
Sbjct: 223 AVEDIQKIILMLKSVGLAILITDHNVRETLGIVDRAYLIHEGRVLLHGTRDEIVNNPLAR 282

Query: 253 RLYLGDRFAF 262
             YLG+ F+ 
Sbjct: 283 ERYLGENFSM 292


>gi|325266393|ref|ZP_08133071.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Kingella denitrificans ATCC
           33394]
 gi|324982186|gb|EGC17820.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Kingella denitrificans ATCC
           33394]
          Length = 242

 Score =  254 bits (649), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 128/239 (53%), Positives = 166/239 (69%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L    L K +    VVK   L +  GE+VGLLGPNGAGKTT FYM+ GLI AD+G I 
Sbjct: 4   SHLHVEGLQKTFKKRQVVKNFSLDIYSGEVVGLLGPNGAGKTTSFYMIAGLIAADAGCIL 63

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG D+   P++ RA+ GI YLPQEASIFR +TVE+NI A+LE+  KD  +   +L+ LL
Sbjct: 64  LDGQDLVHQPIHYRAQAGIGYLPQEASIFRKMTVEQNIRAILEIRLKDTHQIDRELNQLL 123

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NI + RH  AP LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 124 HDLNIERLRHSPAPALSGGERRRVEIARVLAMQPRFILLDEPFAGVDPIAVIDIQKIISF 183

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  + IG+LITDHNV E L + D+AYII  G VLA G  +E+++++ VR +YLG+ F +
Sbjct: 184 LKQKNIGVLITDHNVRETLRICDKAYIISDGTVLACGKPEELVNDERVRAVYLGEHFDY 242


>gi|113969018|ref|YP_732811.1| ABC transporter-like protein [Shewanella sp. MR-4]
 gi|114048837|ref|YP_739387.1| ABC transporter-like protein [Shewanella sp. MR-7]
 gi|117919125|ref|YP_868317.1| ABC transporter-like protein [Shewanella sp. ANA-3]
 gi|113883702|gb|ABI37754.1| ABC transporter related [Shewanella sp. MR-4]
 gi|113890279|gb|ABI44330.1| ABC transporter related [Shewanella sp. MR-7]
 gi|117611457|gb|ABK46911.1| ABC transporter related [Shewanella sp. ANA-3]
          Length = 243

 Score =  254 bits (649), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 174/236 (73%), Gaps = 1/236 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L K Y S  VVK V L VK G++VGLLGPNGAGKTT FYM+ GL+ +D G I ID
Sbjct: 6   LKAQNLAKSYKSRQVVKDVSLTVKTGQVVGLLGPNGAGKTTTFYMVVGLVKSDKGHIFID 65

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSLLK 144
            +D+T  PM+ RAR GI YLPQEASIFR LTV +NI+AVL+   E ++ +R E+L+ LL+
Sbjct: 66  DDDLTADPMHLRARKGIGYLPQEASIFRKLTVHDNIMAVLQTRKELNRDQREEELEHLLE 125

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+IT  R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I  L
Sbjct: 126 EFHITHIRDSQGMSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIEQL 185

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            SRG+G+LITDHNV E L + + AYI+  G ++A GT  EI+DNQ VR +YLG++F
Sbjct: 186 KSRGLGVLITDHNVRETLDVCEHAYIVSHGNLIAEGTPAEILDNQQVRAVYLGEQF 241


>gi|224372819|ref|YP_002607191.1| ABC transporter, ATP-binding protein [Nautilia profundicola AmH]
 gi|223589059|gb|ACM92795.1| ABC transporter, ATP-binding protein [Nautilia profundicola AmH]
          Length = 239

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 172/239 (71%), Gaps = 1/239 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L A  L K +    ++KGV L V+ GE+VGLLGPNGAGKTT FY++ GL+  D GS+ 
Sbjct: 2   SVLEAKDLKKAFKKTLIIKGVSLNVRRGEVVGLLGPNGAGKTTSFYLICGLLQPDEGSVT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG DITK+P++++ARLGI YLPQE+S+FR L+VE+N+  V E Y  DKKK++E ++ LL
Sbjct: 62  LDGKDITKLPLHKKARLGIGYLPQESSVFRDLSVEDNLYIVAEQY-YDKKKQNEIVEDLL 120

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           ++FNI   R      LSGG+RRR+EIAR+LV  P ++ LDEPFAGVDPV +SDI  L+  
Sbjct: 121 EKFNIEPIRKRKGINLSGGERRRVEIARALVPSPKFLFLDEPFAGVDPVNVSDIKHLVEL 180

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           LA   IG++ITDHNV E L++  RAY++  G +L  G  + I+++ +V++ YLG+ F  
Sbjct: 181 LAKENIGVIITDHNVRETLSICHRAYVLKEGMILTEGDAEHIVNHPEVKKSYLGEDFKL 239


>gi|288930099|ref|ZP_06423937.1| ABC transporter, ATP-binding protein [Prevotella sp. oral taxon 317
           str. F0108]
 gi|288328572|gb|EFC67165.1| ABC transporter, ATP-binding protein [Prevotella sp. oral taxon 317
           str. F0108]
          Length = 275

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 130/252 (51%), Positives = 170/252 (67%), Gaps = 3/252 (1%)

Query: 14  EFQENRASKDSL---LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYM 70
           +FQ N  + +     L A  L K+Y    VV  V + V+ GEIVGLLGPNGAGKTT FYM
Sbjct: 5   DFQLNNQNHEDTHMELRAEGLVKRYGKRTVVNDVSINVRQGEIVGLLGPNGAGKTTSFYM 64

Query: 71  MTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK 130
            TGL+  + G I ID  +IT  P+Y+RAR GI YLPQEAS+FR L+VE+NI+AVLE+  K
Sbjct: 65  TTGLVIPNDGHIFIDNTEITDFPVYKRARAGIGYLPQEASVFRKLSVEDNIMAVLELTGK 124

Query: 131 DKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVD 190
            ++ + +KL+SL++EF + K R      LSGG+RRR EIAR L   P +I+LDEPFAGVD
Sbjct: 125 PRQYQLDKLESLIREFRLGKVRKNKGDQLSGGERRRTEIARCLAIAPKFIMLDEPFAGVD 184

Query: 191 PVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQD 250
           P+A+ DI  ++  L  R IGILITDHNV E LT+ DRAY++  G +L  G  +E+ +N+ 
Sbjct: 185 PIAVEDIQHIVWQLKYRNIGILITDHNVQETLTITDRAYLLFEGRILFQGAPEELAENKI 244

Query: 251 VRRLYLGDRFAF 262
           VR  YL + F  
Sbjct: 245 VREKYLSNSFVL 256


>gi|323144374|ref|ZP_08078982.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Succinatimonas hippei YIT 12066]
 gi|322415827|gb|EFY06553.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Succinatimonas hippei YIT 12066]
          Length = 241

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 123/238 (51%), Positives = 168/238 (70%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y    VV  V + V+ G IVGLLGPNGAGKTT FYM+ G+I  + GS+ ++
Sbjct: 4   LKASHLRKTYKKRVVVNDVSISVQSGSIVGLLGPNGAGKTTSFYMIVGIITTEKGSVTLN 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
             DIT MPM+ RAR G+ YLPQE SIFR LTV+ENI+ VLE+ +     +R ++ D L++
Sbjct: 64  NVDITDMPMHLRARAGLGYLPQENSIFRKLTVQENIMGVLELIKGLSPGERQQRADELME 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           E +I+  R+ +   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++S+I  +I  L
Sbjct: 124 ELSISSLRNNVGMSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVSEIKSIITHL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             RGIGILITDHNV E L + ++AYI+ +G ++A GT  EI+ N+ V+ +YLG+ F  
Sbjct: 184 KERGIGILITDHNVRETLDVCEKAYIVSSGEIIAKGTADEILANEKVKNVYLGESFTL 241


>gi|302036697|ref|YP_003797019.1| putative lipopolysaccharide ABC transporter ATPase [Candidatus
           Nitrospira defluvii]
 gi|300604761|emb|CBK41093.1| ABC-type transport system, ATPase component, putative
           lipopolysaccharide transport system [Candidatus
           Nitrospira defluvii]
          Length = 241

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 126/235 (53%), Positives = 167/235 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L+A  L K +    VVKGV L V+ GE+VGLLGPNGAGKTT F MM GL   D G+I + 
Sbjct: 5   LAANGLVKSFRGRKVVKGVSLDVQAGEVVGLLGPNGAGKTTIFDMMVGLCQPDEGTIALS 64

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G +IT +PMY+RAR GI YLPQE+S+FR L+VE NILA+LE+    + +R E++++LLKE
Sbjct: 65  GQEITDLPMYKRARKGIGYLPQESSVFRRLSVEHNILAILEMLGYSRSERMERVETLLKE 124

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
            ++   R   A  LSGG+RRRLEI R+L + PS++LLDEPFAG+DP+A++DI  +I  L 
Sbjct: 125 LDLVHIRKSKAYALSGGERRRLEITRALATSPSFMLLDEPFAGIDPIAVADIQQIIIRLK 184

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            R IG+LITDHNV E L++ DRAYII+ G +L  G    I  ++  R +YLG+ F
Sbjct: 185 QRNIGVLITDHNVRETLSITDRAYIINEGTILEAGPPGVIEKSEMARAVYLGEGF 239


>gi|218262318|ref|ZP_03476832.1| hypothetical protein PRABACTJOHN_02506 [Parabacteroides johnsonii
           DSM 18315]
 gi|218223469|gb|EEC96119.1| hypothetical protein PRABACTJOHN_02506 [Parabacteroides johnsonii
           DSM 18315]
          Length = 250

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 164/238 (68%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L    L KKY +  VV  V + VK GEIVGLLGPNGAGKTT FYM  GL+  + G I +
Sbjct: 8   VLRTEDLVKKYKTRTVVNHVSINVKQGEIVGLLGPNGAGKTTTFYMTVGLVTPNEGKIFL 67

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           +  +ITK P+Y+RAR GI YL QEASIFR +TVE+NI +VLE+ E   + + EKL+SL+ 
Sbjct: 68  NDMEITKFPVYKRARNGIGYLAQEASIFRKMTVEDNIRSVLEMTETTPEYQKEKLESLIA 127

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF + K R  L   LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  L
Sbjct: 128 EFGLNKVRKNLGDQLSGGERRRAEIARCLAIDPKFIMLDEPFAGVDPIAVQDIQSIVAKL 187

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             + IGILITDHNV+E L++ DRAY++  G VL  GT +++ +N+ VR  YLG  F  
Sbjct: 188 KHKNIGILITDHNVYETLSICDRAYLLFEGKVLFQGTAEQLAENEIVREKYLGKDFVL 245


>gi|319945405|ref|ZP_08019665.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Lautropia mirabilis ATCC
           51599]
 gi|319741191|gb|EFV93618.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Lautropia mirabilis ATCC
           51599]
          Length = 257

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 134/244 (54%), Positives = 174/244 (71%), Gaps = 8/244 (3%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A  L K YN   VVK V + V  G++VGLLG NGAGKTT FYM+ GL+  D G+I 
Sbjct: 13  SRLKAEHLMKAYNGRVVVKDVSMEVSSGQVVGLLGRNGAGKTTCFYMIAGLVATDGGNIV 72

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR-------H 136
           +D + I+ +P++RRARLG+SYLPQEAS+FR L+VEENILAVLE+ + DK+ R        
Sbjct: 73  LDEHSISHLPIHRRARLGLSYLPQEASVFRKLSVEENILAVLEL-QVDKRGRGISRAEQK 131

Query: 137 EKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISD 196
            +L+SLLKE  I   R   +  LSGG+RRR+EIAR+L S P +ILLDEPFAGVDP+A+ +
Sbjct: 132 ARLESLLKELQIEHIRSNTSISLSGGERRRVEIARALASSPRFILLDEPFAGVDPIAVIE 191

Query: 197 IHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYL 256
           I  ++  L +R IG+LITDHNV E L + DRAYII+ G VLA G+  +II ++ VR+ YL
Sbjct: 192 IQRIVNLLKNRRIGVLITDHNVRETLGICDRAYIINEGVVLASGSPDQIIQDERVRKAYL 251

Query: 257 GDRF 260
           G+ F
Sbjct: 252 GEDF 255


>gi|254283356|ref|ZP_04958324.1| unclassified ABC-type transport system, ATPase component [gamma
           proteobacterium NOR51-B]
 gi|219679559|gb|EED35908.1| unclassified ABC-type transport system, ATPase component [gamma
           proteobacterium NOR51-B]
          Length = 244

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 168/238 (70%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K +    VV  V L V  G++VGLLGPNGAGKTT FYM+ GLI AD G I 
Sbjct: 5   SELQVKNLAKSFRGRKVVSDVSLSVGSGQVVGLLGPNGAGKTTCFYMIVGLIDADHGRIF 64

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           ++GNDIT M +++RAR G+ YLPQEASIFR +TV +NILA+LE   E  K +R    ++L
Sbjct: 65  LNGNDITGMAIHQRARAGLGYLPQEASIFRRMTVRDNILAILETRKELSKSERKTVCNAL 124

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I      L   LSGG+RRR+EIAR+L + P++ILLDEPFAGVDP++ISDI  +I 
Sbjct: 125 LEEFHIGHLDSALGQALSGGERRRVEIARALATDPAFILLDEPFAGVDPISISDIKGVIS 184

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIG+LITDHNV E L + +RAYI+  G VLA GT   ++++  VR +YLGD F
Sbjct: 185 HLKERGIGVLITDHNVRETLDICERAYIVGEGKVLASGTPDHVLNDAQVRAVYLGDSF 242


>gi|226940943|ref|YP_002796017.1| ABC transporter, ATP-binding protein [Laribacter hongkongensis
           HLHK9]
 gi|226715870|gb|ACO75008.1| probable ABC transporter, ATP-binding protein [Laribacter
           hongkongensis HLHK9]
          Length = 244

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 137/237 (57%), Positives = 171/237 (72%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L   +L K+Y S  VVK V L ++ GE+VGLLGPNGAGKTT FYM+ GL+ AD+G I 
Sbjct: 6   SHLKVRNLQKRYKSRTVVKDVSLDIESGEVVGLLGPNGAGKTTSFYMIVGLVSADAGEIW 65

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG + T + +++RARLGI YLPQEASIFR LTVEENILA+LEV      +   +LD LL
Sbjct: 66  VDGTNATHLAIHQRARLGIGYLPQEASIFRKLTVEENILAILEVSGLRGDEARRELDLLL 125

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + NIT  R   A  LSGG+RRR+EIAR+L   P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 126 DDLNITHLRENPALSLSGGERRRVEIARALAMRPRFILLDEPFAGVDPIAVIDIQKIIAY 185

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L + DRAYII AG VLA G    ++ +++VRR+YLG+ F
Sbjct: 186 LKERGIGVLITDHNVRETLRICDRAYIISAGSVLATGDPAVLVADENVRRVYLGEHF 242


>gi|126662153|ref|ZP_01733152.1| ABC transporter, ATP-binding protein [Flavobacteria bacterium
           BAL38]
 gi|126625532|gb|EAZ96221.1| ABC transporter, ATP-binding protein [Flavobacteria bacterium
           BAL38]
          Length = 265

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 166/235 (70%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L K Y    VVKG+ + V  GEIVGLLGPNGAGKTT FYM+ GL+  +SG+I +D
Sbjct: 3   LRAENLVKTYKKRSVVKGISVEVNQGEIVGLLGPNGAGKTTSFYMIVGLVKPNSGNIYLD 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             DIT  PMY+RA+ GI YL QEAS+FR L++E+NIL+VL++    K ++  K++ L+ E
Sbjct: 63  DMDITNFPMYKRAQNGIGYLAQEASVFRKLSIEDNILSVLQLTTLSKAEQEAKMEELIAE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +   R     LLSGG+RRR EIAR+L + P +ILLDEPFAGVDPVA+ DI  ++  L 
Sbjct: 123 FALEHIRTNRGDLLSGGERRRTEIARALATDPKFILLDEPFAGVDPVAVEDIQRIVAQLK 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           ++ IGILITDHNV E L + D+ Y++  GG+L  G  +E++ ++ VRR+YLG  F
Sbjct: 183 NKNIGILITDHNVQETLAITDKTYLMFEGGILKAGKPEELVADEMVRRVYLGQNF 237


>gi|153007150|ref|YP_001381475.1| ABC transporter-like protein [Anaeromyxobacter sp. Fw109-5]
 gi|152030723|gb|ABS28491.1| ABC transporter related [Anaeromyxobacter sp. Fw109-5]
          Length = 251

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 157/236 (66%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           LL A  L K Y    VV GV  +V PGE+VGLLGPNGAGKTT F M+ GL+  D G + +
Sbjct: 5   LLRAEGLVKSYRGRRVVDGVSFHVAPGEVVGLLGPNGAGKTTSFNMVVGLVTPDGGRVSL 64

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
              D+T+ PM+RRARLG+ YLPQEASIFR LTV +N   VLE     + +R  + D+LL 
Sbjct: 65  GDLDLTREPMHRRARLGVGYLPQEASIFRRLTVRQNFTGVLEALGVGRAERERRADALLA 124

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF + K    L   LSGG+RRR E+ARSL+S P YIL DEPFAGVDP+A+ ++  LI  L
Sbjct: 125 EFRLEKVAESLGEQLSGGERRRAEVARSLLSSPKYILFDEPFAGVDPIAVGELQRLIGSL 184

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             RGIG+LITDH V E L +  RAYI+ AG +L  GT  EI  +   R +YLG++F
Sbjct: 185 RDRGIGVLITDHAVREALGICGRAYILSAGAILEAGTPAEIAASPKARAVYLGEKF 240


>gi|94968688|ref|YP_590736.1| ABC transporter, ATPase subunit [Candidatus Koribacter versatilis
           Ellin345]
 gi|94550738|gb|ABF40662.1| ABC transporter, ATPase subunit [Candidatus Koribacter versatilis
           Ellin345]
          Length = 242

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 169/240 (70%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S LSA  L K Y    VV GV++ V  GE+VGLLGPNGAGKTT FYM+ GLI  D+G + 
Sbjct: 2   STLSAEDLGKTYRGRRVVHGVNISVDQGEVVGLLGPNGAGKTTSFYMIVGLIPLDTGRVL 61

Query: 84  IDGNDITKMPMYRRAR-LGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSL 142
           ID  D+T +PMY RAR  GISYLPQE S+FR LTVEENILAVLE       +R E+++ L
Sbjct: 62  IDDKDLTDVPMYLRARNYGISYLPQEPSVFRKLTVEENILAVLEAQPISWHERRERMERL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           + +  +   R      LSGG+RRR+EIAR+L   PS+ILLDEPF+G+DP+A+ DI  +I 
Sbjct: 122 IDQLGLGHIRKSKGYSLSGGERRRVEIARALCISPSFILLDEPFSGIDPIAVLDIQKIIF 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           DL + GIG+LITDHNV E L++ DRAYII+ G +   GT +E+ ++ +V+R+YLG+ F  
Sbjct: 182 DLKASGIGVLITDHNVRETLSVTDRAYIINEGRIFRTGTAEELANDPEVKRVYLGESFTL 241


>gi|189485434|ref|YP_001956375.1| yhbG family ABC transporter ATPase component [uncultured Termite
           group 1 bacterium phylotype Rs-D17]
 gi|170287393|dbj|BAG13914.1| yhbG family ABC transporter ATPase component [uncultured Termite
           group 1 bacterium phylotype Rs-D17]
          Length = 239

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 117/236 (49%), Positives = 169/236 (71%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L    L K+Y    +V GV++ V+ GEI+GLLGPNGAGKTT FYMM G+I    GS+ +
Sbjct: 2   ILRTKDLFKRYKHRTIVNGVNISVRQGEIIGLLGPNGAGKTTTFYMMVGIIKPYDGSVYL 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           D  +IT  PMY+RAR GI YL QE+SIFRGLTVE+N++++ ++    K ++ EK++ +L+
Sbjct: 62  DDTEITNWPMYKRARAGIGYLSQESSIFRGLTVEDNLMSIAQMLPVSKAEQKEKVNLMLE 121

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           +F +TK    L+  LSGG++RRLEIAR+L++ P ++LLDEPF G+DP+   D+  + + L
Sbjct: 122 DFGLTKQCKQLSITLSGGEKRRLEIARALITNPKFLLLDEPFIGIDPITTYDVQKVTKKL 181

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             +G+GILITDHNV E L +IDR YIIH G ++  G  +E+++N   R++YLGD F
Sbjct: 182 KEKGLGILITDHNVRETLEIIDRVYIIHEGKIMFEGNAKELLENPKARKVYLGDNF 237


>gi|322418292|ref|YP_004197515.1| ABC transporter-like protein [Geobacter sp. M18]
 gi|320124679|gb|ADW12239.1| ABC transporter related protein [Geobacter sp. M18]
          Length = 245

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 127/241 (52%), Positives = 168/241 (69%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A   S L    L K +N   VVKGV+L +  GE+VGLLGPNGAGKTT FYM+ GL   D 
Sbjct: 3   APNRSTLYTEGLAKGFNKRQVVKGVNLELSSGEVVGLLGPNGAGKTTTFYMVVGLTRPDQ 62

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G + +DG  IT +PMY+RAR GISYLPQE S+FR LTV++N+LAVLE  +    +R E++
Sbjct: 63  GQVFLDGEPITGLPMYQRARRGISYLPQEPSVFRRLTVKDNLLAVLETMDLSPGRRRERV 122

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL EF I          LSGG+RRR+EIAR+L + PS+ILLDEPFAG+DP+A+ DI  
Sbjct: 123 EELLAEFRIEHIAGSRGYALSGGERRRVEIARALATDPSFILLDEPFAGIDPIAVIDIQN 182

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           +I  L ++G+G+LI+DHNV E L + D+AYI++AG VL  G   +I  ++  R +YLGD+
Sbjct: 183 IITALKAKGLGVLISDHNVRETLGVCDKAYIMNAGEVLEVGDPVQISQSKKAREIYLGDK 242

Query: 260 F 260
           F
Sbjct: 243 F 243


>gi|170728564|ref|YP_001762590.1| ABC transporter-like protein [Shewanella woodyi ATCC 51908]
 gi|169813911|gb|ACA88495.1| ABC transporter related [Shewanella woodyi ATCC 51908]
          Length = 243

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 174/236 (73%), Gaps = 1/236 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L K Y S  VV+ V L VK G+IVGLLGPNGAGKTT FYM+ GL+ +D G I ID
Sbjct: 6   LKAVNLAKSYKSRAVVQDVSLSVKTGQIVGLLGPNGAGKTTTFYMVVGLVQSDKGRIFID 65

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
            +D+T  PM+ RAR GI YLPQEASIFR L+V +NI+AVL+  ++ DK  R E+L+ LL+
Sbjct: 66  SDDLTLDPMHLRARKGIGYLPQEASIFRKLSVRDNIMAVLQTRDELDKNAREEQLEHLLE 125

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+IT  R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I  L
Sbjct: 126 EFHITHIRDSQGMSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIILQL 185

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            SRG+G+LITDHNV E L + + AYI+  G ++A GT  EI+DNQ VR +YLG++F
Sbjct: 186 KSRGLGVLITDHNVRETLDVCEHAYIVSHGNLIAEGTPAEILDNQQVRAVYLGEQF 241


>gi|24375447|ref|NP_719490.1| ABC transporter, ATP-binding protein [Shewanella oneidensis MR-1]
 gi|24350295|gb|AAN56934.1|AE015827_6 ABC transporter, ATP-binding protein [Shewanella oneidensis MR-1]
          Length = 243

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 172/236 (72%), Gaps = 1/236 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L K Y S  VVK V L VK G++VGLLGPNGAGKTT FYM+ GL+ +D G I ID
Sbjct: 6   LKAQNLAKSYKSRQVVKDVSLTVKTGQVVGLLGPNGAGKTTTFYMVVGLVKSDKGHIFID 65

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSLLK 144
            +D+T  PM+ RAR GI YLPQEASIFR LTV +NI+AVL+   E +  +R E L+ LL+
Sbjct: 66  DDDLTADPMHLRARKGIGYLPQEASIFRKLTVHDNIMAVLQTRKELNSDQREEALEQLLE 125

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+IT  R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I  L
Sbjct: 126 EFHITHIRDSQGMSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIEQL 185

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            SRG+G+LITDHNV E L + + AYI+  G ++A GT  EI+DNQ VR +YLG++F
Sbjct: 186 KSRGLGVLITDHNVRETLDVCEHAYIVSHGSLIAEGTPAEILDNQQVRAVYLGEQF 241


>gi|251793139|ref|YP_003007867.1| ABC transporter ATP-binding protein [Aggregatibacter aphrophilus
           NJ8700]
 gi|247534534|gb|ACS97780.1| ABC transporter, ATP-binding protein [Aggregatibacter aphrophilus
           NJ8700]
          Length = 241

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 130/241 (53%), Positives = 171/241 (70%), Gaps = 3/241 (1%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A +L K Y    VV  V L V  GEIVGLLGPNGAGKTT FYM+ GL+  D G I+
Sbjct: 2   AILYAENLAKSYKKRQVVSDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGLVNHDQGKIR 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKK--KRHEKLDS 141
           ID  DI+ +PM+ RA+ G+ YLPQEASIFR L+V EN++AVLE+  KD    +R E+ D 
Sbjct: 62  IDDEDISLLPMHNRAQKGVGYLPQEASIFRRLSVYENLMAVLEI-RKDLTALQRRERADE 120

Query: 142 LLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLI 201
           L+ EFNI   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I
Sbjct: 121 LIDEFNIGHIRDNLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKII 180

Query: 202 RDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
           +DL  RG+G+LITDHNV E L + +RAYI+ +G ++A G   EI++N+ V+ +YLG  F 
Sbjct: 181 KDLRDRGLGVLITDHNVRETLDVCERAYIVSSGKMIATGMPTEIMNNKLVKDVYLGADFQ 240

Query: 262 F 262
            
Sbjct: 241 L 241


>gi|299141488|ref|ZP_07034624.1| ABC transporter, ATP-binding protein [Prevotella oris C735]
 gi|298576824|gb|EFI48694.1| ABC transporter, ATP-binding protein [Prevotella oris C735]
          Length = 263

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 126/239 (52%), Positives = 163/239 (68%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L    L K+Y    V  GV + VK GEIVGLLGPNGAGKTT FYM TG +  + G + 
Sbjct: 11  TTLRTEGLVKRYGKRTVANGVSINVKQGEIVGLLGPNGAGKTTSFYMTTGNVVPNEGHVY 70

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           ID  +IT  P+Y+RAR GI YLPQEAS+FR L+VE+NI+AVLE+ +    ++ EKL+SL+
Sbjct: 71  IDDEEITNYPVYKRARAGIGYLPQEASVFRKLSVEDNIMAVLEMTKLSHAQQLEKLESLI 130

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            EF + K R      LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  
Sbjct: 131 SEFRLNKVRKNKGDQLSGGERRRTEIARCLAIDPKFIMLDEPFAGVDPIAVEDIQHIVWR 190

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  R IGILITDHNV E L++ DRAY++  G +L HGT +E+  N  VR+ YL + F +
Sbjct: 191 LKYRNIGILITDHNVQETLSITDRAYLLFEGRILFHGTSEELAANPVVRKNYLSENFVY 249


>gi|284008686|emb|CBA75341.1| ABC transporter ATP-binding protein [Arsenophonus nasoniae]
          Length = 241

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 175/237 (73%), Gaps = 3/237 (1%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L+A  L K Y +  VV+ V L V  GEIVGLLGPNGAGKTT FYM+ G++  D+G I ID
Sbjct: 4   LTAKHLAKTYKNRKVVEDVSLEVSSGEIVGLLGPNGAGKTTTFYMVVGIVPRDTGKIAID 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD--KKKRHEKLDSLL 143
             DI+ +P++ RAR GI YLPQEASIFR L V +N++AVLE+  KD   +++ ++ + L+
Sbjct: 64  DEDISLLPLHERARRGIGYLPQEASIFRRLNVYDNLMAVLEI-RKDLTSEEKQQRAEELM 122

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +EF+IT  R+ L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I+ 
Sbjct: 123 EEFSITHLRNNLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVLDIKKIIQH 182

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L   G+G+LITDHNV E L + +RAYI+  G ++AHGT + I++N+ V+R+YLG+ F
Sbjct: 183 LRDYGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGTPKAILENEQVKRVYLGEGF 239


>gi|330958013|gb|EGH58273.1| ABC transporter ATP-binding protein [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 241

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 170/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y S  VV+ V + ++ G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   ATLKAQHLAKSYKSRQVVRDVSISIESGQIVGLLGPNGAGKTTCFYMIVGLVQADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID  D++  PM+ RAR GI YLPQEASIFR L+V +NI+A+LE   E D   R ++L+SL
Sbjct: 62  IDDLDVSHQPMHGRARAGIGYLPQEASIFRKLSVSDNIMAILETRKELDAGARRKELESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+IT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHITHIRDNLGMSLSGGERRRVEIARALATSPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIG+LITDHNV E L + + AYI++ G ++A G  + I+ NQ V+ +YLG  F
Sbjct: 182 HLKAKGIGVLITDHNVRETLDICETAYIVNDGQLIAEGDSETILANQLVKEVYLGHEF 239


>gi|288800851|ref|ZP_06406308.1| ABC transporter, ATP-binding protein [Prevotella sp. oral taxon 299
           str. F0039]
 gi|288332312|gb|EFC70793.1| ABC transporter, ATP-binding protein [Prevotella sp. oral taxon 299
           str. F0039]
          Length = 273

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 125/238 (52%), Positives = 165/238 (69%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L    L K+Y    VV  V + VK GEIVGLLGPNGAGKTT FYM TGLI  + G I +
Sbjct: 16  VLRTEGLVKRYGKRTVVNDVSINVKQGEIVGLLGPNGAGKTTSFYMTTGLIVPNEGHIYL 75

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           +  DIT++P+ +RAR GI YLPQEAS+FR ++VE+NIL+VLE+  K +  + EKL+SL+ 
Sbjct: 76  NDQDITQLPVSKRARSGIGYLPQEASVFRKMSVEDNILSVLEMTGKPRSYQLEKLESLIA 135

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF + K R  +   LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  L
Sbjct: 136 EFRLGKVRKNMGDQLSGGERRRTEIARCLAIDPKFIMLDEPFAGVDPIAVEDIQHIVWQL 195

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             + IGILITDHNV E LT+ DRAY++  G +L  G+ +E+ +N+ VR  YL + F  
Sbjct: 196 KDKNIGILITDHNVQETLTITDRAYLLFEGKILFQGSPEELAENKIVREKYLSNSFVL 253


>gi|118579409|ref|YP_900659.1| ABC transporter-like protein [Pelobacter propionicus DSM 2379]
 gi|118502119|gb|ABK98601.1| ABC transporter related protein [Pelobacter propionicus DSM 2379]
          Length = 247

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 127/241 (52%), Positives = 168/241 (69%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A K   L +  L K+Y    VV GVDL ++ G +VGLLGPNGAGKTT FYM+ GL     
Sbjct: 5   ADKGLRLWSEGLRKRYGDRQVVSGVDLSIQAGTVVGLLGPNGAGKTTTFYMVVGLTQPSE 64

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G + +  +DIT +PMY+RAR GI YLPQEAS+FR L+V +N+LA+LEV E D+  R  ++
Sbjct: 65  GRVFLGDSDITGLPMYQRARRGIGYLPQEASVFRKLSVTDNLLAILEVVEPDRATRISRM 124

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           + LL+EF I+    V    LSGG+RRR+EIAR+L++ P++ILLDEPFAG+DP+A+S+I  
Sbjct: 125 EQLLEEFGISHIADVKGYALSGGERRRVEIARALITNPAFILLDEPFAGIDPIAVSEIQK 184

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           LI  L  R IG+LI+DHNV E L + D AYI+  G VL  GT +EI  ++  R +YLGD 
Sbjct: 185 LIVTLKERNIGVLISDHNVRETLGVCDLAYIMSDGAVLECGTPEEIASSRKAREIYLGDG 244

Query: 260 F 260
           F
Sbjct: 245 F 245


>gi|317504957|ref|ZP_07962906.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Prevotella salivae DSM 15606]
 gi|315663949|gb|EFV03667.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Prevotella salivae DSM 15606]
          Length = 275

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 163/239 (68%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L    L K+Y    V  GV + VK GEIVGLLGPNGAGKTT FYM TG +  + G + 
Sbjct: 23  TTLRTEGLVKRYGKRTVADGVSISVKQGEIVGLLGPNGAGKTTSFYMTTGNVVPNEGHVY 82

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +D  +IT  P+Y+RAR GI YLPQEAS+FR ++VE+NI+AVLE+ +    ++ EKL+SL+
Sbjct: 83  LDEEEITNYPVYKRARTGIGYLPQEASVFRKMSVEDNIMAVLEMTKLSHAEQVEKLESLI 142

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            EF + K R      LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  
Sbjct: 143 NEFRLNKVRKNKGDQLSGGERRRTEIARCLAINPKFIMLDEPFAGVDPIAVEDIQHIVWR 202

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  R IGILITDHNV E L++ DRAY++  G +L HGT +E+  N  VR+ YL D F +
Sbjct: 203 LKYRNIGILITDHNVQETLSITDRAYLLFEGRILFHGTSEELAANPIVRKNYLSDNFVY 261


>gi|254490071|ref|ZP_05103264.1| ABC transporter, ATP-binding protein, putative [Methylophaga
           thiooxidans DMS010]
 gi|224464735|gb|EEF80991.1| ABC transporter, ATP-binding protein, putative [Methylophaga
           thiooxydans DMS010]
          Length = 241

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 174/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+LSA  L K+Y    VVK + L VK GEIVGLLGPNGAGKTT FYM+ GLI  D G I 
Sbjct: 2   SILSAQQLAKRYGDRQVVKDISLDVKSGEIVGLLGPNGAGKTTSFYMIVGLIPVDHGYIY 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           +D  ++T+ P++ RARLGI YLPQEAS+FR L+VE+N+ A++E  ++ D+K++ + L+ L
Sbjct: 62  LDQQELTEYPIHDRARLGIGYLPQEASVFRKLSVEDNLYAIIETRDELDEKQKQDLLERL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L++F+I   R      LSGG+RRR+EIAR+L   P +ILLDEPFAGVDP+++ DI  +I+
Sbjct: 122 LQDFHIDHIRKSKGMALSGGERRRVEIARALAMDPQFILLDEPFAGVDPISVLDIQGIIK 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +L+  GIGILITDHNV E L +  RAYI + G V+A GT +EI++++ V  +YLG  F
Sbjct: 182 ELSEHGIGILITDHNVRETLNVCQRAYIFNEGEVIARGTPEEILNDKKVLSVYLGRDF 239


>gi|330888619|gb|EGH21280.1| ABC transporter ATP-binding protein [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 241

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 169/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y S  VV+ V + +  G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   ATLKAQHLAKSYKSRQVVRDVSISIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID  D++  PM+ RAR GI YLPQEASIFR L+V +NI+A+LE   E D   R ++L+SL
Sbjct: 62  IDDLDVSHQPMHGRARAGIGYLPQEASIFRKLSVSDNIMAILETRKELDAGARRKELESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+IT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHITHIRDNLGMSLSGGERRRVEIARALATAPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIG+LITDHNV E L + + AYI++ G ++A G  + I+ NQ V+ +YLG  F
Sbjct: 182 QLKAKGIGVLITDHNVRETLDICETAYIVNDGQLIAEGDSETILANQLVKEVYLGHEF 239


>gi|218885532|ref|YP_002434853.1| ABC transporter [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218756486|gb|ACL07385.1| ABC transporter related [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 241

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 169/239 (70%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L    L K++    VV+GV L V  GE VGLLGPNGAGKTT FYM+ G+I   SG ++
Sbjct: 3   SVLRGEDLHKQFGQREVVRGVSLTVTQGETVGLLGPNGAGKTTTFYMLIGIIKPTSGRVE 62

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG DI   P++ RAR+G+SYLPQE+SIFR LTV +N+  +LE     K ++ E+ D LL
Sbjct: 63  LDGRDIADWPLHERARVGLSYLPQESSIFRRLTVRQNLQMILEHTGLSKAQQKERGDMLL 122

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           ++F IT   + +A  LSGG+RRRLEIARS++  P +ILLDEPFAG+DP+A+ DI  LI  
Sbjct: 123 EDFGITHLANSVAMHLSGGERRRLEIARSMIRDPKFILLDEPFAGIDPLAVDDIQQLITG 182

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L +RGIG+LI+DHNV E L + DRAY++H G V+  GT + I++N   R +YLG+ F+ 
Sbjct: 183 LRNRGIGVLISDHNVRETLHICDRAYLVHQGEVILEGTPEHIVENPRARDVYLGEGFSL 241


>gi|28871587|ref|NP_794206.1| ABC transporter ATP-binding protein [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213966611|ref|ZP_03394762.1| ABC transporter, ATP-binding protein [Pseudomonas syringae pv.
           tomato T1]
 gi|301383120|ref|ZP_07231538.1| ABC transporter, ATP-binding protein [Pseudomonas syringae pv.
           tomato Max13]
 gi|302063708|ref|ZP_07255249.1| ABC transporter, ATP-binding protein [Pseudomonas syringae pv.
           tomato K40]
 gi|302133818|ref|ZP_07259808.1| ABC transporter, ATP-binding protein [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28854839|gb|AAO57901.1| ABC transporter, ATP-binding protein [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213928461|gb|EEB62005.1| ABC transporter, ATP-binding protein [Pseudomonas syringae pv.
           tomato T1]
          Length = 241

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 169/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y S  VV+ V + +  G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   ATLKAQHLAKSYKSRQVVRDVSISIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID  DI+  PM+ RAR GI YLPQEASIFR L+V +NI+A+LE   E D   R ++L+SL
Sbjct: 62  IDDLDISHQPMHGRARAGIGYLPQEASIFRKLSVSDNIMAILETRKELDAGARRKELESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+IT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHITHIRDNLGMSLSGGERRRVEIARALATSPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIG+LITDHNV E L + + AYI++ G ++A G  + I+ NQ V+ +YLG  F
Sbjct: 182 HLKAKGIGVLITDHNVRETLDICETAYIVNDGQLIAEGDSETILANQLVKEVYLGHEF 239


>gi|78222496|ref|YP_384243.1| ABC transporter-related protein [Geobacter metallireducens GS-15]
 gi|78193751|gb|ABB31518.1| ABC transporter-related protein [Geobacter metallireducens GS-15]
          Length = 246

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 165/240 (68%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
           S D +L A  L K +    VV GVDL V  GE+VGLLGPNGAGKTT FYM+ GL   D G
Sbjct: 5   SADMVLQAHGLRKGFGKRVVVNGVDLRVATGEVVGLLGPNGAGKTTTFYMVVGLCRPDGG 64

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLD 140
            + I   +IT +PMY+RAR+GISYLPQE S+FR LTVEENILAVLE  +    +R ++  
Sbjct: 65  QVFIGDEEITALPMYQRARMGISYLPQEPSVFRKLTVEENILAVLETMDLSSSERRDRAA 124

Query: 141 SLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVL 200
            L+ EF I          LSGG+RRR+EIAR+L + P +ILLDEPFAG+DP+A+ DI  +
Sbjct: 125 ELIGEFKIDHIAKSKGYALSGGERRRVEIARALATDPLFILLDEPFAGIDPIAVIDIQGI 184

Query: 201 IRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           I +L +RGIGILI+DHNV E L + D AYI+ AG V+ +G   +I  ++  R +YLG++F
Sbjct: 185 ITELKARGIGILISDHNVRETLGVCDNAYIMSAGEVIEYGDPVKIAGSKQAREIYLGEKF 244


>gi|304383589|ref|ZP_07366048.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Prevotella marshii DSM 16973]
 gi|304335113|gb|EFM01384.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Prevotella marshii DSM 16973]
          Length = 276

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 163/238 (68%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L    L K+Y    VV  V + V+ GEIVGLLGPNGAGKTT FYM TGLI  ++G I +
Sbjct: 17  MLRTEGLVKRYGKRTVVNDVSINVRQGEIVGLLGPNGAGKTTSFYMTTGLIIPNAGHIYL 76

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           D  DIT  P+Y+RAR GI YLPQEAS+FR ++VE+NIL+VLE+    ++ + E+L++L+ 
Sbjct: 77  DNEDITSFPVYKRARAGIGYLPQEASVFRKMSVEDNILSVLEMTGLPRQAQRERLENLIS 136

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF + K R      LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  L
Sbjct: 137 EFRLNKVRKNKGDQLSGGERRRTEIARCLAISPKFIMLDEPFAGVDPIAVEDIQHIVWKL 196

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             R IGILITDHNV E L++ DRAY++  G +L  GT +E+  N+ VR  YL + F  
Sbjct: 197 KDRNIGILITDHNVQETLSITDRAYLLFEGRILFQGTPEELAANKVVREKYLSNSFVL 254


>gi|170723423|ref|YP_001751111.1| ABC transporter-like protein [Pseudomonas putida W619]
 gi|169761426|gb|ACA74742.1| ABC transporter related [Pseudomonas putida W619]
          Length = 241

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 170/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y    VV+ V L +  G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   ATLKAQHLAKSYKGRQVVRDVSLSIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           ID  D++  PM+ RAR GI YLPQEASIFR L+V +NI+A+LE   E D++ R ++L+SL
Sbjct: 62  IDSLDVSHQPMHGRARAGIGYLPQEASIFRKLSVADNIMAILETRKELDREGRRKELESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I+  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHISHIRDNLGMSLSGGERRRVEIARALATAPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIG+LITDHNV E L + + AYI++ G ++A G  Q I+ N+ V+ +YLG  F
Sbjct: 182 HLKAKGIGVLITDHNVRETLDICETAYIVNDGQLIAEGDAQTILANELVKEVYLGHEF 239


>gi|224437203|ref|ZP_03658184.1| ABC-transporter ATP-binding protein [Helicobacter cinaedi CCUG
           18818]
 gi|313143669|ref|ZP_07805862.1| ABC-transporter ATP-binding protein [Helicobacter cinaedi CCUG
           18818]
 gi|313128700|gb|EFR46317.1| ABC-transporter ATP-binding protein [Helicobacter cinaedi CCUG
           18818]
          Length = 240

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 166/235 (70%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L+A +L+K+     +V+ V L V  GE+VGLLGPNGAGKTT FYM+TGL+    G + ++
Sbjct: 4   LTAHNLSKQIKKTKIVQDVSLEVSSGEVVGLLGPNGAGKTTTFYMITGLLHPSEGKVMLN 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             DITK+P+++R+ LGI YLPQE+SIF+ L+VEEN++   E+  K  K R  K++ +L+E
Sbjct: 64  HTDITKLPLHKRSNLGIGYLPQESSIFKDLSVEENLMLAAEISIKSPKDRQMKIEKMLEE 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           FNI   R      LSGG+RRR+EIAR+LV  P +ILLDEPFAGVDP A+SDI  +I  L 
Sbjct: 124 FNIEPIRARKGVSLSGGERRRVEIARALVKDPKFILLDEPFAGVDPRAVSDIQNIILKLT 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             GIG+LITDHNV E L++  R Y+I +G +LA G  +EI  N+ VR+ YLG+ F
Sbjct: 184 QLGIGVLITDHNVRETLSVCSRTYVIKSGALLASGNAEEIYGNELVRKYYLGEHF 238


>gi|309390183|gb|ADO78063.1| ABC transporter related protein [Halanaerobium praevalens DSM 2228]
          Length = 239

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 165/235 (70%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           + A +L KKYN   VV  V L VK GEIVGLLGPNGAGKTT FYM+ GLI  D G I  D
Sbjct: 3   IRAEALIKKYNQEKVVDQVSLKVKRGEIVGLLGPNGAGKTTTFYMILGLISPDGGQIFYD 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             DI+++P+Y+RA+LGI YLPQEASIFR LTV EN+ A+LE  +       + +  LL E
Sbjct: 63  QADISELPVYKRAQLGIGYLPQEASIFRKLTVGENLKAILEYRDLSSAAIEKNIQELLAE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F++   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+A++DI  +I  L 
Sbjct: 123 FHLEALRERKGFQLSGGERRRVEIARALAADPDFILLDEPFAGVDPIAVNDIQDIILYLK 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            RG+G+LITDH+V E L++ DR YI+H G +L  GT +EI  ++  R+ YLG++F
Sbjct: 183 QRGLGVLITDHSVRETLSITDRTYIMHEGRILLTGTAKEIAADEKARKFYLGEKF 237


>gi|300728341|ref|ZP_07061706.1| ABC transporter, ATP-binding protein [Prevotella bryantii B14]
 gi|299774406|gb|EFI71033.1| ABC transporter, ATP-binding protein [Prevotella bryantii B14]
          Length = 262

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 165/238 (69%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L    L K Y    V  GV + VK GEIVGLLGPNGAGKTT FYM TGL+  + G + +
Sbjct: 8   VLRTEGLVKTYGKRTVANGVSIEVKQGEIVGLLGPNGAGKTTSFYMTTGLVVPNDGHVYL 67

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           +  +IT  P+Y+RAR GI YLPQEAS+FR ++VE+NI++VLE+ +    ++ +KL+SLL+
Sbjct: 68  NNQEITDYPVYKRARAGIGYLPQEASVFRKMSVEDNIMSVLEMTKLSHAQQLDKLESLLQ 127

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF + K R      LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  L
Sbjct: 128 EFRLNKVRKNKGDQLSGGERRRTEIARCLAIDPKFIMLDEPFAGVDPIAVEDIQHIVWRL 187

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             R IGILITDHNV E L++ DRAY++  G +L HGT +E+ +N  VR+ YL D F +
Sbjct: 188 KYRNIGILITDHNVQETLSITDRAYLLFEGRILFHGTPEELAENPIVRKNYLSDNFVY 245


>gi|146298049|ref|YP_001192640.1| ABC transporter related [Flavobacterium johnsoniae UW101]
 gi|146152467|gb|ABQ03321.1| ABC transporter related [Flavobacterium johnsoniae UW101]
          Length = 246

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 122/235 (51%), Positives = 170/235 (72%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L K Y    VVKG+ + V  GEIVGLLGPNGAGKTT FYM+ GL+  + G+I +D
Sbjct: 3   LRADNLIKTYKGRSVVKGISVEVNQGEIVGLLGPNGAGKTTSFYMIVGLVKPNQGNIYLD 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             +IT  PMY+RA+ GI YL QEAS+FR L++E+NIL+VL++ +  K+ +  K++SL++E
Sbjct: 63  DLNITDYPMYKRAQQGIGYLAQEASVFRKLSIEDNILSVLQLTKLSKEAQIAKMESLIEE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F++   R     LLSGG+RRR EIAR+L + P +ILLDEPFAGVDPVA+ DI  ++  L 
Sbjct: 123 FSLEHIRTNRGDLLSGGERRRTEIARALATDPKFILLDEPFAGVDPVAVEDIQRIVAQLK 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           ++ IGILITDHNV E L + D+ Y++  GG+L  G  +E+++++ VRR+YLG  F
Sbjct: 183 NKNIGILITDHNVQETLAITDKTYLMFEGGILKAGVPEELVEDEMVRRVYLGQNF 237


>gi|70728298|ref|YP_258047.1| ABC transporter ATP-binding protein [Pseudomonas fluorescens Pf-5]
 gi|68342597|gb|AAY90203.1| ABC transporter, ATP-binding protein [Pseudomonas fluorescens Pf-5]
          Length = 241

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 169/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y S  VV+ V L +  G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   ATLKAQHLAKSYKSRQVVRDVSLSIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID  D++  PM+ RAR GI YLPQEASIFR L+V +NI+A+LE   E DK  R ++L+SL
Sbjct: 62  IDDLDVSHQPMHGRARAGIGYLPQEASIFRKLSVADNIMAILETRKELDKAGRRQELESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHINHIRDNLGMSLSGGERRRVEIARALATAPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIG+LITDHNV E L + + AYI++ G ++A G  + I+ N+ V+ +YLG  F
Sbjct: 182 HLKAKGIGVLITDHNVRETLDICETAYIVNDGQLIAEGDSETILANELVKEVYLGHEF 239


>gi|119477367|ref|ZP_01617558.1| ABC transporter, ATP-binding protein, putative [marine gamma
           proteobacterium HTCC2143]
 gi|119449293|gb|EAW30532.1| ABC transporter, ATP-binding protein, putative [marine gamma
           proteobacterium HTCC2143]
          Length = 241

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 169/240 (70%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L+   L K Y    VV  V L +  G+IVGLLGPNGAGKTT FYM+ G++ AD G I+
Sbjct: 2   SILTVKHLAKSYKGRPVVNDVSLEIHSGQIVGLLGPNGAGKTTCFYMIVGIVTADKGQIQ 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           +DG D+T + M+ RAR GI YLPQEASIFR L+V  NI+A+LE   E ++++R EKL+ L
Sbjct: 62  LDGVDLTGLSMHARARQGIGYLPQEASIFRKLSVANNIMAILETRKELNRQQRAEKLEGL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+IT  R  L   LSGG+RRR+EIAR+L + P++ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHITHIRDSLGMTLSGGERRRVEIARALATEPAFILLDEPFAGVDPISVGDIKQIIN 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L   GIG+LITDHNV E L + ++AYI+  G +++ G    +++N+ VR  YLG  F  
Sbjct: 182 HLKLLGIGVLITDHNVRETLDICEKAYIVGEGRIISEGDANTVLNNKQVRDTYLGHHFEL 241


>gi|262369717|ref|ZP_06063045.1| lipopolysaccharide ABC transporter ATP-binding protein LptB
           [Acinetobacter johnsonii SH046]
 gi|262315785|gb|EEY96824.1| lipopolysaccharide ABC transporter ATP-binding protein LptB
           [Acinetobacter johnsonii SH046]
          Length = 248

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 171/246 (69%), Gaps = 1/246 (0%)

Query: 17  ENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLIC 76
           E   ++   L    L K Y+  +VVK V   ++ G+IVGLLGPNGAGKTT FYM+ GL+ 
Sbjct: 2   EQTLNQPQTLCIKHLAKNYSKRWVVKDVSFSMQSGQIVGLLGPNGAGKTTSFYMVVGLVR 61

Query: 77  ADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKR 135
            D G I +D  D++ + M+ RAR GI YLPQEASIFR LT+ ENI+++LE  +  +K++R
Sbjct: 62  MDKGEIHLDDLDMSDLAMHERARKGIGYLPQEASIFRKLTISENIMSILETRKDLNKEQR 121

Query: 136 HEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAIS 195
            ++L  LL +F I+  +  L   +SGG+RRR EIAR+L + P ++LLDEPFAGVDP+++ 
Sbjct: 122 KQRLHELLADFKISHIKDSLGMSVSGGERRRAEIARALAADPKFMLLDEPFAGVDPISVG 181

Query: 196 DIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLY 255
           DI  +IR L  RGIG+LITDHNV E L + +RAYI+  G V+A G+  EI+ N+ VR++Y
Sbjct: 182 DIKDIIRTLKDRGIGVLITDHNVRETLAICERAYIVSEGAVIAEGSPDEILANETVRQVY 241

Query: 256 LGDRFA 261
           LGD F 
Sbjct: 242 LGDDFT 247


>gi|71734643|ref|YP_276272.1| ABC transporter ATP-binding protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257483491|ref|ZP_05637532.1| ABC transporter, ATP-binding protein [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289646997|ref|ZP_06478340.1| ABC transporter, ATP-binding protein [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|298488492|ref|ZP_07006522.1| ABC transporter, ATP-binding protein [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|71555196|gb|AAZ34407.1| ABC transporter, ATP-binding protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298156833|gb|EFH97923.1| ABC transporter, ATP-binding protein [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320322492|gb|EFW78585.1| ABC transporter, ATP-binding protein [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320330039|gb|EFW86026.1| ABC transporter, ATP-binding protein [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330875123|gb|EGH09272.1| ABC transporter ATP-binding protein [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330950271|gb|EGH50531.1| ABC transporter ATP-binding protein [Pseudomonas syringae Cit 7]
 gi|330987092|gb|EGH85195.1| ABC transporter ATP-binding protein [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011536|gb|EGH91592.1| ABC transporter ATP-binding protein [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 241

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 169/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y S  VV+ V + +  G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   ATLKAQHLAKSYKSRQVVRDVSISIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID  D++  PM+ RAR GI YLPQEASIFR L+V +NI+A+LE   E D   R ++L+SL
Sbjct: 62  IDDLDVSHQPMHGRARAGIGYLPQEASIFRKLSVSDNIMAILETRKELDAGARRKELESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+IT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHITHIRDNLGMSLSGGERRRVEIARALATAPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIG+LITDHNV E L + + AYI++ G ++A G  + I+ NQ V+ +YLG  F
Sbjct: 182 HLKAKGIGVLITDHNVRETLDICETAYIVNDGQLIAEGDSETILANQLVKEVYLGHEF 239


>gi|116625793|ref|YP_827949.1| ABC transporter-like protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116228955|gb|ABJ87664.1| ABC transporter related [Candidatus Solibacter usitatus Ellin6076]
          Length = 242

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 166/239 (69%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L    ++K Y    VV  V ++V+ GE+VGLLGPNGAGKTT FYM+ GLI  DSG I 
Sbjct: 2   SKLETRQISKTYRGRRVVDDVTVFVQQGEVVGLLGPNGAGKTTSFYMIVGLISPDSGRIL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +D  DIT +PMY+RAR GISYLPQEAS+FR LTVEEN+LA+LE      ++R E ++ L+
Sbjct: 62  VDDKDITDLPMYQRARKGISYLPQEASVFRKLTVEENLLAILETLPLRARERRENMERLI 121

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            +  + K R     +LSGG+RRR+EIARSLV  PS++LLDEPF+G+DP+ + ++  +I D
Sbjct: 122 DQLGLEKVRRSRGYMLSGGERRRVEIARSLVINPSFLLLDEPFSGIDPIQVLELQSIIFD 181

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L   GIGIL+TDHNV   L + DRAYI+  G +   G+ + +  + +VRR+YLG+ F  
Sbjct: 182 LKRAGIGILVTDHNVSATLVVTDRAYILDNGRIFRAGSPEALSRDPEVRRVYLGESFTL 240


>gi|66047373|ref|YP_237214.1| ABC transporter [Pseudomonas syringae pv. syringae B728a]
 gi|289676083|ref|ZP_06496973.1| ABC transporter [Pseudomonas syringae pv. syringae FF5]
 gi|63258080|gb|AAY39176.1| ABC transporter [Pseudomonas syringae pv. syringae B728a]
 gi|330895271|gb|EGH27609.1| ABC transporter [Pseudomonas syringae pv. japonica str. M301072PT]
 gi|330937987|gb|EGH41770.1| ABC transporter [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330969688|gb|EGH69754.1| ABC transporter [Pseudomonas syringae pv. aceris str. M302273PT]
 gi|330981129|gb|EGH79232.1| ABC transporter [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 241

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 169/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y S  VV+ V + +  G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   ATLKAQHLAKSYKSRQVVRDVSISIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID  D++  PM+ RAR GI YLPQEASIFR L+V +NI+A+LE   E D   R ++L+SL
Sbjct: 62  IDDLDVSHQPMHGRARAGIGYLPQEASIFRKLSVSDNIMAILETRKELDAGARRKELESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+IT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHITHIRDNLGMSLSGGERRRVEIARALATAPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIG+LITDHNV E L + + AYI++ G ++A G  + I+ NQ V+ +YLG  F
Sbjct: 182 HLKAKGIGVLITDHNVRETLDICEMAYIVNDGQLIAEGDSETILANQLVKEVYLGHEF 239


>gi|282878068|ref|ZP_06286873.1| ABC transporter, ATP-binding protein [Prevotella buccalis ATCC
           35310]
 gi|281299808|gb|EFA92172.1| ABC transporter, ATP-binding protein [Prevotella buccalis ATCC
           35310]
          Length = 318

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 169/244 (69%)

Query: 17  ENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLIC 76
           + + S+  +L    L K+Y    V   V   V+ GEIVGLLGPNGAGKTT FYM TGL+ 
Sbjct: 56  QQQESESLVLRTEGLVKRYGKRTVANKVSYNVQQGEIVGLLGPNGAGKTTSFYMTTGLVI 115

Query: 77  ADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRH 136
            + G + ++  +IT+ P+Y+RA+ GI YLPQEAS+FR ++VE+NIL+VLE+ +  ++++ 
Sbjct: 116 PNEGHVYLNEEEITEYPVYKRAQAGIGYLPQEASVFRKMSVEDNILSVLEMTKLSRQEQL 175

Query: 137 EKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISD 196
           +KL+SL+ EF + K R      LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ D
Sbjct: 176 DKLESLINEFRLNKVRKNKGDQLSGGERRRTEIARCLAIDPKFIMLDEPFAGVDPIAVED 235

Query: 197 IHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYL 256
           I  ++  L  R IGILITDHNV E LT+ DRAY++  G +L HGT +E+ +N+ VR  YL
Sbjct: 236 IQHIVWRLKYRNIGILITDHNVQETLTITDRAYLLFEGKILFHGTPEELANNKIVREKYL 295

Query: 257 GDRF 260
           G  F
Sbjct: 296 GSNF 299


>gi|320106530|ref|YP_004182120.1| ABC transporter-like protein [Terriglobus saanensis SP1PR4]
 gi|319925051|gb|ADV82126.1| ABC transporter related protein [Terriglobus saanensis SP1PR4]
          Length = 241

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 169/238 (71%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LS   +TK Y    VV+GV L+++ GE+VGLLGPNGAGKTT FYM+ GL+  D G I ID
Sbjct: 4   LSTEEITKTYGGRQVVRGVSLHIEQGEVVGLLGPNGAGKTTSFYMIVGLVKPDLGRILID 63

Query: 86  GNDITKMPMYRRAR-LGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
            +DI+++PMY RAR  GISYLPQE S+FR LTVEENILAVLE  +   + R  + + L++
Sbjct: 64  TDDISRLPMYLRARNHGISYLPQEPSVFRKLTVEENILAVLETQQIPWEARKVRTERLIE 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           + N+   R      LSGG+RRR+EIAR L   PS+ILLDEPF+G+DP+AI D+  +I  L
Sbjct: 124 QLNLGHIRKTRGYALSGGERRRVEIARCLAIEPSFILLDEPFSGIDPIAILDLQQIIFSL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            + GIG+LITDHNV E L + DRAYII+ G +  HG+  E+  + +V+RLYLG+ F+ 
Sbjct: 184 KANGIGVLITDHNVRETLNVTDRAYIINEGRIFRHGSPGELGRDPEVKRLYLGENFSL 241


>gi|203287911|ref|YP_002222926.1| ABC transporter, ATP-binding protein [Borrelia recurrentis A1]
 gi|201085131|gb|ACH94705.1| ABC transporter, ATP-binding protein [Borrelia recurrentis A1]
          Length = 277

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 132/242 (54%), Positives = 171/242 (70%), Gaps = 1/242 (0%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A  D +L A S+ KKY    VV GV + V  GE+VGLLGPNGAGKTT FY + G I A+S
Sbjct: 34  AVTDIVLKADSIVKKYGEKVVVNGVTIDVHRGEVVGLLGPNGAGKTTTFYTIVGFIKANS 93

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEK 138
           G + I+ +D++K+ MY RARLGI YLPQE SIFR LTVE+NIL  LE  E   + +R  +
Sbjct: 94  GRVLINNHDVSKLNMYERARLGIVYLPQEPSIFRELTVEDNILVALERREDLSQAERKIE 153

Query: 139 LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIH 198
           L +LLK+F I + ++  A  LSGG+RRR EIAR+L   P ++LLDEPFAG+DP+AI DI 
Sbjct: 154 LVNLLKDFEIKRIQYQKAYTLSGGERRRTEIARALAVSPYFLLLDEPFAGIDPIAIGDIK 213

Query: 199 VLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGD 258
            +IR L S+ IG+LITDHNV +   +IDRAYII+ G VL  G V  II+++  ++LYLG+
Sbjct: 214 DIIRILKSKNIGVLITDHNVRDAFDIIDRAYIIYQGQVLDSGNVDYIINSEKAKKLYLGE 273

Query: 259 RF 260
            F
Sbjct: 274 EF 275


>gi|86133529|ref|ZP_01052111.1| ABC transporter, ATP-binding protein [Polaribacter sp. MED152]
 gi|85820392|gb|EAQ41539.1| ABC transporter, ATP-binding protein [Polaribacter sp. MED152]
          Length = 247

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 124/236 (52%), Positives = 170/236 (72%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A ++ K Y S  VVKG+ L V+ GEI+GLLGPNGAGKTT FYM+ G+I  +SG I +
Sbjct: 2   ILRADNIQKLYGSRKVVKGISLEVQQGEIIGLLGPNGAGKTTSFYMIVGMIKPNSGQIFL 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           +  +ITK PMY+RA+ GI YL QEAS+FR L+VE+NI++VL+  +  KK++  KL+SL++
Sbjct: 62  NDLEITKDPMYKRAQKGIGYLAQEASVFRKLSVEDNIMSVLQFTDLSKKEQKMKLESLIE 121

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EFNI   R     LLSGG+RRR EIAR L S P +ILLDEPFAGVDP+A+ DI  ++  L
Sbjct: 122 EFNIGHVRKNRGDLLSGGERRRTEIARCLASDPKFILLDEPFAGVDPIAVEDIQSIVAQL 181

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             + IGILITDH+V   L + D+ Y+++ G +L  GT +E+  ++ VR++YLG  F
Sbjct: 182 KDKNIGILITDHDVQATLAITDKTYLMYNGSILKEGTPEELAADEMVRKVYLGKDF 237


>gi|154148182|ref|YP_001406626.1| ABC-transporter ATP-binding protein [Campylobacter hominis ATCC
           BAA-381]
 gi|153804191|gb|ABS51198.1| ABC-transporter ATP-binding protein [Campylobacter hominis ATCC
           BAA-381]
          Length = 242

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 119/235 (50%), Positives = 169/235 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L   +L K      ++KG+ L+V+ GEIVGLLGPNGAGKTT FYM+ GLI A  G I +D
Sbjct: 4   LEVKNLKKTIKKTEIIKGISLFVENGEIVGLLGPNGAGKTTTFYMICGLIPASGGEIFLD 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
            N+I+K+ + +RARLGI YLPQE+SIF+ L+VEEN++   E+  KD+ + ++K++ +L  
Sbjct: 64  NNEISKISLNKRARLGIGYLPQESSIFKDLSVEENLMLAAEITYKDENEANKKVNEMLNL 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
            NI   R      LSGG+RRR EIARSL+  P ++LLDEPFAGVDP+A++DI  +++ L 
Sbjct: 124 LNIEPIRDRKGVSLSGGERRRCEIARSLMITPKFLLLDEPFAGVDPIAVADIQNIVKSLK 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             GIG+LITDHNV E L + DRAY+I  G +LA G+ +++ ++++V++ YLGD F
Sbjct: 184 DLGIGVLITDHNVRETLAICDRAYVIKDGSLLASGSSKDVANDENVKKYYLGDHF 238


>gi|255693536|ref|ZP_05417211.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Bacteroides finegoldii DSM 17565]
 gi|260620674|gb|EEX43545.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Bacteroides finegoldii DSM 17565]
          Length = 253

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 128/243 (52%), Positives = 163/243 (67%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A    +L    L KKY    VV  V + VK GEIVGLLGPNGAGKTT FYM  GLI  + 
Sbjct: 2   AESKMVLRTEDLVKKYGKRTVVSHVSINVKQGEIVGLLGPNGAGKTTSFYMTVGLITPNE 61

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G I +D  +ITK P+Y+RA+ GI YL QEAS+FR ++VE+NI AVLE+  K K+ + EKL
Sbjct: 62  GRIFLDDLEITKYPVYKRAQTGIGYLAQEASVFRQMSVEDNIAAVLEMTNKPKEYQKEKL 121

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           +SL+ EF + K R      LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  
Sbjct: 122 ESLIAEFRLQKVRKNKGNQLSGGERRRTEIARCLAIDPKFIMLDEPFAGVDPIAVEDIQQ 181

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           ++  L  + IGILITDHNV E L++ DRAY++  G +L  GT +E+ +NQ VR  YL + 
Sbjct: 182 IVWKLKDKNIGILITDHNVQETLSITDRAYLLFEGKILFQGTPEELSENQIVREKYLSNS 241

Query: 260 FAF 262
           F  
Sbjct: 242 FVL 244


>gi|57167689|ref|ZP_00366829.1| ABC transporter, ATP-binding protein [Campylobacter coli RM2228]
 gi|305433196|ref|ZP_07402352.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Campylobacter coli JV20]
 gi|57020811|gb|EAL57475.1| ABC transporter, ATP-binding protein [Campylobacter coli RM2228]
 gi|304443897|gb|EFM36554.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Campylobacter coli JV20]
          Length = 242

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 121/221 (54%), Positives = 161/221 (72%)

Query: 42  KGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYRRARLG 101
           +G+ L +  GE+VGLLGPNGAGKTT FYM+ GLI   SG + +DG DITK P+ +RARLG
Sbjct: 20  QGISLELNSGEVVGLLGPNGAGKTTTFYMICGLISPSSGKVLLDGLDITKEPLNKRARLG 79

Query: 102 ISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSG 161
           I YLPQE+SIF+ L+VE+N+L   +++ KDKK  HEK++ +L+  +I   R      LSG
Sbjct: 80  IGYLPQESSIFKDLSVEDNLLLAAQIFYKDKKILHEKVEQMLELLSIEPIRLRKGLSLSG 139

Query: 162 GQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIGILITDHNVHEI 221
           G+RRR EIARSL+  P ++LLDEPFAGVDP+A+++I  LI +L    IGILITDHNV E 
Sbjct: 140 GERRRCEIARSLMCEPKFLLLDEPFAGVDPIAVAEIQSLINELKKLDIGILITDHNVRET 199

Query: 222 LTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L + DRAY+I +G +LA G  +EI +N+DV++ YLG  F  
Sbjct: 200 LAICDRAYVIRSGSLLASGNAEEIANNKDVKKYYLGAEFKL 240


>gi|88704065|ref|ZP_01101780.1| Branched-chain amino acid transport ATP-binding protein
           [Congregibacter litoralis KT71]
 gi|88701892|gb|EAQ98996.1| Branched-chain amino acid transport ATP-binding protein
           [Congregibacter litoralis KT71]
          Length = 241

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 122/238 (51%), Positives = 169/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L+A SL K Y    VVK V + V+  ++VGLLGPNGAGKTT FYM+ G++ +D G I 
Sbjct: 2   ATLTARSLAKAYRGRAVVKDVSIEVQSAQVVGLLGPNGAGKTTCFYMIVGIVASDGGDIL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID   IT +PM+ RAR GI YLPQEASIFR ++V +NIL++LE  +   + +R  + D L
Sbjct: 62  IDDESITALPMHERARRGIGYLPQEASIFRRMSVGDNILSILETRKDLSRAERRTRRDEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF++   R  L   LSGG+RRR+EIAR+L   P +ILLDEPFAGVDP+++ DI  +IR
Sbjct: 122 LEEFHVGHLRDSLGQALSGGERRRVEIARALAMEPKFILLDEPFAGVDPISVGDIKNIIR 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L +RGIG+LITDHNV E L + + A+I+  G ++A G+ Q++++N  VR+ YLG+ F
Sbjct: 182 HLQTRGIGVLITDHNVRETLDICETAFIVGEGHIIAQGSPQDVLENAKVRKTYLGENF 239


>gi|326795048|ref|YP_004312868.1| sulfate-transporting ATPase [Marinomonas mediterranea MMB-1]
 gi|326545812|gb|ADZ91032.1| Sulfate-transporting ATPase [Marinomonas mediterranea MMB-1]
          Length = 241

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 170/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K Y    VV  V L V+ G+ VGLLGPNGAGKTT FYM+ G++  D+G I 
Sbjct: 2   AILEAKHLAKAYKKRKVVLDVSLSVESGQAVGLLGPNGAGKTTCFYMIVGMVANDAGGIF 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           IDG D+TK  M+ RA+ GI YLPQEASIFR ++VE+NI A++E  +   K++R + L+ L
Sbjct: 62  IDGLDVTKDAMHARAQKGIGYLPQEASIFRKMSVEDNIAAIIETRKTLTKQERSDLLEKL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF++T  R  L   LSGG+RRR+EIAR+L   P +ILLDEPFAGVDP+++ DI  +I+
Sbjct: 122 LEEFHVTHIRKNLGMALSGGERRRVEIARALAMNPKFILLDEPFAGVDPISVGDIKQIIK 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   GIG+LITDHNV E L + D+AYI+  G ++A G   ++I+N+ V+++YLGD F
Sbjct: 182 HLTDSGIGVLITDHNVRETLDICDKAYIVGNGHIIASGNADDVINNEQVKKVYLGDDF 239


>gi|78485317|ref|YP_391242.1| ABC transporter related [Thiomicrospira crunogena XCL-2]
 gi|78363603|gb|ABB41568.1| ABC transporter, ATP binding protein homolog [Thiomicrospira
           crunogena XCL-2]
          Length = 240

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 170/236 (72%), Gaps = 5/236 (2%)

Query: 28  ACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGN 87
           A  + K Y   +VV  VDL V+ G++VGLLGPNGAGKTT FYMMTGL+  D+G I +D  
Sbjct: 6   ARKIAKSYKRRHVVSSVDLDVESGQVVGLLGPNGAGKTTTFYMMTGLVPNDAGEIFLDDR 65

Query: 88  DITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK---DKKKRHEKLDSLLK 144
           +I+ + + +RA+LGI YLPQEAS+FR LTVE+NI+A+LE+  +   D+KK+H   + L+ 
Sbjct: 66  EISNLSIDQRAKLGIGYLPQEASVFRKLTVEQNIMAILEMRPELTLDQKKQH--YEELID 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           +  I      L   LSGG+RRR+EIAR+L   P++ILLDEPFAGVDP+++ DI  +I  L
Sbjct: 124 DLQIGHITTQLGQALSGGERRRVEIARALAMEPNFILLDEPFAGVDPISVKDIQNIILHL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             +GIG+LITDHNV E L + D+AYI+HAG +LA G   EI+ N DV+R+YLG+ F
Sbjct: 184 KMKGIGVLITDHNVRETLGVCDQAYILHAGTILAQGAPHEILSNADVKRVYLGENF 239


>gi|281425288|ref|ZP_06256201.1| hypothetical protein HMPREF0971_02260 [Prevotella oris F0302]
 gi|281400581|gb|EFB31412.1| lipopolysaccharide ABC transporter, ATP-binding protein [Prevotella
           oris F0302]
          Length = 263

 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 163/239 (68%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L    L K+Y    V  GV + VK GEIVGLLGPNGAGKTT FYM TG +  + G + 
Sbjct: 11  TTLRTEGLVKRYGKRTVANGVSINVKQGEIVGLLGPNGAGKTTSFYMTTGNVVPNEGHVY 70

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +D  +IT  P+Y+RAR GI YLPQEAS+FR L+VE+NI+AVLE+ +    ++ EKL+SL+
Sbjct: 71  LDDEEITNYPVYKRARAGIGYLPQEASVFRKLSVEDNIMAVLEMTKLSHAQQLEKLESLI 130

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            EF + K R      LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  
Sbjct: 131 SEFRLNKVRKNKGDQLSGGERRRTEIARCLAIDPKFIMLDEPFAGVDPIAVEDIQHIVWR 190

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  R IGILITDHNV E L++ DRAY++  G +L HGT +E+  N  VR+ YL + F +
Sbjct: 191 LKYRNIGILITDHNVQETLSITDRAYLLFEGRILFHGTSEELAANPVVRKNYLSENFVY 249


>gi|256827966|ref|YP_003156694.1| ABC transporter-like protein [Desulfomicrobium baculatum DSM 4028]
 gi|256577142|gb|ACU88278.1| ABC transporter related [Desulfomicrobium baculatum DSM 4028]
          Length = 240

 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 118/239 (49%), Positives = 170/239 (71%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L+   L K+Y    VV+ +DL V+ GE+VG+LGPNGAGKTT FYM+ G++    G + 
Sbjct: 2   TTLTGQKLAKRYGLRDVVRDIDLDVRQGEVVGVLGPNGAGKTTTFYMLAGIVPPTRGQVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +DG DIT+ P+++RAR G+SYLPQE+SIFR LTV +N+  +LE     K ++    D LL
Sbjct: 62  LDGMDITRWPLHKRARAGMSYLPQESSIFRKLTVRQNLQLILEYSGFSKDEQQRTADRLL 121

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            E  IT+    LA  LSGG+RRRLEIAR+L+  P +ILLDEPFAG+DP+A+ DI  +I+D
Sbjct: 122 DELGITRLEGQLAAFLSGGERRRLEIARALIQNPKFILLDEPFAGIDPLAVDDIQTIIQD 181

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L  +GIG+LI+DHNV E L + DRAY+++ G ++ +G+ +EI+ +   R++YLG+ F+ 
Sbjct: 182 LRGKGIGVLISDHNVRETLQICDRAYLVYDGQIILNGSPEEIVADPGARKVYLGEGFSL 240


>gi|88803238|ref|ZP_01118764.1| ABC transporter ATP-binding protein [Polaribacter irgensii 23-P]
 gi|88780804|gb|EAR11983.1| ABC transporter ATP-binding protein [Polaribacter irgensii 23-P]
          Length = 245

 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 122/236 (51%), Positives = 172/236 (72%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A ++ K Y S  VVKG+ L V+ GEI+GLLGPNGAGKTT FYM+ G+I  ++G I +
Sbjct: 2   ILKAENIQKIYGSRKVVKGISLEVQQGEIIGLLGPNGAGKTTSFYMIVGMIKPNAGQIFL 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           +  +IT+  MY+RA+ GI YL QEAS+FR L+VE+NI++VL+   + KK++  KL+SL++
Sbjct: 62  NEEEITQDAMYKRAQKGIGYLAQEASVFRKLSVEDNIMSVLQFTGRSKKEQKIKLESLIE 121

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EFNI   R     LLSGG+RRR EIAR L S P++ILLDEPFAGVDP+A+ DI  ++  L
Sbjct: 122 EFNIGHVRKNRGDLLSGGERRRTEIARCLASDPNFILLDEPFAGVDPIAVEDIQSIVAQL 181

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            +R IGILITDH+V   L + D+ Y+++ G +L  GT +E+  ++ VR++YLG+ F
Sbjct: 182 KNRNIGILITDHDVQATLAITDKTYLMYNGSILKEGTPEELAADEMVRKVYLGNDF 237


>gi|312131174|ref|YP_003998514.1| abc transporter related protein [Leadbetterella byssophila DSM
           17132]
 gi|311907720|gb|ADQ18161.1| ABC transporter related protein [Leadbetterella byssophila DSM
           17132]
          Length = 245

 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 168/240 (70%), Gaps = 2/240 (0%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L    L KKY    V   V   V+ GEIVGLLGPNGAGKTT FYM  GL+  +SG I +
Sbjct: 2   VLRTEDLVKKYGQRLVNDHVSYQVEQGEIVGLLGPNGAGKTTSFYMAVGLVKPNSGKIWL 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY--EKDKKKRHEKLDSL 142
           D  DITK+PMY+RA+LG+ YL QEAS+FR L+V++NI+ V+E+   E  + +R EK++ L
Sbjct: 62  DDIDITKLPMYKRAKLGVGYLAQEASVFRDLSVQDNIIGVMELAKPEMTQAQRREKMEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF++T  R     +LSGG+RRR EIAR+L   P +ILLDEPFAGVDP+A+ +I  ++ 
Sbjct: 122 LEEFSLTHVRKNKGMVLSGGERRRTEIARALAVDPKFILLDEPFAGVDPIAVEEIQGIVA 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L  R IGILITDHNV+E L++ DRAY++  G +L  GT +E+  ++ VRR+YLG  F  
Sbjct: 182 KLKHRNIGILITDHNVNETLSITDRAYLLFEGKILKQGTAEELAADEQVRRVYLGTHFEL 241


>gi|307824373|ref|ZP_07654599.1| ABC transporter related protein [Methylobacter tundripaludum SV96]
 gi|307734753|gb|EFO05604.1| ABC transporter related protein [Methylobacter tundripaludum SV96]
          Length = 261

 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 169/238 (71%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L+A  L K YN   VV GV L+V  GE+VGLLGPNGAGKTT FYMM GLI AD G I +D
Sbjct: 24  LAAKQLIKSYNKRNVVNGVSLHVDTGEVVGLLGPNGAGKTTSFYMMVGLIKADEGEITLD 83

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHE-KLDSLLK 144
              IT  PM+ RA+LGI YLPQE S+FR L+V +N+ AVL++     + + E  ++ LL+
Sbjct: 84  SQVITHHPMHLRAQLGIGYLPQEPSVFRKLSVADNLRAVLQIRSDLTQGQAELVIEELLQ 143

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+I   R   A  LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I  L
Sbjct: 144 EFHILHLRDQTALGLSGGERRRVEIARALATNPQFILLDEPFAGVDPISVDDIKKIIEHL 203

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             RGIG+LIT+HNV E L + DRAYI++ G V+A G  + I+ N++VR++YLG+ F+ 
Sbjct: 204 KYRGIGVLITEHNVRETLGICDRAYILNDGRVIAEGGAEAIVANEEVRKVYLGNNFSL 261


>gi|146305906|ref|YP_001186371.1| ABC transporter related [Pseudomonas mendocina ymp]
 gi|145574107|gb|ABP83639.1| ABC transporter related protein [Pseudomonas mendocina ymp]
          Length = 241

 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 169/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K Y S  VV+ V L ++ G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   AILKAQHLAKSYKSRQVVRDVSLSIESGQIVGLLGPNGAGKTTCFYMIVGLVRADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  D++  PM+ RAR GI YLPQEASIFR L+V +NI+A+LE  +  D+  R  +L++L
Sbjct: 62  IDDLDVSHQPMHGRARAGIGYLPQEASIFRKLSVTDNIMAILETRKDLDRAGRQAELENL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I      L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHIHHIADSLGMSLSGGERRRVEIARALATNPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIGILITDHNV E L + + AYI++ G ++A G  Q I+ NQ V+ +YLG  F
Sbjct: 182 HLKAKGIGILITDHNVRETLDICETAYIVNDGQLIAEGDAQTILANQTVKEVYLGHEF 239


>gi|302185311|ref|ZP_07261984.1| ABC transporter, ATP-binding protein [Pseudomonas syringae pv.
           syringae 642]
          Length = 241

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 169/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y S  VV+ V + +  G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   ATLKAQHLAKSYKSRQVVRDVSISIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID  D++  PM+ RAR GI YLPQEASIFR L+V +NI+A+LE   E D   R ++L+SL
Sbjct: 62  IDDLDVSHQPMHGRARAGIGYLPQEASIFRKLSVSDNIMAILETRKELDVGARRKELESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+IT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHITHIRDNLGMSLSGGERRRVEIARALATAPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIG+LITDHNV E L + + AYI++ G ++A G  + I+ NQ V+ +YLG  F
Sbjct: 182 HLKAKGIGVLITDHNVRETLDICETAYIVNDGQLIAEGDSETILANQLVKEVYLGHEF 239


>gi|260886291|ref|ZP_05897554.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Selenomonas sputigena ATCC 35185]
 gi|330839726|ref|YP_004414306.1| Sulfate-transporting ATPase [Selenomonas sputigena ATCC 35185]
 gi|260864010|gb|EEX78510.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Selenomonas sputigena ATCC 35185]
 gi|329747490|gb|AEC00847.1| Sulfate-transporting ATPase [Selenomonas sputigena ATCC 35185]
          Length = 239

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 132/237 (55%), Positives = 162/237 (68%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K +    VV  V L V+ GEIVGLLGPNGAGKTT FYM+TGL    SG + + 
Sbjct: 3   LEAKDLVKTFKRRSVVDHVSLRVEKGEIVGLLGPNGAGKTTTFYMITGLERPTSGDVFVS 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
              IT MPMY RARLGISYL QEASIFR +TVEEN+L++LE+ +   ++R EK+++LL E
Sbjct: 63  DVRITSMPMYARARLGISYLAQEASIFRKMTVEENLLSILEMTKLSAQERREKMENLLAE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F I   R  L   LSGG+RRR+EIAR L   P +ILLDEPFAGVDP+A++DI  +I  L 
Sbjct: 123 FRIGHVRDRLGTELSGGERRRVEIARCLAIEPQFILLDEPFAGVDPIAVADIQEIIAYLR 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIGILITDHNV E L ++DRAYI++ G +L  G    I  +   R+ YLGD F  
Sbjct: 183 KRGIGILITDHNVRETLHIVDRAYILNDGKILLEGDSATIAASDLARKFYLGDNFTL 239


>gi|254468241|ref|ZP_05081647.1| ABC transporter, ATPase subunit [beta proteobacterium KB13]
 gi|207087051|gb|EDZ64334.1| ABC transporter, ATPase subunit [beta proteobacterium KB13]
          Length = 240

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 122/233 (52%), Positives = 168/233 (72%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           ++ K Y +  VVK + L +  GEI+GLLGPNGAGKTT FYM+ GLI  + GSI +D  DI
Sbjct: 8   NIKKSYKNKNVVKDISLEISSGEIIGLLGPNGAGKTTSFYMIVGLIQPEHGSILVDNTDI 67

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           TK P++ R++LG++YLPQE SIFR + VEENI+++LE+ + +K     KL+ LL E  I 
Sbjct: 68  TKKPIHVRSQLGLAYLPQEPSIFRKMNVEENIISILELRKLNKDDIKTKLNLLLNELGIE 127

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             R   A  LSGG+RRR+EIAR L + P +ILLDEPFAG+DP+A+ DI  +I+ L+SRGI
Sbjct: 128 HIRKNSAISLSGGERRRVEIARCLATNPKFILLDEPFAGIDPIAVLDIQKIIKFLSSRGI 187

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           GILITDH+V E L + +RAYI++ G +   GT  EI++N++V+ +YLG  F+ 
Sbjct: 188 GILITDHSVRETLGICNRAYIVNQGKIFTSGTPNEIVENENVKNIYLGQDFSL 240


>gi|150025305|ref|YP_001296131.1| ABC transporter ATPase [Flavobacterium psychrophilum JIP02/86]
 gi|149771846|emb|CAL43320.1| Probable ABC-type transport system, ATPase component YhbG
           [Flavobacterium psychrophilum JIP02/86]
          Length = 246

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 122/236 (51%), Positives = 168/236 (71%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A +L K Y    VVKG+ + V  GEIVGLLGPNGAGKTT FYM+ GL+  +SG+I +
Sbjct: 2   ILRAENLVKTYKGRSVVKGISVEVNQGEIVGLLGPNGAGKTTSFYMVVGLVKPNSGNIYL 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           D  +IT  PMY+RA+ GI YL QEAS+FR L++E+NIL+VL++ +  K  +  K++SL+ 
Sbjct: 62  DDMNITSFPMYKRAQNGIGYLAQEASVFRKLSIEDNILSVLQLTKLSKAAQEAKMESLID 121

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF++   R     LLSGG+RRR EIAR L + P +ILLDEPFAGVDPVA+ DI  ++  L
Sbjct: 122 EFSLQHIRTNRGDLLSGGERRRTEIARCLATDPKFILLDEPFAGVDPVAVEDIQRIVAKL 181

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            ++ IGILITDHNV E L + D+ Y++  G +L  G  +E+++++ VRR+YLG  F
Sbjct: 182 KNKNIGILITDHNVQETLAITDKTYLMFEGRILKAGVPEELVEDEMVRRVYLGQNF 237


>gi|305664751|ref|YP_003861038.1| ABC transporter ATP-binding protein [Maribacter sp. HTCC2170]
 gi|88707873|gb|EAR00112.1| ABC transporter ATP-binding protein [Maribacter sp. HTCC2170]
          Length = 246

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 124/235 (52%), Positives = 169/235 (71%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A ++ K Y    VVKG+ L V  GEIVGLLGPNGAGKTT FYM+ GLI  +SG+I +D
Sbjct: 3   LRAENIMKAYRGRQVVKGISLEVNQGEIVGLLGPNGAGKTTSFYMIVGLIKPNSGNIFLD 62

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             +ITK PMY+RA+ GI YL QEAS+FR L++E+NIL+VL++    KK++  K++SL++E
Sbjct: 63  DMEITKFPMYKRAQNGIGYLAQEASVFRKLSIEKNILSVLQLTNLSKKEQLMKMESLIEE 122

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +   R     LLSGG+RRR EIAR+L + P +ILLDEPFAGVDPVA+ DI  ++  L 
Sbjct: 123 FGLGHIRKNRGDLLSGGERRRTEIARALATDPKFILLDEPFAGVDPVAVEDIQRIVAHLK 182

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            + IGILITDHNV E L + +R+Y++  GG+L  G  +++  ++ VR++YLG  F
Sbjct: 183 DKNIGILITDHNVQETLAITERSYLMFEGGILKSGVPEDLAADEMVRKVYLGQNF 237


>gi|222823756|ref|YP_002575330.1| ABC transporter, ATP-binding protein [Campylobacter lari RM2100]
 gi|222538978|gb|ACM64079.1| ABC transporter, ATP-binding protein [Campylobacter lari RM2100]
          Length = 241

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 160/217 (73%)

Query: 44  VDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYRRARLGIS 103
           V L ++ GE+VGLLGPNGAGKTT FYM+ GLI   SG + +D  DITK P+ +RA+LGI 
Sbjct: 22  VSLEIQSGEVVGLLGPNGAGKTTSFYMICGLILPTSGQVFLDSQDITKEPLNKRAKLGIG 81

Query: 104 YLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQ 163
           YLPQE+SIF+ L+VE+N+L   ++  KDKK   +K++ +L+  +I   RH     LSGG+
Sbjct: 82  YLPQESSIFKDLSVEDNLLLAAQMLYKDKKILDQKIEQMLELLSIEPIRHRKGLSLSGGE 141

Query: 164 RRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIGILITDHNVHEILT 223
           RRR EIARSL+  P ++LLDEPFAGVDP+A+S+I  LI+DL +  IG+LITDHNV E L 
Sbjct: 142 RRRCEIARSLMCDPKFLLLDEPFAGVDPIAVSEIQSLIKDLKAMNIGVLITDHNVRETLA 201

Query: 224 LIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           + DRAY+I +G +LA G   EI DN+DV++ YLG+ F
Sbjct: 202 ICDRAYVIRSGRLLASGNASEIADNEDVKKYYLGNEF 238


>gi|296104914|ref|YP_003615060.1| lipopolysaccharide export system ATP-binding protein [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
 gi|295059373|gb|ADF64111.1| lipopolysaccharide export system ATP-binding protein [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
          Length = 241

 Score =  251 bits (642), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 123/238 (51%), Positives = 174/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L+A +L K Y    VV+ V L V  GEIVGLLGPNGAGKTT FYM+ G++  D+G+I 
Sbjct: 2   ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNII 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V +N++AVL++ +    ++R ++ + L
Sbjct: 62  IDDEDISLLPLHARARRGIGYLPQEASIFRRLSVFDNLMAVLQIRDDLTSEQRQDRANEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+I   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 MEEFHIEHLRDSLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT Q+I+++  V+R+YLG+ F
Sbjct: 182 HLRDSGLGVLITDHNVRETLAVCERAYIVSQGNLIAHGTPQQILEDDHVKRVYLGEDF 239


>gi|258648517|ref|ZP_05735986.1| lipopolysaccharide ABC transporter, ATP-binding protein [Prevotella
           tannerae ATCC 51259]
 gi|260851284|gb|EEX71153.1| lipopolysaccharide ABC transporter, ATP-binding protein [Prevotella
           tannerae ATCC 51259]
          Length = 272

 Score =  251 bits (642), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 129/242 (53%), Positives = 166/242 (68%), Gaps = 1/242 (0%)

Query: 20  ASKDSL-LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICAD 78
            +KD++ L    L KKY    VV  V   V  GEIVGLLGPNGAGKTT FYM TGL+  +
Sbjct: 12  TAKDAMVLRTEGLVKKYGRRTVVNDVSFNVHQGEIVGLLGPNGAGKTTSFYMTTGLVVPN 71

Query: 79  SGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEK 138
            G I ++ +DITK P+Y+RAR GI YL QEAS+FR ++VE+NI++VLE+  K K+ R +K
Sbjct: 72  GGHIYLNDHDITKFPVYKRARYGIGYLAQEASVFRSMSVEDNIMSVLEMTGKSKEYRKDK 131

Query: 139 LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIH 198
           L+SL+ EF + K R      LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI 
Sbjct: 132 LESLIAEFRLGKVRKNKGNQLSGGERRRTEIARCLAIDPKFIMLDEPFAGVDPIAVEDIQ 191

Query: 199 VLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGD 258
            ++  L  R IGILITDHNV E L++ DRAY++  G +L  GT +E+  NQ VR  YL +
Sbjct: 192 YIVWKLKDRHIGILITDHNVEETLSITDRAYLLFEGRILFQGTPEELAANQVVRDKYLTN 251

Query: 259 RF 260
            F
Sbjct: 252 SF 253


>gi|237712742|ref|ZP_04543223.1| ABC transporter ATP-binding protein [Bacteroides sp. D1]
 gi|262408121|ref|ZP_06084668.1| urea ABC transporter, ATP-binding protein UrtD [Bacteroides sp.
           2_1_22]
 gi|293369493|ref|ZP_06616072.1| ABC transporter, ATP-binding protein [Bacteroides ovatus SD CMC 3f]
 gi|294644222|ref|ZP_06721992.1| ABC transporter, ATP-binding protein [Bacteroides ovatus SD CC 2a]
 gi|294808600|ref|ZP_06767340.1| ABC transporter, ATP-binding protein [Bacteroides xylanisolvens SD
           CC 1b]
 gi|298480164|ref|ZP_06998362.1| ABC transporter, ATP-binding protein [Bacteroides sp. D22]
 gi|229447219|gb|EEO53010.1| ABC transporter ATP-binding protein [Bacteroides sp. D1]
 gi|262353673|gb|EEZ02766.1| urea ABC transporter, ATP-binding protein UrtD [Bacteroides sp.
           2_1_22]
 gi|292635378|gb|EFF53891.1| ABC transporter, ATP-binding protein [Bacteroides ovatus SD CMC 3f]
 gi|292640432|gb|EFF58680.1| ABC transporter, ATP-binding protein [Bacteroides ovatus SD CC 2a]
 gi|294444199|gb|EFG12926.1| ABC transporter, ATP-binding protein [Bacteroides xylanisolvens SD
           CC 1b]
 gi|295088055|emb|CBK69578.1| ABC-type (unclassified) transport system, ATPase component
           [Bacteroides xylanisolvens XB1A]
 gi|298273445|gb|EFI15008.1| ABC transporter, ATP-binding protein [Bacteroides sp. D22]
          Length = 253

 Score =  251 bits (642), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 162/238 (68%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L    L KKY    VV  V + VK GEIVGLLGPNGAGKTT FYM  GLI  + G I +
Sbjct: 7   VLRTEDLVKKYGKRTVVSHVSINVKQGEIVGLLGPNGAGKTTSFYMTVGLITPNEGRIFL 66

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           D  +ITK P+Y+RA+ GI YL QEAS+FR ++VE+NI AVLE+  K K+ + EKL+SL+ 
Sbjct: 67  DDLEITKYPVYKRAQTGIGYLAQEASVFRQMSVEDNIAAVLEMTNKPKEYQKEKLESLIA 126

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF + K R      LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  L
Sbjct: 127 EFRLQKVRKNKGNQLSGGERRRTEIARCLAIDPKFIMLDEPFAGVDPIAVEDIQQIVWKL 186

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             + IGILITDHNV E L++ DRAY++  G +L  GT +E+ +NQ VR  YL + F  
Sbjct: 187 KDKNIGILITDHNVQETLSITDRAYLLFEGKILFQGTPEELSENQIVREKYLSNSFVL 244


>gi|289627571|ref|ZP_06460525.1| ABC transporter, ATP-binding protein [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|330869982|gb|EGH04691.1| ABC transporter ATP-binding protein [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 241

 Score =  251 bits (642), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 168/238 (70%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y S  VV+ V + +  G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   ATLKAQHLAKSYKSRQVVRDVSISIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID  D++  PM+ RAR GI YLPQEASIFR L+V +NI+A+LE   E D   R ++L SL
Sbjct: 62  IDDLDVSHQPMHGRARAGIGYLPQEASIFRKLSVSDNIMAILETRKELDAGARRKELKSL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+IT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHITHIRDNLGMSLSGGERRRVEIARALATAPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIG+LITDHNV E L + + AYI++ G ++A G  + I+ NQ V+ +YLG  F
Sbjct: 182 HLKAKGIGVLITDHNVRETLDICETAYIVNDGQLIAEGDSETILANQLVKEVYLGHEF 239


>gi|261250136|ref|ZP_05942712.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           orientalis CIP 102891]
 gi|260939252|gb|EEX95238.1| lipopolysaccharide ABC transporter ATP-binding protein LptB [Vibrio
           orientalis CIP 102891]
          Length = 241

 Score =  251 bits (642), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 175/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K Y +  VV  V L V+ G+IVGLLGPNGAGKTT FYM+ GL+  D GSI 
Sbjct: 2   AILKAEHLAKTYGNRTVVTDVSLQVESGQIVGLLGPNGAGKTTSFYMIVGLVARDQGSIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR-HEKLDSL 142
           ID  DI+ +PM+ R+R+GI YLPQEASIFR L+VE+NI+AVLE  E+  ++   +KL+ L
Sbjct: 62  IDDKDISILPMHSRSRMGIGYLPQEASIFRKLSVEDNIMAVLETREEMTREERQDKLEDL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LEEFHIQHIRASAGMALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RG+G+LITDHNV E L + ++AYI+  G ++A GT  ++++N+ V+++YLG++F
Sbjct: 182 HLRDRGLGVLITDHNVRETLDVCEKAYIVSQGHLIAEGTPDQVLNNEQVKQVYLGEQF 239


>gi|189462220|ref|ZP_03011005.1| hypothetical protein BACCOP_02903 [Bacteroides coprocola DSM 17136]
 gi|189431073|gb|EDV00058.1| hypothetical protein BACCOP_02903 [Bacteroides coprocola DSM 17136]
          Length = 274

 Score =  251 bits (642), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 125/238 (52%), Positives = 164/238 (68%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L   +L KKY    VV  V + VK GEIVGLLGPNGAGKTT FYM TGLI  + G I +
Sbjct: 24  VLRTENLVKKYGKRTVVSHVSINVKQGEIVGLLGPNGAGKTTSFYMTTGLIVPNEGHIYL 83

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           +  DIT  P+Y+RA+ GI YL QEAS+FR ++VE+NI +VLE+ +  K+ + EKL+SL+ 
Sbjct: 84  NNQDITDYPVYKRAQNGIGYLAQEASVFRKMSVEDNIASVLELTKTSKEYQKEKLESLIA 143

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF + K R  L   LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  L
Sbjct: 144 EFRLQKVRKNLGDQLSGGERRRTEIARCLAIDPKFIMLDEPFAGVDPIAVEDIQHIVWKL 203

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             + IGILITDHNV E L++ DRAY++  G +L  GT +E+ +N+ VR  YL + F  
Sbjct: 204 KDKNIGILITDHNVQETLSITDRAYLLFEGKILFQGTPEELAENKIVREKYLSNSFVL 261


>gi|226951451|ref|ZP_03821915.1| lipopolysaccharide ABC transporter ATP-binding protein
           [Acinetobacter sp. ATCC 27244]
 gi|226837799|gb|EEH70182.1| lipopolysaccharide ABC transporter ATP-binding protein
           [Acinetobacter sp. ATCC 27244]
          Length = 248

 Score =  251 bits (642), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 124/231 (53%), Positives = 170/231 (73%), Gaps = 1/231 (0%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K Y+  +VVK V   ++ G+IVGLLGPNGAGKTT FYM+ GL+  D G I +D  D++
Sbjct: 16  LAKNYSKRWVVKDVSFTMQSGQIVGLLGPNGAGKTTSFYMVVGLVRMDKGEIHLDDLDLS 75

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLKEFNIT 149
            + M+ RAR GI YLPQEASIFR LT+ ENI+A+LE  +  +K++R ++L+ LL +F I+
Sbjct: 76  DLAMHERARKGIGYLPQEASIFRKLTIAENIMAILETRKDLNKQQRQQRLNELLGDFKIS 135

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             +  L   +SGG+RRR EIAR+L + P ++LLDEPFAGVDP+++ DI  +I+ L  RGI
Sbjct: 136 HIKDSLGMSVSGGERRRAEIARALAADPKFMLLDEPFAGVDPISVGDIKEIIQTLKDRGI 195

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           G+LITDHNV E L + ++AYI+  G V+A GT QEI+DN+ VR++YLGD F
Sbjct: 196 GVLITDHNVRETLAICEKAYIVSEGSVIAEGTPQEILDNEQVRKVYLGDDF 246


>gi|56477356|ref|YP_158945.1| putative ATP-binding ABC transporter protein [Aromatoleum
           aromaticum EbN1]
 gi|56313399|emb|CAI08044.1| putative ATP-binding ABC transporter protein [Aromatoleum
           aromaticum EbN1]
          Length = 240

 Score =  251 bits (642), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 132/237 (55%), Positives = 164/237 (69%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           SLL    L K+Y +  VV  V   V  GE+VGLLGPNGAGKTT FYM+ GL+ AD G I 
Sbjct: 2   SLLKVAGLQKRYKARTVVHDVGFEVGSGEVVGLLGPNGAGKTTCFYMIVGLVRADGGDIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +D   +T +P++ RARLG+SYLPQE S+FR LTV ENI AVLE+    +++   +L+ LL
Sbjct: 62  LDEALLTHLPIHARARLGLSYLPQEMSVFRKLTVAENIRAVLELQTLTEEEITTRLEQLL 121

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +E  I   R   A  LSGG+RRR EIAR+L + P  ILLDEPFAGVDP+A+ DI  +IR 
Sbjct: 122 EELGIAHLRDNTAISLSGGERRRCEIARALATDPRLILLDEPFAGVDPIAVLDIQKIIRF 181

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  RGIG+LITDHNV E L + DRAYII  G VLA G   EI+ N+ VR++YLG+ F
Sbjct: 182 LKDRGIGVLITDHNVRETLGICDRAYIISEGRVLASGRPGEIVANERVRQVYLGEHF 238


>gi|152972125|ref|YP_001337271.1| putative ABC transporter ATP-binding protein YhbG [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|206577061|ref|YP_002236387.1| lipopolysaccharide ABC transporter, ATP-binding protein [Klebsiella
           pneumoniae 342]
 gi|288933371|ref|YP_003437430.1| ABC transporter [Klebsiella variicola At-22]
 gi|290511578|ref|ZP_06550947.1| lipopolysaccharide export system ATP-binding protein lptB
           [Klebsiella sp. 1_1_55]
 gi|329997609|ref|ZP_08302878.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Klebsiella sp. MS 92-3]
 gi|150956974|gb|ABR79004.1| putative ATP-binding component of a transport system [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|206566119|gb|ACI07895.1| lipopolysaccharide ABC transporter, ATP-binding protein [Klebsiella
           pneumoniae 342]
 gi|288888100|gb|ADC56418.1| ABC transporter related protein [Klebsiella variicola At-22]
 gi|289776571|gb|EFD84570.1| lipopolysaccharide export system ATP-binding protein lptB
           [Klebsiella sp. 1_1_55]
 gi|328538950|gb|EGF65003.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Klebsiella sp. MS 92-3]
          Length = 241

 Score =  251 bits (642), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 123/238 (51%), Positives = 174/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L+A +L K Y    VV+ V L V  GEIVGLLGPNGAGKTT FYM+ G++  D+G+I 
Sbjct: 2   ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNII 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V +N++AVL++ +    ++R ++   L
Sbjct: 62  IDDEDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLTSEQREDRAKEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+I   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 MEEFHIEHLRDSLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT Q+I++++ V+R+YLG+ F
Sbjct: 182 HLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPQQILEDEQVKRVYLGEDF 239


>gi|330877185|gb|EGH11334.1| ABC transporter ATP-binding protein [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 241

 Score =  251 bits (642), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 169/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y S  VV+ V + +  G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   ATLKAQHLAKSYKSRQVVRDVSISIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID  DI+  PM+ RAR GI YLPQEASIFR L+V +NI+A+LE   E D   R ++L+SL
Sbjct: 62  IDDLDISHQPMHGRARAGIGYLPQEASIFRKLSVSDNIMAILETRKELDAGARRKELESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+IT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHITHIRDNLGMSLSGGERRRVEIARALATSPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIG+LITDHNV E L + + AYI++ G ++A G  + I+ N+ V+ +YLG  F
Sbjct: 182 HLKAKGIGVLITDHNVRETLDICETAYIVNDGQLIAEGDSETILANELVKEVYLGHEF 239


>gi|228469867|ref|ZP_04054806.1| ABC transporter, ATP-binding protein [Porphyromonas uenonis 60-3]
 gi|228308502|gb|EEK17290.1| ABC transporter, ATP-binding protein [Porphyromonas uenonis 60-3]
          Length = 267

 Score =  251 bits (642), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 164/238 (68%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           LL    L K+Y S  VV  V + ++ GEIVGLLGPNGAGKTT FYM  GL+  + G I +
Sbjct: 22  LLRTEHLVKRYRSRTVVNDVSIELRQGEIVGLLGPNGAGKTTTFYMTVGLVVPNGGKIYL 81

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           +  DITK+P+Y+RARLGI YL QEAS+FR L+VE+NI AVLE+     +++ E+L+ L+ 
Sbjct: 82  NEQDITKLPVYQRARLGIGYLAQEASVFRKLSVEDNIKAVLEMTPLTPEQQQERLEMLIA 141

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF + K R      LSGG+RRR+EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  L
Sbjct: 142 EFGLHKVRTNQGNRLSGGERRRVEIARCLAIDPKFIMLDEPFAGVDPIAVQDIQSIVAKL 201

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             R IGILITDHNV+E L++ DRAY++  G VL  GT +++ DN  VR  YLG  F  
Sbjct: 202 KQRNIGILITDHNVNETLSITDRAYLLFEGKVLFQGTAEQLADNALVREKYLGRDFVL 259


>gi|238896708|ref|YP_002921453.1| putative ABC transporter ATP-binding protein YhbG [Klebsiella
           pneumoniae NTUH-K2044]
 gi|238549035|dbj|BAH65386.1| putative ABC transpor system ATP-binding protein [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 241

 Score =  251 bits (642), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 123/238 (51%), Positives = 174/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L+A +L K Y    VV+ V L V  GEIVGLLGPNGAGKTT FYM+ G++  D+G+I 
Sbjct: 2   ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNII 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V +N++AVL++ +    ++R ++   L
Sbjct: 62  IDEEDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLTSEQREDRAKEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+I   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 MEEFHIEHLRDSLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT Q+I++++ V+R+YLG+ F
Sbjct: 182 HLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPQQILEDEQVKRVYLGEDF 239


>gi|150009003|ref|YP_001303746.1| ABC transporter ATP-binding protein [Parabacteroides distasonis
           ATCC 8503]
 gi|262383893|ref|ZP_06077029.1| ABC transporter ATP-binding protein [Bacteroides sp. 2_1_33B]
 gi|301312053|ref|ZP_07217975.1| ABC transporter, ATP-binding protein [Bacteroides sp. 20_3]
 gi|149937427|gb|ABR44124.1| ABC transporter ATP-binding protein [Parabacteroides distasonis
           ATCC 8503]
 gi|262294791|gb|EEY82723.1| ABC transporter ATP-binding protein [Bacteroides sp. 2_1_33B]
 gi|300830155|gb|EFK60803.1| ABC transporter, ATP-binding protein [Bacteroides sp. 20_3]
          Length = 250

 Score =  251 bits (642), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 164/238 (68%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L    L KKY +  VV  V + VK GEIVGLLGPNGAGKTT FYM  GL+  + G I +
Sbjct: 8   VLRTEDLVKKYRTRTVVNHVSINVKQGEIVGLLGPNGAGKTTTFYMTVGLVTPNEGKIFL 67

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           +  +ITK P+Y+RAR GI YL QEASIFR +TVE+NI +VLE+  +  + + EKL+SL+ 
Sbjct: 68  NDMEITKFPVYKRARNGIGYLAQEASIFRKMTVEDNIRSVLEMTGRSVEYQKEKLESLIS 127

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF + K R  L   LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  L
Sbjct: 128 EFGLNKVRKNLGDQLSGGERRRAEIARCLAIDPKFIMLDEPFAGVDPIAVQDIQTIVARL 187

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             + IGILITDHNV+E L++ DRAY++  G VL  GT +++ +N+ VR  YLG  F  
Sbjct: 188 KHKNIGILITDHNVYETLSICDRAYLLFEGKVLFQGTAEQLAENEIVREKYLGKDFVL 245


>gi|255020586|ref|ZP_05292649.1| Lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Acidithiobacillus caldus ATCC 51756]
 gi|254969971|gb|EET27470.1| Lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Acidithiobacillus caldus ATCC 51756]
          Length = 241

 Score =  251 bits (642), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 162/235 (68%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K+Y    VV+ V + V  GE+VGLLGPNGAGKTT FYMM GL+  D G I + 
Sbjct: 5   LHAEGLCKRYRRRTVVREVSVEVAAGEVVGLLGPNGAGKTTTFYMMVGLVRPDGGHISLL 64

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G DIT +PM++RARLG+ YLPQE S+FR ++  +NILAVLE       +R E+L+ L+ E
Sbjct: 65  GKDITDLPMHQRARLGLGYLPQEPSVFRNMSAADNILAVLEQLPLTPTERAEQLERLMGE 124

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
            ++   R      LSGG+RRR+EIAR+L   P +ILLDEPFAG+DP+++ D+  LIR L 
Sbjct: 125 LHLHALRDTKGHSLSGGERRRVEIARALAMNPRFILLDEPFAGIDPISVLDLQHLIRGLR 184

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            RGIGILITDHNV E L + +RAYI+H G VL  G  + ++ N  VR +YLGD+F
Sbjct: 185 ERGIGILITDHNVRETLGICERAYILHDGAVLTSGNPEAVVSNPLVREVYLGDQF 239


>gi|256840996|ref|ZP_05546503.1| urea ABC transporter, ATP-binding protein UrtD [Parabacteroides sp.
           D13]
 gi|298375765|ref|ZP_06985721.1| ABC transporter, ATP-binding protein [Bacteroides sp. 3_1_19]
 gi|256736839|gb|EEU50166.1| urea ABC transporter, ATP-binding protein UrtD [Parabacteroides sp.
           D13]
 gi|298266802|gb|EFI08459.1| ABC transporter, ATP-binding protein [Bacteroides sp. 3_1_19]
          Length = 250

 Score =  251 bits (641), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 164/238 (68%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L    L KKY +  VV  V + VK GEIVGLLGPNGAGKTT FYM  GL+  + G I +
Sbjct: 8   VLRTEDLVKKYRTRTVVNHVSINVKQGEIVGLLGPNGAGKTTTFYMTVGLVTPNEGKIFL 67

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           +  +ITK P+Y+RAR GI YL QEASIFR +TVE+NI +VLE+  +  + + EKL+SL+ 
Sbjct: 68  NDMEITKFPVYKRARNGIGYLAQEASIFRKMTVEDNIRSVLEMTGRSIEYQKEKLESLIS 127

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF + K R  L   LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  L
Sbjct: 128 EFGLNKVRKNLGDQLSGGERRRAEIARCLAIDPKFIMLDEPFAGVDPIAVQDIQTIVARL 187

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             + IGILITDHNV+E L++ DRAY++  G VL  GT +++ +N+ VR  YLG  F  
Sbjct: 188 KHKNIGILITDHNVYETLSICDRAYLLFEGKVLFQGTAEQLAENEIVREKYLGKDFVL 245


>gi|92114347|ref|YP_574275.1| ABC transporter related [Chromohalobacter salexigens DSM 3043]
 gi|91797437|gb|ABE59576.1| ABC transporter related protein [Chromohalobacter salexigens DSM
           3043]
          Length = 259

 Score =  251 bits (641), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 125/236 (52%), Positives = 166/236 (70%), Gaps = 1/236 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LSA +L K Y    VV  + L ++ G IVGLLGPNGAGKTT FYM+ GL+ AD+GS+ ID
Sbjct: 22  LSAANLAKSYKGRRVVHDISLTIRQGSIVGLLGPNGAGKTTSFYMIVGLVGADAGSVHID 81

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
             ++++  M+ RAR GI YLPQEASIFR L+V +NI+A+LE     DK  R ++L+ LL+
Sbjct: 82  ERNLSRAAMHERARAGIGYLPQEASIFRKLSVADNIMAILETRRDLDKAARKDRLERLLE 141

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF++T  R      LSGG+RRR+EIAR+L + P++ILLDEPFAGVDP+++ +I  +IR L
Sbjct: 142 EFHVTHIRDNPGMSLSGGERRRVEIARALATEPAFILLDEPFAGVDPISVGEIKGIIRQL 201

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             R IG+LITDHNV E L + D AYI+  G ++A G    I+ NQ VR +YLG  F
Sbjct: 202 RDRDIGVLITDHNVRETLDICDNAYIVGDGQIIAEGHADAILANQKVRDVYLGHEF 257


>gi|153809064|ref|ZP_01961732.1| hypothetical protein BACCAC_03372 [Bacteroides caccae ATCC 43185]
 gi|149128397|gb|EDM19616.1| hypothetical protein BACCAC_03372 [Bacteroides caccae ATCC 43185]
          Length = 253

 Score =  251 bits (641), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 162/238 (68%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L    L KKY    VV  V + VK GEIVGLLGPNGAGKTT FYM  GLI  + G I +
Sbjct: 7   VLRTEDLVKKYGKRTVVSHVSIDVKQGEIVGLLGPNGAGKTTSFYMTVGLITPNEGRIFL 66

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           D  +ITK P+Y+RA+ GI YL QEAS+FR ++VE+NI +VLE+  K K+ + EKL+SL+ 
Sbjct: 67  DDLEITKYPVYKRAQTGIGYLAQEASVFRQMSVEDNIASVLEMTNKPKEYQKEKLESLIA 126

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF + K R      LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  L
Sbjct: 127 EFRLQKVRKNKGNQLSGGERRRTEIARCLAIDPKFIMLDEPFAGVDPIAVEDIQQIVWKL 186

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             R IGILITDHNV E L++ DRAY++  G +L  GT +E+ +NQ VR  YL + F  
Sbjct: 187 KDRNIGILITDHNVQETLSITDRAYLLFEGKILFQGTPEELSENQIVREKYLSNSFVL 244


>gi|90408214|ref|ZP_01216381.1| ABC transporter, ATP-binding protein [Psychromonas sp. CNPT3]
 gi|90310660|gb|EAS38778.1| ABC transporter, ATP-binding protein [Psychromonas sp. CNPT3]
          Length = 241

 Score =  251 bits (641), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 163/238 (68%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y    VV GV+L VK GEIVGLLGPNGAGKTT FYM+ GL+  D G I ID
Sbjct: 4   LIATGLVKSYKGRTVVNGVNLTVKTGEIVGLLGPNGAGKTTSFYMVVGLVKQDEGKICID 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
             DI+  PM+ RA+ GI YLPQEASIFR LTV ENI+ +L+  +     +R EKL++LL 
Sbjct: 64  DEDISHQPMHIRAQKGIGYLPQEASIFRRLTVTENIMGILQTRKNLTSAQRTEKLNALLN 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           +FNI   +      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I  L
Sbjct: 124 DFNINHIKDNKGMSLSGGERRRVEIARALATDPKFILLDEPFAGVDPISVLDIKKIIEQL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             RG+G+LITDHNV E L +   +YI+  G ++A GT +EI+ N  V+ +YLGD F  
Sbjct: 184 RDRGLGVLITDHNVRETLDVCQHSYIVSHGEIIAIGTQEEILSNAKVKEVYLGDAFKL 241


>gi|297537426|ref|YP_003673195.1| ABC transporter-like protein [Methylotenera sp. 301]
 gi|297256773|gb|ADI28618.1| ABC transporter related protein [Methylotenera sp. 301]
          Length = 240

 Score =  251 bits (641), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 170/231 (73%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           +L K Y +  VV+ + L +K GE+VGLLGPNGAGKTT FYM+ GL+  D G I +DG D+
Sbjct: 8   NLRKSYKTRTVVQDISLSIKSGEVVGLLGPNGAGKTTSFYMIVGLVALDGGRITLDGKDL 67

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           ++MP++ RAR+G+SYLPQE SIFR LTV ENILAVLE+ +  +    EKL+SLL+E +IT
Sbjct: 68  SRMPIHMRARMGLSYLPQEPSIFRKLTVSENILAVLELQDMSEDAMDEKLESLLEELHIT 127

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             R   A  LSGG+RRR+EIAR L S PS+ILLDEPFAG+DP+A+ DI  +I  L +R I
Sbjct: 128 HIRDSAAVSLSGGERRRVEIARCLASNPSFILLDEPFAGIDPIAVIDIQKIIHFLTARNI 187

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           G+LITDHNV E L + DRAYI++ G V A G   EI++N+ VR +YLG  F
Sbjct: 188 GVLITDHNVRETLGICDRAYIVNQGHVFASGHPSEIVENERVREVYLGKDF 238


>gi|157963429|ref|YP_001503463.1| ABC transporter-like protein [Shewanella pealeana ATCC 700345]
 gi|157848429|gb|ABV88928.1| ABC transporter related [Shewanella pealeana ATCC 700345]
          Length = 243

 Score =  251 bits (641), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 132/236 (55%), Positives = 175/236 (74%), Gaps = 1/236 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L K Y +  VV+ V L VK G+IVGLLGPNGAGKTT FYM+ GL+ +D G I ID
Sbjct: 6   LKAANLAKSYKNRAVVQDVSLTVKTGQIVGLLGPNGAGKTTTFYMVVGLVQSDKGKIFID 65

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSLLK 144
            +D+T  PM+ RAR GI YLPQEASIFR L+V +NI+AVL+  ++ + ++R E+L+ LL+
Sbjct: 66  DDDLTLDPMHLRARKGIGYLPQEASIFRKLSVRDNIMAVLQTRHDINNEQREEQLEHLLE 125

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+IT  R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I  L
Sbjct: 126 EFHITHIRDSQGMALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIEQL 185

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            SRG+G+LITDHNV E L + + AYI+  G ++A GT  EI+DNQ VR +YLG++F
Sbjct: 186 KSRGLGVLITDHNVRETLDVCEHAYIVSHGNLIAEGTPAEILDNQQVRAVYLGEQF 241


>gi|304413066|ref|ZP_07394539.1| putative transporter subunit: ATP-binding component of ABC
           superfamily [Candidatus Regiella insecticola LSR1]
 gi|304283909|gb|EFL92302.1| putative transporter subunit: ATP-binding component of ABC
           superfamily [Candidatus Regiella insecticola LSR1]
          Length = 258

 Score =  251 bits (641), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 125/242 (51%), Positives = 172/242 (71%), Gaps = 1/242 (0%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A+  + L    L K Y    VV+ V L V  GEIVGLLGPNGAGKTT FYM+ G++  D+
Sbjct: 15  ATTMASLIVTKLAKAYKGRKVVEEVSLTVNSGEIVGLLGPNGAGKTTTFYMIVGIVARDA 74

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD-KKKRHEK 138
           G I +D  DI+ +P++ RAR GI YLPQEASIFRGL+V  N++AVLE+ +    ++R E+
Sbjct: 75  GCILLDEEDISLLPLHERARRGIGYLPQEASIFRGLSVYHNLMAVLEIRQDLLAQQRTER 134

Query: 139 LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIH 198
              L++EF+I      L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI 
Sbjct: 135 AKELMEEFHIAHLHDNLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIK 194

Query: 199 VLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGD 258
            +I+ L  RG+G+LITDHNV E L + +RAYI++ G ++A GT QEI+ ++ V+R+YLG+
Sbjct: 195 KIIKHLRGRGLGVLITDHNVRETLDVCERAYIVNRGHLIAQGTPQEILADEQVKRVYLGE 254

Query: 259 RF 260
            F
Sbjct: 255 EF 256


>gi|117620537|ref|YP_858363.1| ABC transporter, ATP-binding protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117561944|gb|ABK38892.1| ABC transporter, ATP-binding protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 241

 Score =  251 bits (641), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 124/240 (51%), Positives = 172/240 (71%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K Y    VV  V L V  G+IVGLLGPNGAGKTT FYM+ GL+ +D+G I 
Sbjct: 2   AVLKAAGLQKSYKRRMVVSDVSLEVGTGQIVGLLGPNGAGKTTSFYMIVGLVQSDAGLIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+  PM+ RAR GI YLPQEASIFR L+V +N++ V++  +   +++R +K+  L
Sbjct: 62  IDDQDISLQPMHIRARNGIGYLPQEASIFRRLSVFDNLMGVMQTRKGLSREEREDKVQQL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EFNIT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I+
Sbjct: 122 LEEFNITHIRDSLGQSLSGGERRRVEIARALAAEPRFILLDEPFAGVDPISVIDIKKIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L  RG+G+LITDHNV E L + ++AYI+  G ++A G   +I+ ++ V+R+YLGD+F+ 
Sbjct: 182 HLKDRGLGVLITDHNVRETLDVCEKAYIVSHGKMIAEGAPADILADEQVKRVYLGDQFSL 241


>gi|255014834|ref|ZP_05286960.1| ABC transporter ATP-binding protein [Bacteroides sp. 2_1_7]
          Length = 244

 Score =  251 bits (640), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 164/238 (68%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L    L KKY +  VV  V + VK GEIVGLLGPNGAGKTT FYM  GL+  + G I +
Sbjct: 2   VLRTEDLVKKYRTRTVVNHVSINVKQGEIVGLLGPNGAGKTTTFYMTVGLVTPNEGKIFL 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           +  +ITK P+Y+RAR GI YL QEASIFR +TVE+NI +VLE+  +  + + EKL+SL+ 
Sbjct: 62  NDMEITKFPVYKRARNGIGYLAQEASIFRKMTVEDNIRSVLEMTGRSIEYQKEKLESLIS 121

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF + K R  L   LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  L
Sbjct: 122 EFGLNKVRKNLGDQLSGGERRRAEIARCLAIDPKFIMLDEPFAGVDPIAVQDIQTIVARL 181

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             + IGILITDHNV+E L++ DRAY++  G VL  GT +++ +N+ VR  YLG  F  
Sbjct: 182 KHKNIGILITDHNVYETLSICDRAYLLFEGKVLFQGTAEQLAENEIVREKYLGKDFVL 239


>gi|189911130|ref|YP_001962685.1| ABC transporter ATP-binding protein [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167775806|gb|ABZ94107.1| ATP-binding protein of an ABC transporter complex [Leptospira
           biflexa serovar Patoc strain 'Patoc 1 (Ames)']
          Length = 257

 Score =  251 bits (640), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 125/233 (53%), Positives = 160/233 (68%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           +L K YN   VV GV  Y+K GEIVGLLGPNGAGKTT FYM  G +  D G + ID  D+
Sbjct: 25  NLVKIYNKRKVVDGVSFYIKKGEIVGLLGPNGAGKTTSFYMSVGFVTPDEGHVFIDNEDL 84

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           TK PM+ RAR+G+ YL QEASIFR LTV EN+ A+LE       +   + D LL E  I 
Sbjct: 85  TKSPMHIRARMGVGYLAQEASIFRKLTVAENLEAILETMNLPGDEIIRRRDELLMELQIM 144

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
           +  +     LSGG+RRR EIAR+LV+ P +ILLDEPFAGVDP+A+ DI  +I+ L  RG+
Sbjct: 145 RVANQKGYTLSGGERRRCEIARALVTNPDFILLDEPFAGVDPIAVKDIQNVIQSLKERGL 204

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           GILITDHNV E L + DRAYI+++G +L  GT  ++I++ + RR+YLG+ F  
Sbjct: 205 GILITDHNVRETLKITDRAYIMYSGRILISGTADDLINDPETRRIYLGEDFKL 257


>gi|121592780|ref|YP_984676.1| ABC transporter-like protein [Acidovorax sp. JS42]
 gi|120604860|gb|ABM40600.1| ABC transporter related protein [Acidovorax sp. JS42]
          Length = 255

 Score =  251 bits (640), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 174/244 (71%), Gaps = 8/244 (3%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A  L K Y S  VVK V + V+ GE+VGLLGPNGAGKTT FYM+ GL+ +D G I 
Sbjct: 11  SRLEALHLEKSYGSRKVVKDVSVVVQKGEVVGLLGPNGAGKTTSFYMIVGLVRSDGGRIS 70

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR-------H 136
           IDG D+T MP++RR+RLG+SYLPQEASIFR L VE+N+ AVLE+ + D+  R        
Sbjct: 71  IDGQDVTDMPIHRRSRLGLSYLPQEASIFRKLNVEDNVRAVLEL-QTDEAGRSLPRAEVE 129

Query: 137 EKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISD 196
            +L +LL+E  +   R   A  LSGG+RRR+EIAR+L + P +ILLDEPFAG+DP+A+ +
Sbjct: 130 RRLTALLQELRVDHLRKSPALALSGGERRRVEIARALATQPRFILLDEPFAGIDPIAVIE 189

Query: 197 IHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYL 256
           I  +I  L +RGIG+LITDHNV E L + D A+II  G VLA GT  +I+DN +VRR+YL
Sbjct: 190 IQRIIGFLKARGIGVLITDHNVRETLGICDHAFIISDGQVLAQGTPSDIVDNAEVRRVYL 249

Query: 257 GDRF 260
           G+ F
Sbjct: 250 GEHF 253


>gi|313207181|ref|YP_004046358.1| ABC transporter related protein [Riemerella anatipestifer DSM
           15868]
 gi|312446497|gb|ADQ82852.1| ABC transporter related protein [Riemerella anatipestifer DSM
           15868]
 gi|315022418|gb|EFT35445.1| ABC transporter ATP-binding protein [Riemerella anatipestifer
           RA-YM]
 gi|325335380|gb|ADZ11654.1| ABC-type (unclassified) transport system, ATPase component
           [Riemerella anatipestifer RA-GD]
          Length = 242

 Score =  251 bits (640), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 122/238 (51%), Positives = 169/238 (71%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L   +L K+Y    VVKGV + VK GEIVGLLGPNGAGKTT FYM+ GL+    G+I +
Sbjct: 2   ILRGDNLIKEYGPKKVVKGVSIEVKQGEIVGLLGPNGAGKTTTFYMIVGLVKPTQGNIFL 61

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           D  +ITK  MYRRA+ GI YL QEAS+FR L+VE+NI+ VL++ +  KK++  K D+L++
Sbjct: 62  DQQNITKDAMYRRAQKGIGYLAQEASVFRKLSVEDNIMGVLQLTKLSKKEQRLKCDALIE 121

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF++   R     LLSGG+RRR EIAR L + P++ILLDEPFAGVDP+A+ DI  ++R L
Sbjct: 122 EFSLEHVRKNRGDLLSGGERRRTEIARCLATSPNFILLDEPFAGVDPIAVEDIQKIVRSL 181

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             + IGILITDHNV + L + ++ YI+  G +L  G  +++ ++ +VR+ YLG+ F F
Sbjct: 182 VEKNIGILITDHNVQQTLAITNKTYIMFEGKILKEGLPEDLANDPEVRQAYLGENFRF 239


>gi|295097688|emb|CBK86778.1| ABC-type (unclassified) transport system, ATPase component
           [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 241

 Score =  251 bits (640), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 123/238 (51%), Positives = 175/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L+A +L K Y    VV+ V L V  GEIVGLLGPNGAGKTT FYM+ G++  D+G+I 
Sbjct: 2   ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNII 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V +N++AVL++ +    ++R ++ + L
Sbjct: 62  IDDEDISLLPLHARARRGIGYLPQEASIFRRLSVFDNLMAVLQIRDDLTSEQRTDRANEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+I   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 MEEFHIEHLRDSLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT Q+I++++ V+R+YLG+ F
Sbjct: 182 HLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPQQILEDEHVKRVYLGEDF 239


>gi|319786672|ref|YP_004146147.1| ABC transporter [Pseudoxanthomonas suwonensis 11-1]
 gi|317465184|gb|ADV26916.1| ABC transporter related protein [Pseudoxanthomonas suwonensis 11-1]
          Length = 240

 Score =  251 bits (640), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 162/238 (68%), Gaps = 2/238 (0%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A  L KKY    VV+   L +  GE+VGLLGPNGAGKTT FYM+ GL+ AD+G I +
Sbjct: 1   MLVAEGLRKKYKQREVVREFGLTLDAGEVVGLLGPNGAGKTTCFYMIVGLVAADAGRIVL 60

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYE--KDKKKRHEKLDSL 142
           DG DIT  PMY RARLG+ YLPQE S+FR LTV +NI  VLE+ E  +D+     +L SL
Sbjct: 61  DGRDITAEPMYTRARLGVGYLPQEPSVFRKLTVADNIRLVLELREDLEDEDALEAELSSL 120

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L E  I      L   LSGG+RRR EIAR+L + P  +LLDEPFAGVDP+++ +I  ++ 
Sbjct: 121 LDELQIGHVADQLGASLSGGERRRCEIARALAAKPRLMLLDEPFAGVDPISVGEIQRIVT 180

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L +RGIG+LITDHNV E L + DRAYI+  G VLA G    ++ N DVRR+YLG+ F
Sbjct: 181 HLKNRGIGVLITDHNVRETLGICDRAYILAEGSVLAQGAPDALLANPDVRRVYLGETF 238


>gi|304310278|ref|YP_003809876.1| Putative leucine/isoleucine/valine transport system, ATP-binding
           protein [gamma proteobacterium HdN1]
 gi|301796011|emb|CBL44215.1| Putative leucine/isoleucine/valine transport system, ATP-binding
           protein [gamma proteobacterium HdN1]
          Length = 241

 Score =  251 bits (640), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 127/240 (52%), Positives = 166/240 (69%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A  L K Y    VV+ V L +  G+IVGLLGPNGAGKTT FYM+ G++  D G I 
Sbjct: 2   SRLCAMHLAKSYKGRRVVEDVSLAIDSGQIVGLLGPNGAGKTTCFYMIVGIVPQDKGHIL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DIT +PM+ RA  GI YLPQEASIFR LTV EN+LA+LE  +   + +R  K++ L
Sbjct: 62  IDDQDITYLPMHGRASRGIGYLPQEASIFRKLTVRENLLAILETRKSLSRSQRISKMEEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EF++    + L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP++++DI  +IR
Sbjct: 122 LDEFHVGHIANSLGMALSGGERRRVEIARALAADPQFILLDEPFAGVDPISVNDIKEIIR 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L  RGIG+LITDHNV E L + ++AYI+  G +LA G  +++I N  VR +YLG +F  
Sbjct: 182 HLKQRGIGVLITDHNVRETLDICEKAYIVSEGHILAEGPPEKVIANPQVREVYLGKQFQL 241


>gi|317485281|ref|ZP_07944161.1| ABC transporter [Bilophila wadsworthia 3_1_6]
 gi|316923407|gb|EFV44613.1| ABC transporter [Bilophila wadsworthia 3_1_6]
          Length = 240

 Score =  251 bits (640), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 123/237 (51%), Positives = 167/237 (70%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           LS   L K Y    VV+GV   V  GEIVGLLGPNGAGKTT FYM+TG+I   SG + ++
Sbjct: 4   LSGVDLRKWYGQREVVRGVSPEVNQGEIVGLLGPNGAGKTTSFYMLTGIIKPSSGRVLLE 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
             DI   P++ RAR+GISYLPQE+S+FR LTV +N+  +LE     +K++ E+ D LL++
Sbjct: 64  DQDIGTWPLHERARVGISYLPQESSVFRKLTVRQNLQIILEHTGLSRKEQKERADVLLED 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           F +T+     A  LSGG+RRRLEIAR+L+  P ++LLDEPFAG+DP+A+ DI  L+R L 
Sbjct: 124 FGLTRLEKSHAMHLSGGERRRLEIARALIREPKFVLLDEPFAGIDPLAVGDIQGLVRALR 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            RGIG+LI+DHNV E LT+ DRAY++  G V+  GT + I++N+  R +YLG+ F+ 
Sbjct: 184 DRGIGVLISDHNVRETLTICDRAYLMVQGQVVLSGTPETIVNNEQARSVYLGEGFSL 240


>gi|15599657|ref|NP_253151.1| ATP-binding component of ABC transporter [Pseudomonas aeruginosa
           PAO1]
 gi|107099954|ref|ZP_01363872.1| hypothetical protein PaerPA_01000975 [Pseudomonas aeruginosa PACS2]
 gi|116052493|ref|YP_792806.1| putative ATP-binding component of ABC transporter [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|218893552|ref|YP_002442421.1| putative ATP-binding component of ABC transporter [Pseudomonas
           aeruginosa LESB58]
 gi|254238877|ref|ZP_04932200.1| hypothetical protein PACG_05045 [Pseudomonas aeruginosa C3719]
 gi|254244725|ref|ZP_04938047.1| hypothetical protein PA2G_05597 [Pseudomonas aeruginosa 2192]
 gi|296391171|ref|ZP_06880646.1| putative ATP-binding component of ABC transporter [Pseudomonas
           aeruginosa PAb1]
 gi|313107046|ref|ZP_07793249.1| putative ATP-binding component of ABC transporter [Pseudomonas
           aeruginosa 39016]
 gi|9950697|gb|AAG07849.1|AE004860_5 probable ATP-binding component of ABC transporter [Pseudomonas
           aeruginosa PAO1]
 gi|115587714|gb|ABJ13729.1| putative ATP-binding component of ABC transporter [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|126170808|gb|EAZ56319.1| hypothetical protein PACG_05045 [Pseudomonas aeruginosa C3719]
 gi|126198103|gb|EAZ62166.1| hypothetical protein PA2G_05597 [Pseudomonas aeruginosa 2192]
 gi|218773780|emb|CAW29594.1| probable ATP-binding component of ABC transporter [Pseudomonas
           aeruginosa LESB58]
 gi|310879751|gb|EFQ38345.1| putative ATP-binding component of ABC transporter [Pseudomonas
           aeruginosa 39016]
          Length = 241

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 125/238 (52%), Positives = 166/238 (69%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y    VV+ V + +  G+IVGLLGPNGAGKTT FYM+ GL+ AD G ++
Sbjct: 2   ATLKAQHLAKSYKGRQVVRDVSMSIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGVVR 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  ++T +PM+ RAR GI YLPQEASIFR L+V +NI+A+LE     D+  R E L+ L
Sbjct: 62  IDEQNVTHLPMHGRARAGIGYLPQEASIFRKLSVSDNIMAILETRSDLDRNGRKEALEGL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R  L   LSGG+RRR+EIAR+L S P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHIHHIRDNLGMSLSGGERRRVEIARALASAPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIGILITDHNV E L + + AYI++ G ++A G  + I+ N  V+ +YLG  F
Sbjct: 182 HLKAKGIGILITDHNVRETLDICETAYIVNDGQLIAEGDAESILANDLVKEVYLGHEF 239


>gi|256821874|ref|YP_003145837.1| ABC transporter-like protein [Kangiella koreensis DSM 16069]
 gi|256795413|gb|ACV26069.1| ABC transporter related [Kangiella koreensis DSM 16069]
          Length = 241

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 169/236 (71%), Gaps = 1/236 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K Y    VV+ V L V  G+IVGLLGPNGAGKTT FYM+ GL+ +D G I + 
Sbjct: 4   LQARRLAKSYKERKVVENVSLEVNQGQIVGLLGPNGAGKTTSFYMIVGLVPSDGGQIFLG 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLK 144
            ++IT  PM+ RA+ G+ YLPQEASIFR L+VE+NI+A+L++ +  D K+R EKLD LL 
Sbjct: 64  EDNITTDPMHTRAKKGLGYLPQEASIFRKLSVEDNIMAILQLRKDLDSKQREEKLDQLLS 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+I   R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I  L
Sbjct: 124 EFHIEHIRLSHGMSLSGGERRRVEIARALANDPKFILLDEPFAGVDPISVLDIKTIIIQL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             RGIG+LITDHNV E L + ++AYI+ +G ++A GT  E++ N+ V++ YLG+ F
Sbjct: 184 KERGIGVLITDHNVRETLDVCEQAYIVDSGNIIASGTPAEVLTNELVKKRYLGEHF 239


>gi|198276178|ref|ZP_03208709.1| hypothetical protein BACPLE_02367 [Bacteroides plebeius DSM 17135]
 gi|198270990|gb|EDY95260.1| hypothetical protein BACPLE_02367 [Bacteroides plebeius DSM 17135]
          Length = 272

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 125/238 (52%), Positives = 163/238 (68%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L   +L KKY    VV  V + VK GEIVGLLGPNGAGKTT FYM TGLI  + G I +
Sbjct: 23  VLRTENLVKKYGKRTVVSHVSINVKQGEIVGLLGPNGAGKTTSFYMTTGLIVPNEGHIYL 82

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           +  DIT  P+Y+RA+ GI YL QEAS+FR ++VE+NI +VLE+  K  + + EKL+SL+ 
Sbjct: 83  NDKDITSYPVYKRAQNGIGYLAQEASVFRKMSVEDNIASVLELTNKSPEYQKEKLESLIA 142

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF + K R  L   LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  L
Sbjct: 143 EFRLQKVRKNLGDQLSGGERRRTEIARCLAIDPKFIMLDEPFAGVDPIAVEDIQHIVWKL 202

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             + IGILITDHNV E L++ DRAY++  G +L  GT +E+ +N+ VR  YL + F  
Sbjct: 203 KDKNIGILITDHNVQETLSITDRAYLLFEGKILFQGTPEELAENKIVREKYLSNSFVL 260


>gi|77457085|ref|YP_346590.1| ABC transporter-like [Pseudomonas fluorescens Pf0-1]
 gi|77381088|gb|ABA72601.1| putative ABC transport system, ATP-binding protein [Pseudomonas
           fluorescens Pf0-1]
          Length = 241

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 169/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y S  VV+ V L +  G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   ATLKAQHLAKAYKSRQVVRDVSLSIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID  D++  PM+ RA+ GI YLPQEASIFR L+V +NI+A+LE   E DK  R ++L+SL
Sbjct: 62  IDDLDVSHQPMHGRAKAGIGYLPQEASIFRKLSVADNIMAILETRQELDKAGRRKELESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I+  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHISHIRDNLGMSLSGGERRRVEIARALATAPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIG+LITDHNV E L + + AYI++ G ++A G  + I+ N  V+ +YLG  F
Sbjct: 182 HLKAKGIGVLITDHNVRETLDICETAYIVNDGQLIAEGDSETILANNLVKEVYLGHEF 239


>gi|291279434|ref|YP_003496269.1| ABC transporter ATP-binding protein [Deferribacter desulfuricans
           SSM1]
 gi|290754136|dbj|BAI80513.1| ABC transporter, ATP-binding protein [Deferribacter desulfuricans
           SSM1]
          Length = 238

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 123/237 (51%), Positives = 164/237 (69%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L A +L K+Y   YVV GV L +  GE+VGLLGPNGAGKTT FYM+ G+I +D G I  
Sbjct: 1   MLEAKNLKKRYKKRYVVDGVSLELSKGEVVGLLGPNGAGKTTTFYMIVGIIKSDGGEIYY 60

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
            G +IT +P+Y+RA LGI YLPQE S+FR LTV ENI A +E   KDKK   E+ + L++
Sbjct: 61  KGENITGLPIYKRASLGIGYLPQEISVFRKLTVYENIYAAMEFKFKDKKIIEERTERLIE 120

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF +   R  +   LSGG++RR+EIAR L   P  ILLDEPFAG+DP+++ +I  +I  L
Sbjct: 121 EFGLNHVRDTIGYALSGGEKRRVEIARCLSIEPEIILLDEPFAGIDPISVQEIQKMIERL 180

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
              GIGILITDHNV E L + DRAYI++ G +L HG   +II+++ V++ YLG+ + 
Sbjct: 181 KKMGIGILITDHNVRETLQITDRAYIMYQGKILTHGDPDKIINDEKVKKTYLGEGYT 237


>gi|317046697|ref|YP_004114345.1| ABC transporter-like protein [Pantoea sp. At-9b]
 gi|316948314|gb|ADU67789.1| ABC transporter related protein [Pantoea sp. At-9b]
          Length = 241

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 123/238 (51%), Positives = 173/238 (72%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A +L K Y    VV+ V L VK GEIVGLLGPNGAGKTT FYM+ G++  D+G I 
Sbjct: 2   ATLIAENLAKAYKGRRVVEDVSLQVKSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGRIV 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V +N++AVL++ +   +++R ++ + L
Sbjct: 62  IDDEDISILPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLTEEQRQDRANEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+I   R  +   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 MEEFHIEHLRDSMGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT  EI+ ++ V+R+YLG+ F
Sbjct: 182 HLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPDEILADEQVKRVYLGEEF 239


>gi|73540062|ref|YP_294582.1| ABC transporter related [Ralstonia eutropha JMP134]
 gi|72117475|gb|AAZ59738.1| ABC transporter related [Ralstonia eutropha JMP134]
          Length = 266

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 170/245 (69%), Gaps = 5/245 (2%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
           ++ S +    L K+Y +  VVK V L VK GE+VGLLGPNGAGKTT FYM+ GL+  D G
Sbjct: 20  AESSTMVVRHLKKRYGTRTVVKDVSLDVKSGEVVGLLGPNGAGKTTSFYMIVGLVALDEG 79

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKD-----KKKR 135
            I +DG  I+ + ++ RAR+G+SYLPQEAS+FR L VEENI AVLE+   +     K + 
Sbjct: 80  DIVLDGQHISGLAIHERARMGLSYLPQEASVFRKLNVEENIRAVLELQVVNGKPLPKAEI 139

Query: 136 HEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAIS 195
             +LD+LL +  I   R+  A  LSGG+RRR+EIAR+L S P +ILLDEPFAGVDP+A+ 
Sbjct: 140 DARLDTLLDDLQIAHLRNNPALSLSGGERRRVEIARALASSPRFILLDEPFAGVDPIAVG 199

Query: 196 DIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLY 255
           +I  ++  L +R IG+LITDHNV E L + D AYII  G VLA G  ++II N+ VRR+Y
Sbjct: 200 EIQRIVSFLKARNIGVLITDHNVRETLGICDHAYIISEGTVLAAGQPEDIIANESVRRVY 259

Query: 256 LGDRF 260
           LG+ F
Sbjct: 260 LGENF 264


>gi|160882381|ref|ZP_02063384.1| hypothetical protein BACOVA_00330 [Bacteroides ovatus ATCC 8483]
 gi|237719053|ref|ZP_04549534.1| ABC transporter ATP-binding protein [Bacteroides sp. 2_2_4]
 gi|260172012|ref|ZP_05758424.1| ABC transporter ATP-binding protein [Bacteroides sp. D2]
 gi|299148137|ref|ZP_07041199.1| ABC transporter, ATP-binding protein [Bacteroides sp. 3_1_23]
 gi|315920325|ref|ZP_07916565.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|156112194|gb|EDO13939.1| hypothetical protein BACOVA_00330 [Bacteroides ovatus ATCC 8483]
 gi|229451432|gb|EEO57223.1| ABC transporter ATP-binding protein [Bacteroides sp. 2_2_4]
 gi|298512898|gb|EFI36785.1| ABC transporter, ATP-binding protein [Bacteroides sp. 3_1_23]
 gi|313694200|gb|EFS31035.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 253

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 162/238 (68%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L    L KKY    VV  V + VK GEIVGLLGPNGAGKTT FYM  GLI  + G I +
Sbjct: 7   VLRTEDLVKKYGKRTVVSHVSINVKQGEIVGLLGPNGAGKTTSFYMTVGLITPNEGRIFL 66

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           D  +ITK P+Y+RA+ GI YL QEAS+FR ++VE+NI +VLE+  K K+ + EKL+SL+ 
Sbjct: 67  DDLEITKYPVYKRAQTGIGYLAQEASVFRQMSVEDNIASVLEMTNKPKEYQKEKLESLIA 126

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF + K R      LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  L
Sbjct: 127 EFRLQKVRKNKGNQLSGGERRRTEIARCLAIDPKFIMLDEPFAGVDPIAVEDIQQIVWKL 186

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             + IGILITDHNV E L++ DRAY++  G +L  GT +E+ +NQ VR  YL + F  
Sbjct: 187 KDKNIGILITDHNVQETLSITDRAYLLFEGKILFQGTPEELSENQIVREKYLSNSFVL 244


>gi|222109556|ref|YP_002551820.1| ABC transporter-like protein [Acidovorax ebreus TPSY]
 gi|221729000|gb|ACM31820.1| ABC transporter related [Acidovorax ebreus TPSY]
          Length = 250

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 174/244 (71%), Gaps = 8/244 (3%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A  L K Y S  VVK V + V+ GE+VGLLGPNGAGKTT FYM+ GL+ +D G I 
Sbjct: 6   SRLEALHLEKSYGSRKVVKDVSVVVQKGEVVGLLGPNGAGKTTSFYMIVGLVRSDGGRIS 65

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR-------H 136
           IDG D+T MP++RR+RLG+SYLPQEASIFR L VE+N+ AVLE+ + D+  R        
Sbjct: 66  IDGQDVTDMPIHRRSRLGLSYLPQEASIFRKLNVEDNVRAVLEL-QTDEAGRSLPRAEVE 124

Query: 137 EKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISD 196
            +L +LL+E  +   R   A  LSGG+RRR+EIAR+L + P +ILLDEPFAG+DP+A+ +
Sbjct: 125 RRLTALLQELRVDHLRKSPALALSGGERRRVEIARALATQPRFILLDEPFAGIDPIAVIE 184

Query: 197 IHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYL 256
           I  +I  L +RGIG+LITDHNV E L + D A+II  G VLA GT  +I+DN +VRR+YL
Sbjct: 185 IQRIIGFLKARGIGVLITDHNVRETLGICDHAFIISDGQVLAQGTPSDIVDNAEVRRVYL 244

Query: 257 GDRF 260
           G+ F
Sbjct: 245 GEHF 248


>gi|330501873|ref|YP_004378742.1| ABC transporter-like protein [Pseudomonas mendocina NK-01]
 gi|328916159|gb|AEB56990.1| ABC transporter related protein [Pseudomonas mendocina NK-01]
          Length = 241

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 125/238 (52%), Positives = 169/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K Y S  VV+ V L ++ G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   AILKAQHLAKSYKSRQVVRDVSLSIESGQIVGLLGPNGAGKTTCFYMIVGLVRADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  D++  PM+ RAR GI YLPQEASIFR L+V +NI+A+LE  +  D+  R  +L++L
Sbjct: 62  IDDLDVSHQPMHGRARAGIGYLPQEASIFRKLSVADNIMAILETRKDLDRAGRQAELENL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I      L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHIHHIADSLGMSLSGGERRRVEIARALATNPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIGILITDHNV E L + + AYI++ G ++A G  + I+ NQ V+ +YLG  F
Sbjct: 182 HLKTKGIGILITDHNVRETLDICETAYIVNDGQLIAEGDAETILANQTVKEVYLGHEF 239


>gi|325982707|ref|YP_004295109.1| Sulfate-transporting ATPase [Nitrosomonas sp. AL212]
 gi|325532226|gb|ADZ26947.1| Sulfate-transporting ATPase [Nitrosomonas sp. AL212]
          Length = 240

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 134/237 (56%), Positives = 171/237 (72%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L A +L K+Y S  VV+ V   +  GE++GLLGPNGAGKTT FYM+ GL+  D G I 
Sbjct: 2   SELKANNLKKRYKSRTVVEDVSFSLSSGEVIGLLGPNGAGKTTCFYMIVGLLPLDGGGIY 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +D  D++ + +++RA+LG+SYLPQEASIFR LTVEENILAVLE+   D+  +   LD LL
Sbjct: 62  LDDQDLSLLQIHQRAKLGLSYLPQEASIFRRLTVEENILAVLELQSLDEDAKQRHLDDLL 121

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            + +I+  R+  A  LSGG+RRR+EIAR+L S P +ILLDEPFAGVDP+A+ DI  +I  
Sbjct: 122 HDLHISHLRNNPAISLSGGERRRVEIARALASQPRFILLDEPFAGVDPIAVLDIQKVIAF 181

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L  R IG+LITDHNV E L + DRAYII  G VLA G  +EIIDN+ VR +YLG+ F
Sbjct: 182 LKERKIGVLITDHNVRETLGICDRAYIISEGHVLAKGRSEEIIDNEKVREVYLGEHF 238


>gi|319790123|ref|YP_004151756.1| ABC transporter related protein [Thermovibrio ammonificans HB-1]
 gi|317114625|gb|ADU97115.1| ABC transporter related protein [Thermovibrio ammonificans HB-1]
          Length = 248

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 129/239 (53%), Positives = 163/239 (68%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  +TK+Y    VV  V + V  GE+VGLLGPNGAGKTT FY + GL+  D G + 
Sbjct: 10  NCLRAERITKRYGKKTVVDNVTVEVMEGEVVGLLGPNGAGKTTTFYCIVGLVKPDGGRVL 69

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           I   D+T++P Y RA  G+SYLPQE S+FR LTVE+NI AVLE++   K +  EK DSLL
Sbjct: 70  IGEEDVTELPTYERALKGLSYLPQEPSVFRKLTVEDNIKAVLEMHGYSKGEIEEKTDSLL 129

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
             F I   R   A  LSGG+RRRLEIAR+L   P ++LLDEPFAG+DP+A+SDI  LI++
Sbjct: 130 NRFGIAHLRKQKAASLSGGERRRLEIARALTINPKFLLLDEPFAGIDPIAVSDIQGLIKE 189

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L    IGILITDHNV E L +IDRAYII  G V+A G   E+ + + VR +YLG+ F+ 
Sbjct: 190 LKEMDIGILITDHNVRETLKIIDRAYIIAHGKVIASGKPHEVANQELVREIYLGEDFSL 248


>gi|167625609|ref|YP_001675903.1| ABC transporter-like protein [Shewanella halifaxensis HAW-EB4]
 gi|167355631|gb|ABZ78244.1| ABC transporter related [Shewanella halifaxensis HAW-EB4]
          Length = 243

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 176/240 (73%), Gaps = 1/240 (0%)

Query: 22  KDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGS 81
           K   L A +L K Y +  VV+ V L VK G+IVGLLGPNGAGKTT FYM+ GL+ +D G 
Sbjct: 2   KQITLRAVNLAKSYKNRAVVQDVSLTVKTGQIVGLLGPNGAGKTTTFYMVVGLVQSDKGK 61

Query: 82  IKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLD 140
           I ID +D+T  PM+ RAR GI YLPQEASIFR L+V +NI+AVL+  ++ + ++R E+L+
Sbjct: 62  IFIDDDDLTLDPMHLRARKGIGYLPQEASIFRKLSVRDNIMAVLQTRHDINNEQREEQLE 121

Query: 141 SLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVL 200
            LL+EF+IT  R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +
Sbjct: 122 HLLEEFHITHIRDSQGMALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKI 181

Query: 201 IRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           I  L SRG+G+LITDHNV E L + + AYI+  G ++A GT  EI+DNQ VR +YLG++F
Sbjct: 182 IEQLKSRGLGVLITDHNVRETLDVCEHAYIVSHGNLIAEGTPAEILDNQQVRAVYLGEQF 241


>gi|322434794|ref|YP_004217006.1| ABC transporter related protein [Acidobacterium sp. MP5ACTX9]
 gi|321162521|gb|ADW68226.1| ABC transporter related protein [Acidobacterium sp. MP5ACTX9]
          Length = 242

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 128/239 (53%), Positives = 167/239 (69%), Gaps = 1/239 (0%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +LS   + K Y    VV+GV L +  GE+VGLLGPNGAGKTT FYM+ GL+  D+G +  
Sbjct: 3   VLSTEEIGKSYGGREVVRGVSLSISQGEVVGLLGPNGAGKTTSFYMIVGLVRPDAGRVLA 62

Query: 85  DGNDITKMPMYRRARLG-ISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           DG DIT++PMY RAR   ISYLPQE S+FR LTVEENILAVLEV     + R  + + L+
Sbjct: 63  DGVDITRLPMYLRARQHRISYLPQEPSVFRKLTVEENILAVLEVQNLSWELRRTRTERLI 122

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           ++ N+   R      LSGG+RRR+EIAR L   P++ILLDEPFAG+DP+A+ D+  +I  
Sbjct: 123 EQLNLGHVRKTRGYALSGGERRRVEIARCLCIEPAFILLDEPFAGIDPIAVLDLQEIIFG 182

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L + GIG+LITDH V E L++ DRAYII+ G + A GT  E+  N +VRR+YLGD+F+ 
Sbjct: 183 LKASGIGVLITDHQVKETLSVTDRAYIINEGKIFATGTPGELGRNPEVRRVYLGDKFSM 241


>gi|237798599|ref|ZP_04587060.1| ABC transporter ATP-binding protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331021452|gb|EGI01509.1| ABC transporter ATP-binding protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 241

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 168/238 (70%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y    VV+ V + +  G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   ATLKAQHLAKSYKGRQVVRDVSISIDSGQIVGLLGPNGAGKTTCFYMIVGLVRADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           ID  D++  PM+ RAR GI YLPQEASIFR L+V +NI+A+LE   E D   R ++L+SL
Sbjct: 62  IDDLDVSHQPMHGRARAGIGYLPQEASIFRKLSVSDNIMAILETRKELDAGARRKELESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+IT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHITHIRDNLGMSLSGGERRRVEIARALATAPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIG+LITDHNV E L + + AYI++ G ++A G  + I+ NQ V+ +YLG  F
Sbjct: 182 HLKAKGIGVLITDHNVRETLDICETAYIVNDGQLIAEGDSETILANQLVKEVYLGHEF 239


>gi|261342646|ref|ZP_05970504.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Enterobacter cancerogenus ATCC 35316]
 gi|288315294|gb|EFC54232.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Enterobacter cancerogenus ATCC 35316]
          Length = 241

 Score =  250 bits (638), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 123/238 (51%), Positives = 174/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L+A +L K Y    VV+ V L V  GEIVGLLGPNGAGKTT FYM+ G++  D+G+I 
Sbjct: 2   ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNII 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V +N++AVL++ +    ++R ++ + L
Sbjct: 62  IDDEDISLLPLHARARRGIGYLPQEASIFRRLSVFDNLMAVLQIRDDLTSEQRTDRANEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+I   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 MEEFHIEHLRDSLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT Q+I+ ++ V+R+YLG+ F
Sbjct: 182 HLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPQQILQDEHVKRVYLGEDF 239


>gi|330807555|ref|YP_004352017.1| ABC transporter ATP-binding protein [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327375663|gb|AEA67013.1| putative ABC transporter, ATP-binding component [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 241

 Score =  250 bits (638), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 168/238 (70%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y S  VV+ V L +  G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   ATLKAQHLAKSYKSRQVVRDVSLSIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSL 142
           ID  D++  PM+ RA+ GI YLPQEASIFR L+V +NI+A+LE   E DK  R ++L+SL
Sbjct: 62  IDDVDVSHQPMHGRAKAGIGYLPQEASIFRKLSVADNIMAILETRKELDKAGRRQELESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I+  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHISHIRDNLGMSLSGGERRRVEIARALATAPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIG+LITDHNV E L + + AYI++ G ++A G    I+ N  V+ +YLG  F
Sbjct: 182 HLKAKGIGVLITDHNVRETLDICETAYIVNDGQLIAEGDSAAILANDLVKEVYLGHEF 239


>gi|57242594|ref|ZP_00370531.1| ABC transporter, ATP-binding protein [Campylobacter upsaliensis
           RM3195]
 gi|57016523|gb|EAL53307.1| ABC transporter, ATP-binding protein [Campylobacter upsaliensis
           RM3195]
          Length = 242

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 122/239 (51%), Positives = 164/239 (68%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L    L K      ++  + L ++ GE+VGLLGPNGAGKTT FYM+ GLI    G +K
Sbjct: 2   SKLEVLHLEKVIKKTKIIHDISLEIQSGEVVGLLGPNGAGKTTTFYMICGLITPSGGQVK 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           ++G DITK P+ +RAR GI YLPQE+S+F+ L+VE+N+L   E++ KDKK  +EK++ +L
Sbjct: 62  LNGTDITKEPLNKRARQGIGYLPQESSVFKDLSVEDNLLLAAEIFHKDKKILNEKVEKML 121

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +  +I   R      LSGG+RRR EIARSL+  P ++LLDEPFAGVDP+A+++I  LI++
Sbjct: 122 ELLSIEPIRLRKGLSLSGGERRRCEIARSLMCEPKFLLLDEPFAGVDPIAVAEIQNLIKE 181

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L    IGILITDHNV E L + DRAY+I  G +LA G  +EI  NQDV++ YLG  F  
Sbjct: 182 LKRLDIGILITDHNVRETLAICDRAYVIKQGTLLASGNAKEIAHNQDVKKYYLGAEFKL 240


>gi|330996069|ref|ZP_08319963.1| ABC transporter, ATP-binding protein [Paraprevotella xylaniphila
           YIT 11841]
 gi|329574066|gb|EGG55644.1| ABC transporter, ATP-binding protein [Paraprevotella xylaniphila
           YIT 11841]
          Length = 269

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 165/247 (66%), Gaps = 5/247 (2%)

Query: 21  SKDSL-----LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLI 75
           S+DSL     L    L K Y    VV  V   VK GEIVGLLGPNGAGKTT FYM TGL+
Sbjct: 6   SQDSLNAGLVLRTEGLVKTYGKRTVVNHVSFDVKQGEIVGLLGPNGAGKTTSFYMTTGLV 65

Query: 76  CADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKR 135
             + G I I   +ITK P+Y+RAR GI YL QEAS+FR +TVE+NI +VLE+  K K+ +
Sbjct: 66  VPNEGRIFIGDLEITKFPVYKRARNGIGYLAQEASVFRKMTVEDNIASVLEMTGKPKEYQ 125

Query: 136 HEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAIS 195
            EKL+SL+ EF++ K R  L   LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ 
Sbjct: 126 KEKLESLISEFSLQKVRKNLGDRLSGGERRRTEIARCLAIDPKFIMLDEPFAGVDPIAVE 185

Query: 196 DIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLY 255
           DI  ++  L  R IG+LITDHNV E L + DRAY++  G +L  G+ QE+ +N+ VR  Y
Sbjct: 186 DIQYIVWKLKKRNIGVLITDHNVEETLCITDRAYLLFEGQILFQGSPQELSENEVVRAKY 245

Query: 256 LGDRFAF 262
           L + F  
Sbjct: 246 LTNSFVL 252


>gi|261880038|ref|ZP_06006465.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Prevotella bergensis DSM
           17361]
 gi|270333278|gb|EFA44064.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Prevotella bergensis DSM
           17361]
          Length = 269

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 126/243 (51%), Positives = 165/243 (67%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           + K S L    L K+Y    V   V + V+ GEIVGLLGPNGAGKTT FYM TGL+  + 
Sbjct: 3   SEKLSTLRTEGLVKRYGERTVANEVSISVRQGEIVGLLGPNGAGKTTSFYMTTGLVVPNE 62

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKL 139
           G + ID  +ITK P+Y+RAR GI YLPQEAS+FR L+VE+NI+AVLE+ +   +++  KL
Sbjct: 63  GHVYIDDKEITKYPVYKRARAGIGYLPQEASVFRKLSVEDNIMAVLEMTDLTHEQQLAKL 122

Query: 140 DSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHV 199
           +SL+ EF + K R      LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  
Sbjct: 123 ESLIGEFRLNKVRKNKGDRLSGGERRRTEIARCLAIDPKFIMLDEPFAGVDPIAVEDIQH 182

Query: 200 LIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDR 259
           ++  L  R IGILITDHNV E L++ DRAY++  G +L  G  +E+  N+ VR+ YL D 
Sbjct: 183 IVWRLKYRNIGILITDHNVQETLSVTDRAYLLFEGRILFQGVPEELAANKIVRKNYLSDN 242

Query: 260 FAF 262
           F +
Sbjct: 243 FVY 245


>gi|49082114|gb|AAT50457.1| PA4461 [synthetic construct]
          Length = 242

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 125/238 (52%), Positives = 166/238 (69%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y    VV+ V + +  G+IVGLLGPNGAGKTT FYM+ GL+ AD G ++
Sbjct: 2   ATLKAQHLAKSYKGRQVVRDVSMSIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGVVR 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  ++T +PM+ RAR GI YLPQEASIFR L+V +NI+A+LE     D+  R E L+ L
Sbjct: 62  IDEQNVTHLPMHGRARAGIGYLPQEASIFRKLSVSDNIMAILETRSDLDRNGRKEALEGL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R  L   LSGG+RRR+EIAR+L S P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHIHHIRDNLGMSLSGGERRRVEIARALASAPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIGILITDHNV E L + + AYI++ G ++A G  + I+ N  V+ +YLG  F
Sbjct: 182 HLKAKGIGILITDHNVRETLDIRETAYIVNDGQLIAEGDAESILANDLVKEVYLGHEF 239


>gi|254447177|ref|ZP_05060644.1| ABC transporter, ATP-binding protein [gamma proteobacterium
           HTCC5015]
 gi|198263316|gb|EDY87594.1| ABC transporter, ATP-binding protein [gamma proteobacterium
           HTCC5015]
          Length = 241

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 165/238 (69%), Gaps = 1/238 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L K+Y    VV  V   V  GE+VGLLGPNGAGKTT FYMM GL+  D G I +D
Sbjct: 4   LRAQHLAKRYKKRTVVSDVSYAVSSGEVVGLLGPNGAGKTTSFYMMVGLVPCDGGQILLD 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSLLK 144
             DIT++PM++RARLG+ YLPQEASIFR LTV +N++ +L++  E    +R + L+ LL+
Sbjct: 64  DLDITQLPMHKRARLGVGYLPQEASIFRKLTVAQNLMGILQLRKELSDAEREDTLEHLLE 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           +F I   R+     LSGG+RRR+EIAR+L + P ++LLDEPFAGVDP+++ DI  +I  L
Sbjct: 124 DFQIAHIRNSDGISLSGGERRRVEIARALAADPKFVLLDEPFAGVDPISVGDIQHIITSL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             R IG+LITDHNV E L + +RAYI+  G V+A GT  +++DN  VR +YLG+ F  
Sbjct: 184 TKRDIGVLITDHNVRETLGICERAYILGNGQVIAEGTPSDVLDNPKVREIYLGEDFQL 241


>gi|300871394|ref|YP_003786267.1| ABC transporter ATP-binding protein [Brachyspira pilosicoli
           95/1000]
 gi|300689095|gb|ADK31766.1| ATP-binding protein of an ABC transporter complex [Brachyspira
           pilosicoli 95/1000]
          Length = 275

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 126/239 (52%), Positives = 169/239 (70%), Gaps = 1/239 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S + A +LTK Y    +++ +   VK GE+VGLLGPNGAGKTT FY+  G + A +G++ 
Sbjct: 36  SEIRAVNLTKFYGKRKIIENISYSVKQGEVVGLLGPNGAGKTTSFYITVGFVTATNGNVY 95

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ++  DITK+ MY+RA+LGI YLPQEASIFR L+VE+N+L++LE  +   +K R +  D L
Sbjct: 96  LNDIDITKLHMYQRAQLGIGYLPQEASIFRKLSVEDNLLSILEYNDALTQKDRMDITDRL 155

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EFNIT  R      LSGG+RRR EIAR+L   P +ILLDEPFAGVDP+A+ DI  +I 
Sbjct: 156 LEEFNITHVRKQKGYTLSGGERRRCEIARALTVNPKFILLDEPFAGVDPIAVIDIQNIIA 215

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFA 261
            L  +G+GILITDHNV E L + DRAYI+  G +L  G+ +EII N   R++YLG+ F+
Sbjct: 216 SLKEKGLGILITDHNVRETLRITDRAYIMGNGKILVQGSPEEIIANPLARKIYLGESFS 274


>gi|154174132|ref|YP_001408320.1| ABC-transporter ATP-binding protein [Campylobacter curvus 525.92]
 gi|112803177|gb|EAU00521.1| ABC-transporter ATP-binding protein [Campylobacter curvus 525.92]
          Length = 243

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 120/232 (51%), Positives = 165/232 (71%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K      ++KG+ L VK GE+VGLLGPNGAGKTT FYM+ GLI   SG + +D  D+T
Sbjct: 10  LQKTIKKTNIIKGISLDVKSGEVVGLLGPNGAGKTTTFYMICGLISPTSGGVFLDSVDVT 69

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITK 150
            + +++RA++GI YLPQE+SIF+ L+VEEN+L   E+  KD+++  +K+D +L   NI  
Sbjct: 70  NVALHKRAQMGIGYLPQESSIFKDLSVEENLLLGAEILYKDEEECAKKVDEMLNLLNIEP 129

Query: 151 WRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIG 210
            R      LSGG+RRR EIARSL+  P ++LLDEPFAGVDP+A+SDI  ++RDL + GIG
Sbjct: 130 IRLRKGVSLSGGERRRCEIARSLMITPKFLLLDEPFAGVDPIAVSDIQSIVRDLKNLGIG 189

Query: 211 ILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           +LITDHNV E L + DRAY+I  G +LA G+ +E+ ++++VR  YLG  F  
Sbjct: 190 VLITDHNVRETLAICDRAYVIKDGALLASGSAKEVANDKNVRTHYLGAEFKL 241


>gi|331016688|gb|EGH96744.1| ABC transporter, ATP-binding protein [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 241

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 168/238 (70%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y S  VV+ V + +  G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   ATLKAQHLAKSYKSRQVVRDVSISIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           ID  DI+  PM+ RAR GI YLPQEASIFR L+V +NI+A+LE   E D   R ++L+SL
Sbjct: 62  IDDLDISHQPMHGRARAGIGYLPQEASIFRKLSVSDNIMAILETRKELDAGARRKELESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+IT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHITHIRDNLGMSLSGGERRRVEIARALATSPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIG+LITDHNV E L + + AYI++   ++A G  + I+ NQ V+ +YLG  F
Sbjct: 182 HLKAKGIGVLITDHNVRETLDICETAYIVNDRQLIAEGDSETILANQLVKEVYLGHEF 239


>gi|149199441|ref|ZP_01876477.1| ABC transporter, ATP-binding protein [Lentisphaera araneosa
           HTCC2155]
 gi|149137519|gb|EDM25936.1| ABC transporter, ATP-binding protein [Lentisphaera araneosa
           HTCC2155]
          Length = 241

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 116/236 (49%), Positives = 173/236 (73%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           ++ A  L K+Y    VVKGV   V+ G+IVGLLGPNGAGKTT FYM+ GL+  + G +  
Sbjct: 4   IIKAEGLVKEYKKKRVVKGVSFKVEKGQIVGLLGPNGAGKTTSFYMVVGLVRPEEGKVLF 63

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           +G ++TK+PMY+RAR+G+ YL QE S+FR LTV++NI+A+LE+ + DK +R +++ +L+ 
Sbjct: 64  NGENVTKLPMYKRARMGMGYLAQEPSVFRRLTVKDNIMAILEMLKLDKAERVKRMHNLID 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           E  + K     A  LSGG+RRRLEIAR+LV+ P++++LDEPFAGVDP+A+S++  +IR L
Sbjct: 124 ELGLEKVADQAAVTLSGGERRRLEIARALVTNPTFLMLDEPFAGVDPIAVSEVQKIIRRL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
             RGI ILITDH+V ++L+++D  YI++ G +L  GT   ++ +++ R +YLG  F
Sbjct: 184 KDRGISILITDHSVRDMLSIVDYGYIMNKGELLTEGTSDFLVSDKEAREIYLGSDF 239


>gi|148926644|ref|ZP_01810325.1| ABC-transporter ATP-binding protein [Campylobacter jejuni subsp.
           jejuni CG8486]
 gi|145845163|gb|EDK22258.1| ABC-transporter ATP-binding protein [Campylobacter jejuni subsp.
           jejuni CG8486]
          Length = 263

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 159/220 (72%)

Query: 43  GVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYRRARLGI 102
           G+ L V  GE+VGLLGPNGAGKTT FYM+ GLI   SG + +DG D+TK P+ +RAR GI
Sbjct: 42  GISLEVNSGEVVGLLGPNGAGKTTTFYMICGLISPSSGKVLLDGLDVTKDPLNKRARSGI 101

Query: 103 SYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGG 162
            YLPQE+SIF+ L+VE+N+L   +++ KDKK  H+K++ +L+  +I   R      LSGG
Sbjct: 102 GYLPQESSIFKDLSVEDNLLLAAQIFYKDKKILHDKVEQMLELLSIEPIRLRKGLSLSGG 161

Query: 163 QRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIGILITDHNVHEIL 222
           +RRR EIARSL+  P ++LLDEPFAGVDP+A+++I  LI++L   GIG+LITDHNV E L
Sbjct: 162 ERRRCEIARSLMCEPKFLLLDEPFAGVDPIAVAEIQTLIKELKRLGIGVLITDHNVRETL 221

Query: 223 TLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            + DRAY+I +G +LA G   EI  N+DV++ YLG  F  
Sbjct: 222 AICDRAYVIRSGSLLASGNADEIATNKDVKKYYLGAEFKL 261


>gi|198284714|ref|YP_002221035.1| ABC transporter-like protein [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218665646|ref|YP_002427393.1| ABC transporter, ATP-binding protein [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|141101|sp|P24693|LPTB_THIFE RecName: Full=Lipopolysaccharide export system ATP-binding protein
           LptB
 gi|154643|gb|AAA27378.1| 5' end potential; putative [Acidithiobacillus ferrooxidans]
 gi|198249235|gb|ACH84828.1| ABC transporter related [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218517859|gb|ACK78445.1| ABC transporter, ATP-binding protein [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 241

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 127/236 (53%), Positives = 166/236 (70%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           LL A SL K Y    VV+ V + V  GE+VGLLGPNGAGKTT FYMM GL+  D G I +
Sbjct: 4   LLQAQSLFKSYRRRVVVRDVSVQVATGEVVGLLGPNGAGKTTTFYMMVGLVRPDRGHIFL 63

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
              DIT +PM+ RAR+G+ YLPQE S+FR ++  +N+LAVLE       +R E+ + LL 
Sbjct: 64  QQRDITALPMHERARMGLGYLPQEPSVFRQMSAADNVLAVLETLPLSPVERQERQEQLLS 123

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           E ++   R      LSGG+RRR+EIAR+L   P +ILLDEPFAG+DP+++ +I  LIRDL
Sbjct: 124 ELHLHALRDTKGHSLSGGERRRVEIARALAMSPRFILLDEPFAGIDPISVLEIQRLIRDL 183

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            +RGIG+LITDHNV E L + +RAYI+H G VL  G+ QEI+D+  VR++YLGD+F
Sbjct: 184 RARGIGVLITDHNVRETLGICERAYILHDGKVLTAGSPQEIVDDPMVRQVYLGDQF 239


>gi|308189071|ref|YP_003933202.1| ABC transport system, ATP-binding protein [Pantoea vagans C9-1]
 gi|308059581|gb|ADO11753.1| Putative ABC transport system, ATP-binding protein [Pantoea vagans
           C9-1]
          Length = 241

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/238 (51%), Positives = 172/238 (72%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A +L K Y    VV+ V L VK GEIVGLLGPNGAGKTT FYM+ G++  D+G I 
Sbjct: 2   ATLIAENLAKAYKGRRVVEDVSLQVKSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGRIV 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V +N++AVL++ +   +++R ++   L
Sbjct: 62  IDDEDISILPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLTEEQRQDRAREL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+I   R  +   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 MEEFHIEHLRDSMGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT  EI+ ++ V+R+YLG+ F
Sbjct: 182 HLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPNEILADEQVKRVYLGEEF 239


>gi|229588427|ref|YP_002870546.1| putative ABC transporter ATP-binding protein [Pseudomonas
           fluorescens SBW25]
 gi|312958998|ref|ZP_07773517.1| ABC transporter, ATP-binding protein [Pseudomonas fluorescens WH6]
 gi|229360293|emb|CAY47150.1| putative ABC transport system, ATP-binding protein [Pseudomonas
           fluorescens SBW25]
 gi|311286768|gb|EFQ65330.1| ABC transporter, ATP-binding protein [Pseudomonas fluorescens WH6]
          Length = 241

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 168/238 (70%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y S  VV+ V L +  G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   ATLKAQHLAKAYKSRQVVRDVSLSIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY-EKDKKKRHEKLDSL 142
           ID  D++  PM+ RAR GI YLPQEASIFR L+V +NI+A+LE   E D+  R ++L+SL
Sbjct: 62  IDDLDVSHQPMHGRARAGIGYLPQEASIFRKLSVADNIMAILETRKELDRDGRRKELESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHINHIRDNLGMSLSGGERRRVEIARALATAPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIG+LITDHNV E L + + AYI++ G ++A G    I+ N+ V+ +YLG  F
Sbjct: 182 HLKAKGIGVLITDHNVRETLDICETAYIVNDGQLIAEGDSATILANELVKEVYLGHEF 239


>gi|146313271|ref|YP_001178345.1| putative ABC transporter ATP-binding protein YhbG [Enterobacter sp.
           638]
 gi|145320147|gb|ABP62294.1| ABC transporter related protein [Enterobacter sp. 638]
          Length = 241

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/238 (51%), Positives = 174/238 (73%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L+A +L K Y    VV+ V L V  GEIVGLLGPNGAGKTT FYM+ G++  D+G+I 
Sbjct: 2   ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNII 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V +N++AVL++ +    ++R ++ + L
Sbjct: 62  IDDEDISLLPLHARARRGIGYLPQEASIFRRLSVFDNLMAVLQIRDDLTAEQRQDRANEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+I   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 MEEFHIEHLRDSLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT  EI++++ V+R+YLG+ F
Sbjct: 182 HLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPLEILEDEHVKRVYLGEDF 239


>gi|313682079|ref|YP_004059817.1| ABC transporter [Sulfuricurvum kujiense DSM 16994]
 gi|313154939|gb|ADR33617.1| ABC transporter related protein [Sulfuricurvum kujiense DSM 16994]
          Length = 240

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 169/233 (72%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           +L K   +  +V+G+ + ++ GE+VGLLGPNGAGKTT FYM+ GL+ A  G + IDG D+
Sbjct: 8   NLVKTIKNHEIVRGISMDLRTGEVVGLLGPNGAGKTTTFYMVCGLVEATGGKVYIDGEDV 67

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           + +P+++R+R+GI YLPQEASIF+ LTVEEN++   +  + D++   ++++ LL+ FNI 
Sbjct: 68  SGLPLHQRSRMGIGYLPQEASIFKDLTVEENLIIAAQAGKLDQEMAEKRIEELLEMFNIE 127

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             R+     LSGG+RRR EIAR+LV+ P ++LLDEPFAGVDP+A+ DI  +I  L   GI
Sbjct: 128 PIRNRRGINLSGGERRRAEIARALVNKPRFLLLDEPFAGVDPIAVMDIQGVISQLVEYGI 187

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           G+LITDHNV E L + DRAY+I +G +LA G+  EI +N DVR+ YLG+ F F
Sbjct: 188 GVLITDHNVRETLAVCDRAYVIKSGELLASGSSDEIANNPDVRQHYLGESFKF 240


>gi|325300149|ref|YP_004260066.1| Sulfate-transporting ATPase [Bacteroides salanitronis DSM 18170]
 gi|324319702|gb|ADY37593.1| Sulfate-transporting ATPase [Bacteroides salanitronis DSM 18170]
          Length = 272

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 125/238 (52%), Positives = 163/238 (68%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           +L   +L KKY    VV  V + VK GEIVGLLGPNGAGKTT FYM TGLI  + G I +
Sbjct: 23  VLRTENLVKKYGKRTVVSHVSINVKQGEIVGLLGPNGAGKTTSFYMTTGLIVPNEGHIYL 82

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           +  DIT  P+Y+RA+ GI YL QEAS+FR ++VE+NI +VLE+ +  K+ + EKL+SL+ 
Sbjct: 83  NNQDITSYPVYKRAQNGIGYLAQEASVFRKMSVEDNIASVLELTKTSKEYQKEKLESLIA 142

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF + K R  L   LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  L
Sbjct: 143 EFRLEKVRKNLGDQLSGGERRRTEIARCLAIDPKFIMLDEPFAGVDPIAVEDIQHIVWRL 202

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             + IGILITDHNV E L++ DRAY++  G +L  GT +E+  N+ VR  YL + F  
Sbjct: 203 KDKNIGILITDHNVQETLSITDRAYLLFEGKILFQGTPEELAANKIVREKYLSNSFVL 260


>gi|307721004|ref|YP_003892144.1| ABC transporter [Sulfurimonas autotrophica DSM 16294]
 gi|306979097|gb|ADN09132.1| ABC transporter related protein [Sulfurimonas autotrophica DSM
           16294]
          Length = 240

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 127/237 (53%), Positives = 162/237 (68%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A  L KK   + +VK V L V  GE+VGLLGPNGAGKTT FYM+ GL+ A  G +  D
Sbjct: 4   LKAADLKKKIKDLEIVKSVSLEVHSGEVVGLLGPNGAGKTTTFYMICGLVEATEGKVYFD 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
           G D+  MP++ RA  GI YLPQEASIF+ LTVE+N++   EV  KDK+++  ++  LL  
Sbjct: 64  GEDLIGMPLHERALKGIGYLPQEASIFKDLTVEDNLMIAAEVGIKDKQEQEARIVELLDM 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
           FNI   R+     LSGG+RRR+EIAR+LV+ P ++LLDEPFAGVDP+A+ DI  +I  L 
Sbjct: 124 FNIEPIRYRKGISLSGGERRRVEIARALVNKPKFLLLDEPFAGVDPIAVMDIQKVIHQLI 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           S  IG+LITDHNV E L + DR Y+I +G +LA GT  EI  N+DVR  YLG+ F  
Sbjct: 184 SYDIGVLITDHNVRETLDVCDRVYVIKSGELLAQGTSDEIGQNEDVRTHYLGESFKL 240


>gi|303256248|ref|ZP_07342264.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Burkholderiales bacterium 1_1_47]
 gi|331001309|ref|ZP_08324935.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Parasutterella excrementihominis YIT 11859]
 gi|302860977|gb|EFL84052.1| lipopolysaccharide ABC transporter, ATP-binding protein
           [Burkholderiales bacterium 1_1_47]
 gi|329569036|gb|EGG50832.1| lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Parasutterella excrementihominis YIT 11859]
          Length = 257

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 135/260 (51%), Positives = 174/260 (66%), Gaps = 12/260 (4%)

Query: 9   GIEMPEFQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFF 68
           G+ + + Q N      +L   +L K Y    VVK V L +K GE+VGLLGPNGAGKTT F
Sbjct: 4   GVNLQKHQTN------VLEVKNLKKIYGPRTVVKDVSLSIKSGEVVGLLGPNGAGKTTTF 57

Query: 69  YMMTGLICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVY 128
           YM+ GL+ A+ G I ++G  I  +P+Y+RAR+GI+YLPQE S+FR LTVEENI A+LE+ 
Sbjct: 58  YMIVGLVAANGGQILLNGESIQHLPIYKRARIGITYLPQENSVFRTLTVEENIQAILELQ 117

Query: 129 EKD------KKKRHEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILL 182
             +      KK+  E+L+ LL E  IT  R  LAP +SGG+RRR EIAR+L + P +ILL
Sbjct: 118 TNEDGSPFTKKQIKEELEKLLNELQITGIRKNLAPTVSGGERRRTEIARALAARPRFILL 177

Query: 183 DEPFAGVDPVAISDIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTV 242
           DEPFAGVDP+A+ +I  ++  L  RGIG+LITDHNV E L + D AYII  G VLA G  
Sbjct: 178 DEPFAGVDPIAVIEIQRIVHFLKERGIGVLITDHNVRETLGICDHAYIISNGSVLAQGKP 237

Query: 243 QEIIDNQDVRRLYLGDRFAF 262
           + I++N  VR  YLGD F  
Sbjct: 238 EAIVENPQVRNAYLGDNFTM 257


>gi|157148772|ref|YP_001456091.1| putative ABC transporter ATP-binding protein YhbG [Citrobacter
           koseri ATCC BAA-895]
 gi|157085977|gb|ABV15655.1| hypothetical protein CKO_04604 [Citrobacter koseri ATCC BAA-895]
          Length = 241

 Score =  249 bits (636), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/238 (51%), Positives = 173/238 (72%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L+A +L K Y    VV+ V L V  GEIVGLLGPNGAGKTT FYM+ G++  D+G+I 
Sbjct: 2   ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNII 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V +N++AVL++ +    ++R ++ + L
Sbjct: 62  IDDEDISLLPLHARARRGIGYLPQEASIFRRLSVFDNLMAVLQIRDDLTTEQREDRANEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+I   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 MEEFHIEHLRDSLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT  EI+ ++ V+R+YLG+ F
Sbjct: 182 HLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQDEHVKRVYLGEDF 239


>gi|196232235|ref|ZP_03131089.1| ABC transporter-related protein [Chthoniobacter flavus Ellin428]
 gi|196223603|gb|EDY18119.1| ABC transporter-related protein [Chthoniobacter flavus Ellin428]
          Length = 253

 Score =  249 bits (636), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 121/239 (50%), Positives = 164/239 (68%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
            +L    L K Y    VV GVD+ V+ GEIVGLLGPNGAGKTT FYM+ GL+  DSG + 
Sbjct: 15  EVLRTDKLVKVYGGRAVVNGVDINVRSGEIVGLLGPNGAGKTTSFYMVVGLVRPDSGRVF 74

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
               ++T   MYRRARLG+ YLPQE SIFR LTVE+N++A+LE+   +K++R  + + LL
Sbjct: 75  FQEKEVTDYAMYRRARLGMGYLPQEESIFRKLTVEQNLMAILELTSLNKRERKHRCEELL 134

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            +F I      LA  LSGG++RRL IARSLV  PS ++LDEPF+GVDP+A+ D+  +I++
Sbjct: 135 NQFGIEHVARQLALTLSGGEKRRLTIARSLVMKPSLLMLDEPFSGVDPIAVYDVQQIIKN 194

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L   G+ ILITDHNV E L ++DRAY++H G V+  G    ++++   RR+YLG+ F  
Sbjct: 195 LGDSGLAILITDHNVRETLNIVDRAYLVHEGKVVTQGEKDFLLNDPIARRVYLGETFQM 253


>gi|205355518|ref|ZP_03222289.1| ABC transporter ATP-binding protein [Campylobacter jejuni subsp.
           jejuni CG8421]
 gi|205346752|gb|EDZ33384.1| ABC transporter ATP-binding protein [Campylobacter jejuni subsp.
           jejuni CG8421]
 gi|315058084|gb|ADT72413.1| ABC-transporter ATP-binding protein [Campylobacter jejuni subsp.
           jejuni S3]
          Length = 250

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 159/220 (72%)

Query: 43  GVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYRRARLGI 102
           G+ L V  GE+VGLLGPNGAGKTT FYM+ GLI   SG + +DG D+TK P+ +RAR GI
Sbjct: 29  GISLEVNSGEVVGLLGPNGAGKTTTFYMICGLISPSSGKVLLDGLDVTKDPLNKRARSGI 88

Query: 103 SYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITKWRHVLAPLLSGG 162
            YLPQE+SIF+ L+VE+N+L   +++ KDKK  H+K++ +L+  +I   R      LSGG
Sbjct: 89  GYLPQESSIFKDLSVEDNLLLAAQIFYKDKKILHDKVEQMLELLSIEPIRLRKGLSLSGG 148

Query: 163 QRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIGILITDHNVHEIL 222
           +RRR EIARSL+  P ++LLDEPFAGVDP+A+++I  LI++L   GIG+LITDHNV E L
Sbjct: 149 ERRRCEIARSLMCEPKFLLLDEPFAGVDPIAVAEIQTLIKELKRLGIGVLITDHNVRETL 208

Query: 223 TLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            + DRAY+I +G +LA G   EI  N+DV++ YLG  F  
Sbjct: 209 AICDRAYVIRSGSLLASGNADEIATNKDVKKYYLGAEFKL 248


>gi|330828004|ref|YP_004390956.1| ABC transporter ATPase [Aeromonas veronii B565]
 gi|328803140|gb|AEB48339.1| ABC-type transport system, ATPase component [Aeromonas veronii
           B565]
          Length = 241

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 124/240 (51%), Positives = 171/240 (71%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           ++L A  L K Y    VV  V L V  G+IVGLLGPNGAGKTT FYM+ GL+  D+G I 
Sbjct: 2   AVLKAVGLQKSYKRRMVVSDVSLEVGTGQIVGLLGPNGAGKTTSFYMIVGLVQRDAGLIT 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+  PM+ RAR GI YLPQEASIFR L+V +N++ V++  +   +++R +K+  L
Sbjct: 62  IDDQDISLQPMHVRARNGIGYLPQEASIFRRLSVFDNLMGVMQTRKGLSREEREDKVQQL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EFNIT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I+
Sbjct: 122 LEEFNITHIRDNLGQSLSGGERRRVEIARALAAEPRFILLDEPFAGVDPISVIDIKKIIQ 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L  RG+G+LITDHNV E L + ++AYI+  G ++A G   +I+ ++ V+R+YLGD+F+ 
Sbjct: 182 HLKDRGLGVLITDHNVRETLDVCEKAYIVSHGKMIAEGAPADILADEQVKRVYLGDQFSL 241


>gi|37522833|ref|NP_926210.1| ABC transporter ATP-binding protein [Gloeobacter violaceus PCC
           7421]
 gi|35213835|dbj|BAC91205.1| glr3264 [Gloeobacter violaceus PCC 7421]
          Length = 242

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 130/233 (55%), Positives = 165/233 (70%), Gaps = 3/233 (1%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           ++K+Y+   VV  V L V+ GE+VGLLGPNGAGKTT FYM+TGL   DSGSI++D  DIT
Sbjct: 8   ISKQYSKRVVVDAVSLAVEQGEVVGLLGPNGAGKTTTFYMITGLEKPDSGSIELDERDIT 67

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITK 150
            +PM+RRARLGI YLPQ+ SIFR L+VE+NIL VLE     +K   ++L+ LL+EF I  
Sbjct: 68  TLPMHRRARLGIGYLPQQQSIFRRLSVEDNILLVLEQTRVPRKFWRKRLEELLEEFGIAT 127

Query: 151 WRHVLAPLLSGGQRRRLEIARSLVS---FPSYILLDEPFAGVDPVAISDIHVLIRDLASR 207
            R  L   +SGG+ RR+EIAR+L +    P ++LLDEPFAG+DP+A+SDI  +I  L  R
Sbjct: 128 IRKSLGIQVSGGESRRVEIARALAAGMEGPQFLLLDEPFAGIDPIAVSDIQKMIARLRDR 187

Query: 208 GIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           GIGILITDHNV   L+  DRAYI+  G V A GT  E+  N  VR+ YLG+ F
Sbjct: 188 GIGILITDHNVRATLSTTDRAYIMAQGRVFAAGTPAEMAVNPLVRQYYLGEDF 240


>gi|259907012|ref|YP_002647368.1| putative ABC transporter ATP-binding protein YhbG [Erwinia
           pyrifoliae Ep1/96]
 gi|224962634|emb|CAX54089.1| Putative ABC superfamily transport protein [Erwinia pyrifoliae
           Ep1/96]
 gi|283476807|emb|CAY72645.1| LPS export porin complex, cytoplasmic ABC-type ATPase subunit
           [Erwinia pyrifoliae DSM 12163]
 gi|310766224|gb|ADP11174.1| putative ABC transporter ATP-binding protein YhbG [Erwinia sp.
           Ejp617]
          Length = 241

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 171/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A +L K Y    VV+ V L VK GEIVGLLGPNGAGKTT FYM+ G++  D+G I 
Sbjct: 2   ATLIAENLAKAYKGRRVVEDVSLQVKSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGRIV 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V +N++AVL++ +    ++R ++ + L
Sbjct: 62  IDEEDISILPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLTSEQREDRANEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L EF+I   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LAEFHIAHLRDSLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT + I+ ++ V+R+YLG+ F
Sbjct: 182 HLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPEAILADEQVKRVYLGEEF 239


>gi|294650974|ref|ZP_06728314.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Acinetobacter haemolyticus ATCC 19194]
 gi|292823075|gb|EFF81938.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Acinetobacter haemolyticus ATCC 19194]
          Length = 248

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 172/245 (70%), Gaps = 1/245 (0%)

Query: 17  ENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLIC 76
           E    +   L    L K Y+  +VVK V   ++ G+IVGLLGPNGAGKTT FYM+ GL+ 
Sbjct: 2   EQSLQQPQTLCIKHLAKNYSKRWVVKDVSFTMQSGQIVGLLGPNGAGKTTSFYMVVGLVR 61

Query: 77  ADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKR 135
            D G I +D  D++ + M+ RAR GI YLPQEASIFR LT+ ENI+A+LE  +  +K +R
Sbjct: 62  MDKGEIHLDDLDLSDLAMHERARKGIGYLPQEASIFRKLTIAENIMAILETRKDLNKAQR 121

Query: 136 HEKLDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAIS 195
            ++L+ LL +F I+  +  L   +SGG+RRR EIAR+L + P ++LLDEPFAGVDP+++ 
Sbjct: 122 QQRLNELLGDFKISHIKDSLGMSVSGGERRRAEIARALAADPKFMLLDEPFAGVDPISVG 181

Query: 196 DIHVLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLY 255
           DI  +I+ L +RGIG+LITDHNV E L + ++AYI+  G V+A G  QEI+DN+ VR++Y
Sbjct: 182 DIKEIIQTLKNRGIGVLITDHNVRETLAICEKAYIVSEGSVIAEGAPQEILDNEQVRKVY 241

Query: 256 LGDRF 260
           LGD F
Sbjct: 242 LGDDF 246


>gi|104780310|ref|YP_606808.1| ABC transporter ATP-binding protein [Pseudomonas entomophila L48]
 gi|95109297|emb|CAK13994.1| putative ABC transporter, ATP-binding protein [Pseudomonas
           entomophila L48]
          Length = 241

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 169/238 (71%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y    VV+ V L +  G+IVGLLGPNGAGKTT FYM+ GL+ AD G + 
Sbjct: 2   ATLKAQHLAKSYKGRQVVRDVSLSIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGRVL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  D++  PM+ RA+ GI YLPQEASIFR L+V +NI+A+LE  +  D+  R ++L+SL
Sbjct: 62  IDSLDVSHQPMHGRAQAGIGYLPQEASIFRKLSVADNIMAILETRKDLDRDGRRKELESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I+  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHISHIRDNLGMSLSGGERRRVEIARALATAPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIG+LITDHNV E L + + AYI++ G ++A G  + I+ NQ V+ +YLG  F
Sbjct: 182 HLKNKGIGVLITDHNVRETLDICETAYIVNDGQLIAEGDAETILANQLVKEVYLGHEF 239


>gi|183221036|ref|YP_001839032.1| ABC transporter ATPase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|167779458|gb|ABZ97756.1| ABC-type transport system, ATPase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 232

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 159/232 (68%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           + K YN   VV GV  Y+K GEIVGLLGPNGAGKTT FYM  G +  D G + ID  D+T
Sbjct: 1   MVKIYNKRKVVDGVSFYIKKGEIVGLLGPNGAGKTTSFYMSVGFVTPDEGHVFIDNEDLT 60

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITK 150
           K PM+ RAR+G+ YL QEASIFR LTV EN+ A+LE       +   + D LL E  I +
Sbjct: 61  KSPMHIRARMGVGYLAQEASIFRKLTVAENLEAILETMNLPGDEIIRRRDELLMELQIMR 120

Query: 151 WRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIG 210
             +     LSGG+RRR EIAR+LV+ P +ILLDEPFAGVDP+A+ DI  +I+ L  RG+G
Sbjct: 121 VANQKGYTLSGGERRRCEIARALVTNPDFILLDEPFAGVDPIAVKDIQNVIQSLKERGLG 180

Query: 211 ILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           ILITDHNV E L + DRAYI+++G +L  GT  ++I++ + RR+YLG+ F  
Sbjct: 181 ILITDHNVRETLKITDRAYIMYSGRILISGTADDLINDPETRRIYLGEDFKL 232


>gi|157373866|ref|YP_001472466.1| ABC transporter-related protein [Shewanella sediminis HAW-EB3]
 gi|157316240|gb|ABV35338.1| ABC transporter-related protein [Shewanella sediminis HAW-EB3]
          Length = 243

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 173/236 (73%), Gaps = 1/236 (0%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L A +L K Y S  VV+ V L VK G+IVGLLGPNGAGKTT FYM+ GL+ +D G I ID
Sbjct: 6   LKAVNLAKSYKSRAVVQDVSLTVKTGQIVGLLGPNGAGKTTTFYMVVGLVQSDKGRIFID 65

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEV-YEKDKKKRHEKLDSLLK 144
            +D+T  PM+ RAR GI YLPQEASIFR L+V +NI+AVL+   E    +R E+L+ LL+
Sbjct: 66  EDDLTLDPMHLRARKGIGYLPQEASIFRKLSVRDNIMAVLQTRSEMSNNEREEQLEHLLE 125

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF+IT  R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I  L
Sbjct: 126 EFHITHIRDSLGMALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIILQL 185

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            SRG+G+LITDHNV E L + + AYI+  G ++A GT  EI+DNQ VR +YLG++F
Sbjct: 186 KSRGLGVLITDHNVRETLDVCEHAYIVSHGNLIAEGTPAEILDNQQVRAVYLGEQF 241


>gi|91791854|ref|YP_561505.1| ABC transporter related [Shewanella denitrificans OS217]
 gi|91713856|gb|ABE53782.1| ABC transporter related [Shewanella denitrificans OS217]
          Length = 243

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 175/240 (72%), Gaps = 1/240 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L+A +L K Y +  VVK V L V  G+IVGLLGPNGAGKTT FYM+ GL+ +D G I 
Sbjct: 4   SKLTAENLAKSYKNRQVVKDVSLSVSTGQIVGLLGPNGAGKTTTFYMVVGLVKSDKGRIL 63

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID +D+T  PM+ RAR GI YLPQEASIFR LTV +NI+AVL+  +     +R E+L+ L
Sbjct: 64  IDDDDLTGDPMHLRARKGIGYLPQEASIFRKLTVRDNIMAVLQTRKSLSNDEREEQLEHL 123

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+IT  R      LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I+
Sbjct: 124 LEEFHITHIRDSQGMSLSGGERRRVEIARALAADPQFILLDEPFAGVDPISVIDIKKIIQ 183

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
            L SRG+G+LITDHNV E L + +RAYI+  G ++A GT  EI+DNQ VR +YLG++F  
Sbjct: 184 QLKSRGLGVLITDHNVRETLDVCERAYIVSHGNLIAEGTPAEILDNQQVRAVYLGEQFKL 243


>gi|152986347|ref|YP_001350370.1| ABC transporter ATP-binding protein [Pseudomonas aeruginosa PA7]
 gi|150961505|gb|ABR83530.1| probable ATP-binding component of ABC transporter [Pseudomonas
           aeruginosa PA7]
          Length = 241

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 166/238 (69%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L A  L K Y    VV+ V + +  G+IVGLLGPNGAGKTT FYM+ GL+ AD G ++
Sbjct: 2   ATLKAQHLAKSYKGRQVVRDVSMSIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGVVR 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  ++T +PM+ RAR GI YLPQEASIFR L+V +NI+A+LE     D+  R + L+ L
Sbjct: 62  IDEQNVTHLPMHGRARAGIGYLPQEASIFRKLSVSDNIMAILETRSDLDRNGRKDALEGL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+EF+I   R  L   LSGG+RRR+EIAR+L S P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 LQEFHIHHIRDNLGMSLSGGERRRVEIARALASAPKFILLDEPFAGVDPISVGDIKQIIH 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L ++GIGILITDHNV E L + + AYI++ G ++A G  + I+ N  V+ +YLG  F
Sbjct: 182 HLKAKGIGILITDHNVRETLDICETAYIVNDGQLIAEGDAESILANDLVKEVYLGHEF 239


>gi|220933907|ref|YP_002512806.1| ABC transporter related [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995217|gb|ACL71819.1| ABC transporter related [Thioalkalivibrio sp. HL-EbGR7]
          Length = 241

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 125/238 (52%), Positives = 167/238 (70%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S LSA  L K+Y     V GV ++V  GE+VGLLGPNGAGKTT FYM+ GL+ AD G I 
Sbjct: 2   SRLSAQDLIKRYRGRTPVNGVSVHVDSGEVVGLLGPNGAGKTTCFYMIVGLVPADEGQIL 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ++  DIT  PM+ RAR+G+ YLPQEAS+FR L+  +NILAVLE        +R + L+SL
Sbjct: 62  LNERDITAFPMHARARMGVGYLPQEASVFRKLSAADNILAVLETRRDLSATERQQHLESL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           L+E  IT  R  L   LSGG+RRR+EIAR+L + P++ILLDEPFAGVDP+++ +I  +I 
Sbjct: 122 LEELQITHIRDNLGISLSGGERRRVEIARALATEPAFILLDEPFAGVDPISVIEIQRIIT 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L  RGIG+LITDHNV E L + DRAYI+  G +++ G    ++ ++ VR++YLG+ F
Sbjct: 182 HLKDRGIGVLITDHNVRETLGICDRAYILSEGRIISEGPPDHLLADEMVRKVYLGEHF 239


>gi|203284377|ref|YP_002222117.1| ABC transporter, ATP-binding protein [Borrelia duttonii Ly]
 gi|201083820|gb|ACH93411.1| ABC transporter, ATP-binding protein [Borrelia duttonii Ly]
          Length = 277

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 130/242 (53%), Positives = 169/242 (69%), Gaps = 1/242 (0%)

Query: 20  ASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADS 79
           A  D +L A S+ KKY     V GV + V  GE+VGLLGPNGAGKTT FY + G I A+ 
Sbjct: 34  AVTDIVLKADSIVKKYGEKVAVNGVTIDVHRGEVVGLLGPNGAGKTTTFYTIVGFIKANG 93

Query: 80  GSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEK 138
           G + I+ +D++K+ MY RARLGI YLPQE SIFR LTVE+NIL  LE  E   + +R  +
Sbjct: 94  GRVLINNHDVSKLNMYERARLGIVYLPQEPSIFRELTVEDNILVALERREDLSQAERKIE 153

Query: 139 LDSLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIH 198
           L +LLK+F I + ++  A  LSGG+RRR EIAR+L   P ++LLDEPFAG+DP+AI DI 
Sbjct: 154 LVNLLKDFEIKRIQYQKAYTLSGGERRRTEIARALAVSPYFLLLDEPFAGIDPIAIGDIK 213

Query: 199 VLIRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGD 258
            +IR L S+ IG+LITDHNV +   +IDRAYII+ G VL  G V  II+++  ++LYLG+
Sbjct: 214 DIIRILKSKNIGVLITDHNVRDAFDIIDRAYIIYQGQVLDSGNVDYIINSEKAKKLYLGE 273

Query: 259 RF 260
            F
Sbjct: 274 EF 275


>gi|182416015|ref|YP_001821081.1| ABC transporter related [Opitutus terrae PB90-1]
 gi|177843229|gb|ACB77481.1| ABC transporter related [Opitutus terrae PB90-1]
          Length = 259

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 120/231 (51%), Positives = 168/231 (72%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           +L K Y    VV GV++    GE+VGLLGPNGAGKTT FYM+ GLI A  G + +DG D+
Sbjct: 27  ALVKVYGERRVVDGVNMRFCGGEVVGLLGPNGAGKTTTFYMIVGLIAATDGRVCLDGADL 86

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           TKM M++RAR GI YLPQE S+FR LTVE+NILA+LE     +++R  ++ + ++E ++T
Sbjct: 87  TKMRMHQRARHGIGYLPQEPSVFRKLTVEQNILAILESIGVPRRERAARVKAHIEELHLT 146

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
                 A  LSGG+RRRLEIAR+LV+ P ++L+DEPFA +DP++++++  ++  L SRGI
Sbjct: 147 HVAKQKAYTLSGGERRRLEIARALVTRPKFLLMDEPFAAIDPISVAEVQRIVLQLKSRGI 206

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           GI+ITDHNV E L ++DRAY+IH G VLA GT + +I ++  R+ YLG+ F
Sbjct: 207 GIVITDHNVRETLRVVDRAYLIHKGRVLAEGTGEFLIQDEQARKFYLGEDF 257


>gi|313886199|ref|ZP_07819929.1| ABC transporter, ATP-binding protein [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|332299723|ref|YP_004441644.1| Fe(3+)-transporting ATPase [Porphyromonas asaccharolytica DSM
           20707]
 gi|312924378|gb|EFR35157.1| ABC transporter, ATP-binding protein [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|332176786|gb|AEE12476.1| Fe(3+)-transporting ATPase [Porphyromonas asaccharolytica DSM
           20707]
          Length = 267

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 125/238 (52%), Positives = 164/238 (68%)

Query: 25  LLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKI 84
           LL    L K+Y S  VV  V + ++ GEIVGLLGPNGAGKTT FYM  GL+  + G I +
Sbjct: 22  LLRTEHLVKRYRSRTVVNDVSIELRQGEIVGLLGPNGAGKTTTFYMTVGLVVPNGGKIYL 81

Query: 85  DGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLK 144
           +  DITK+P+Y+RARLGI YL QEAS+FR L+VE+NI AVLE+      ++ E+L+ L++
Sbjct: 82  NEQDITKLPVYQRARLGIGYLAQEASVFRKLSVEDNIKAVLEMTPLTPDQQRERLEMLIE 141

Query: 145 EFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDL 204
           EF + K R      LSGG+RRR+EIAR L   P +I+LDEPFAGVDP+A+ DI  ++  L
Sbjct: 142 EFGLHKVRTNQGNRLSGGERRRVEIARCLAIDPKFIMLDEPFAGVDPIAVQDIQSIVAKL 201

Query: 205 ASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
             R IGILITDHNV+E L++ DRAY++  G VL  GT +++ +N  VR  YLG  F  
Sbjct: 202 KQRNIGILITDHNVNETLSITDRAYLLFEGKVLFQGTAEQLAENALVREKYLGRDFVL 259


>gi|332830439|gb|EGK03067.1| hypothetical protein HMPREF9455_01317 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 264

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 165/240 (68%)

Query: 21  SKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSG 80
            K  +L   +L K+Y S  VV  V + VK GEIVGLLGPNGAGKTT FYM  GL+  + G
Sbjct: 13  EKHMVLRTENLVKRYKSRTVVNHVSIDVKQGEIVGLLGPNGAGKTTTFYMTVGLVMPNEG 72

Query: 81  SIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLD 140
            I ++  +ITK P+Y+RA+ GI YL QEASIFR +TVE+NI ++LE+ +     + EKL+
Sbjct: 73  KIFLNEQEITKFPVYKRAQNGIGYLAQEASIFRKMTVEDNIRSILEMTKTSAAYQKEKLE 132

Query: 141 SLLKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVL 200
           SL++EF + K R  L   LSGG+RRR EIAR L   P +I+LDEPFAGVDP+A+ DI  +
Sbjct: 133 SLIEEFGLQKVRKNLGDRLSGGERRRSEIARCLAIDPKFIMLDEPFAGVDPIAVQDIQEI 192

Query: 201 IRDLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           +  L  + IGILITDHNV E L++ DRAY++  G VL  GT +++ +N+ VR  YLG  F
Sbjct: 193 VAKLKYKNIGILITDHNVDETLSITDRAYLLFEGKVLFQGTAEQLANNEIVREKYLGRDF 252


>gi|328953773|ref|YP_004371107.1| Sulfate-transporting ATPase [Desulfobacca acetoxidans DSM 11109]
 gi|328454097|gb|AEB09926.1| Sulfate-transporting ATPase [Desulfobacca acetoxidans DSM 11109]
          Length = 240

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 122/235 (51%), Positives = 164/235 (69%)

Query: 26  LSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKID 85
           L    LTK Y +  VV  V L V  GEIVGLLGPNGAGKTT FYM+ G+I  D+G I ID
Sbjct: 4   LKTIELTKSYRNKKVVDHVSLVVHSGEIVGLLGPNGAGKTTTFYMIVGIIKPDAGDIVID 63

Query: 86  GNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKE 145
              I+ +P++RR+RLGI YLPQE S+FR LTV ENILA+L+        R  +LD LL+E
Sbjct: 64  DQSISPLPIFRRSRLGIQYLPQEPSVFRKLTVAENILAILQTLPLASLTRQTRLDGLLQE 123

Query: 146 FNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLA 205
             I+   +  A  LSGG+RRR+EI R+L + P ++LLDEPFAG+DP+A++DI  +I  L 
Sbjct: 124 LKISHLANNKAYSLSGGERRRVEITRALATSPRFVLLDEPFAGIDPLAVNDIQNIIHKLK 183

Query: 206 SRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            +G+GILI+DHNV E L + DRAYI++ G +L  GT ++I+D+   +++YLG+ F
Sbjct: 184 EKGLGILISDHNVRETLGVCDRAYIMNEGSILEEGTPEKIVDSDLAKKIYLGESF 238


>gi|315638550|ref|ZP_07893726.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Campylobacter upsaliensis
           JV21]
 gi|315481394|gb|EFU72022.1| lipopolysaccharide ABC superfamily ATP binding cassette
           transporter, ABC protein [Campylobacter upsaliensis
           JV21]
          Length = 242

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 122/239 (51%), Positives = 164/239 (68%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S L    L K      ++  + L ++ GE+VGLLGPNGAGKTT FYM+ GLI    G +K
Sbjct: 2   SKLEVLHLEKVIKKTKIIHDISLEIQSGEVVGLLGPNGAGKTTTFYMICGLITPSGGQVK 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           ++G DITK P+ +RAR GI YLPQE+S+F+ L+VE+N+L   E++ KDKK  +EK++ +L
Sbjct: 62  LNGTDITKEPLNKRARQGIGYLPQESSVFKDLSVEDNLLLAAEIFYKDKKILNEKVEKML 121

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
           +  +I   R      LSGG+RRR EIARSL+  P ++LLDEPFAGVDP+A+++I  LI++
Sbjct: 122 ELLSIEPIRLRKGLSLSGGERRRCEIARSLMCEPKFLLLDEPFAGVDPIAVAEIQNLIKE 181

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           L    IGILITDHNV E L + DRAY+I  G +LA G  +EI  NQDV++ YLG  F  
Sbjct: 182 LKRLDIGILITDHNVRETLAICDRAYVIKQGTLLASGNAKEIAHNQDVKKYYLGAEFKL 240


>gi|257459452|ref|ZP_05624561.1| ABC-transporter ATP-binding protein [Campylobacter gracilis RM3268]
 gi|257442877|gb|EEV18011.1| ABC-transporter ATP-binding protein [Campylobacter gracilis RM3268]
          Length = 240

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 121/232 (52%), Positives = 163/232 (70%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           L K      ++KG+ L +  GEIVGLLGPNGAGKTT FYM+ GLI A  G I ++ N I 
Sbjct: 9   LKKTIKGTPIIKGISLELYNGEIVGLLGPNGAGKTTTFYMICGLISASGGDILLNENSIA 68

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITK 150
           K+P+++RA+LGI YLPQE+SIF+ L+VEEN++   E+  K+K +   K+D +L   NI  
Sbjct: 69  KVPLHKRAKLGIGYLPQESSIFKELSVEENLMLAAEITYKNKAEASRKVDEMLNLLNIEP 128

Query: 151 WRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIG 210
            R      LSGG+RRR EIARSL+  P ++LLDEPFAGVDP+A++DI  ++RDL+  GIG
Sbjct: 129 IRLRKGVSLSGGERRRCEIARSLMITPKFLLLDEPFAGVDPIAVNDIQSIVRDLSDLGIG 188

Query: 211 ILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           +LITDHNV E L + DRAY+I  G + A GT +EI  + +VR+ YLG+ F+ 
Sbjct: 189 VLITDHNVRETLAICDRAYVIKDGELFAGGTAKEIASDPNVRKFYLGEDFSI 240


>gi|116328334|ref|YP_798054.1| ATP-binding protein of an ABC transporter complex [Leptospira
           borgpetersenii serovar Hardjo-bovis L550]
 gi|116331060|ref|YP_800778.1| ATP-binding protein of an ABC transporter complex [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
 gi|116121078|gb|ABJ79121.1| ATP-binding protein of an ABC transporter complex [Leptospira
           borgpetersenii serovar Hardjo-bovis L550]
 gi|116124749|gb|ABJ76020.1| ATP-binding protein of an ABC transporter complex [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
          Length = 241

 Score =  249 bits (635), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 121/233 (51%), Positives = 161/233 (69%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           +L K YN   VV G    +K GE++GLLGPNGAGKTT FYM  G +  DSG + IDG D+
Sbjct: 9   NLIKVYNKRKVVDGASFNIKKGEVIGLLGPNGAGKTTSFYMSVGFVKPDSGKVYIDGQDV 68

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           T+ PM+ RARLG+ YL QEASIFR LTV EN+ A+LE     + +  ++ D LL E  I 
Sbjct: 69  TESPMHIRARLGVGYLAQEASIFRKLTVAENLEAILETMNLSRTEIIKRRDELLIELQIM 128

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
           +  +     LSGG+RRR EIAR+LV+ P +ILLDEPFAGVDP+A+ DI  +I  L  RG+
Sbjct: 129 RVANQKGYTLSGGERRRCEIARALVTNPDFILLDEPFAGVDPIAVKDIQTVIGSLKERGL 188

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRFAF 262
           GILITDHNV E L + DRAYI+++G +L  G+  +++++ + RR+YLG+ F  
Sbjct: 189 GILITDHNVRETLKITDRAYIMYSGRILISGSTHDLVNDPETRRIYLGEDFTL 241


>gi|238019691|ref|ZP_04600117.1| hypothetical protein VEIDISOL_01565 [Veillonella dispar ATCC 17748]
 gi|237863732|gb|EEP65022.1| hypothetical protein VEIDISOL_01565 [Veillonella dispar ATCC 17748]
          Length = 239

 Score =  249 bits (635), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 164/231 (70%)

Query: 30  SLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDI 89
           +L K ++   VV GV L V  G++VGLLGPNGAGKTT FYM+ G+    SG I +DG DI
Sbjct: 7   NLVKTFSGRNVVDGVSLRVDKGQVVGLLGPNGAGKTTSFYMIVGIERPSSGIITVDGKDI 66

Query: 90  TKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNIT 149
           T +PMY+RA  GI YLPQEASIFR +TVE+NI A+L+   K   +    ++SL++EF+I 
Sbjct: 67  TNIPMYKRAAEGIGYLPQEASIFRSMTVEDNIRAMLQTTSKKSDEIEAIVESLIEEFHIG 126

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGI 209
             R  +   LSGG+RRR+EIAR L   P++ILLDEPFAGVDP+A++DI  +I  + +RGI
Sbjct: 127 HVRDRMGMQLSGGERRRVEIARCLALEPNFILLDEPFAGVDPIAVADIQQIILHVKNRGI 186

Query: 210 GILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           GILITDHNV E L ++D+AYI+ +G +L  GT +EI +N   R  YLGD F
Sbjct: 187 GILITDHNVRETLGIVDKAYILSSGKILLEGTPEEIANNPIAREHYLGDNF 237


>gi|237730121|ref|ZP_04560602.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226908727|gb|EEH94645.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 241

 Score =  249 bits (635), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 123/238 (51%), Positives = 173/238 (72%), Gaps = 1/238 (0%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           + L+A +L K Y    VV+ V L V  GEIVGLLGPNGAGKTT FYM+ G++  D+G+I 
Sbjct: 2   ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNII 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSL 142
           ID  DI+ +P++ RAR GI YLPQEASIFR L+V +N++AVL++ +    ++R ++ + L
Sbjct: 62  IDDEDISLLPLHARARRGIGYLPQEASIFRRLSVFDNLMAVLQIRDDLTSEQREDRANEL 121

Query: 143 LKEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIR 202
           ++EF+I   R  L   LSGG+RRR+EIAR+L + P +ILLDEPFAGVDP+++ DI  +I 
Sbjct: 122 MEEFHIEHLRDSLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIE 181

Query: 203 DLASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
            L   G+G+LITDHNV E L + +RAYI+  G ++AHGT  EI+ ++ V+R+YLG+ F
Sbjct: 182 HLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQDEHVKRVYLGEDF 239


>gi|42522414|ref|NP_967794.1| ABC-type nitrate transporter, ATPase component [Bdellovibrio
           bacteriovorus HD100]
 gi|39574946|emb|CAE78787.1| ABC-type nitrate transporter, ATPase component [Bdellovibrio
           bacteriovorus HD100]
          Length = 240

 Score =  249 bits (635), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 165/237 (69%)

Query: 24  SLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIK 83
           S+L+   ++K +    VV G    V+ G++VGLLGPNGAGKTT FYM+ GL+  DSG+I 
Sbjct: 2   SMLTIKDISKSFKKRKVVDGASFSVESGQVVGLLGPNGAGKTTSFYMVVGLVQPDSGTIN 61

Query: 84  IDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLL 143
           +D  +IT+ PMY+RAR+G+SYL QE SIFR LTV ENI+  LE +      R EKL+ L+
Sbjct: 62  LDETNITQEPMYKRARVGLSYLAQEPSIFRKLTVAENIIVALEAHGYSGASRSEKLEQLI 121

Query: 144 KEFNITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRD 203
            +F++   R      LSGG+RRR+EIAR+L   P +ILLDEPFAG+DP+A++DI  +IR+
Sbjct: 122 GDFHVGHIRDSYGYALSGGERRRVEIARALAGSPKFILLDEPFAGIDPIAVADIQNIIRE 181

Query: 204 LASRGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDVRRLYLGDRF 260
           L ++GIG+LITDHNV E L + D AYI+  G +   G+  EI +++  R+ YLG+ F
Sbjct: 182 LKAKGIGVLITDHNVRETLGICDYAYILKDGKIQVSGSSDEIANSELARKFYLGENF 238


>gi|16762081|ref|NP_457698.1| ABC transporter ATP-binding protein YhbG [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|16766614|ref|NP_462229.1| ABC transporter ATP-binding protein YhbG [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|29143570|ref|NP_806912.1| ABC transporter ATP-binding protein YhbG [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|56415248|ref|YP_152323.1| ABC transporter ATP-binding protein YhbG [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|62181827|ref|YP_218244.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|161506118|ref|YP_001573230.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. arizonae serovar 62:z4,z23:-- str.
           RSK2980]
 gi|161616329|ref|YP_001590294.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Paratyphi B str. SPB7]
 gi|167552031|ref|ZP_02345784.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|167994512|ref|ZP_02575603.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|168231930|ref|ZP_02656988.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|168238021|ref|ZP_02663079.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|168243155|ref|ZP_02668087.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|168262668|ref|ZP_02684641.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|168463455|ref|ZP_02697372.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|168819611|ref|ZP_02831611.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|194444797|ref|YP_002042577.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194451452|ref|YP_002047348.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194469194|ref|ZP_03075178.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194735191|ref|YP_002116269.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|197251736|ref|YP_002148244.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|197266054|ref|ZP_03166128.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|197364178|ref|YP_002143815.1| ABC transporter ATP-binding protein YhbG [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|198242245|ref|YP_002217290.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|200388659|ref|ZP_03215271.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|204931204|ref|ZP_03221998.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|205354220|ref|YP_002228021.1| ABC transporter ATP-binding protein YhbG [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|207858567|ref|YP_002245218.1| ABC transporter ATP-binding protein YhbG [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|213053146|ref|ZP_03346024.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213426638|ref|ZP_03359388.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Typhi str. E02-1180]
 gi|213579698|ref|ZP_03361524.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-0664]
 gi|213648388|ref|ZP_03378441.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Typhi str. J185]
 gi|213855449|ref|ZP_03383689.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Typhi str. M223]
 gi|224585116|ref|YP_002638915.1| ABC transporter ATP-binding protein YhbG [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|238910113|ref|ZP_04653950.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Tennessee str.
           CDC07-0191]
 gi|289825830|ref|ZP_06544998.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|25384647|pir||AF0905 probable ABC transport protein, ATP-binding component STY3498
           [imported] - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)
 gi|16421876|gb|AAL22188.1| putative ABC superfamily transport protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|16504384|emb|CAD07836.1| probable ABC transport protein, ATP-binding component [Salmonella
           enterica subsp. enterica serovar Typhi]
 gi|29139205|gb|AAO70772.1| probable ABC transport protein, ATP-binding component [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
 gi|56129505|gb|AAV79011.1| probable ABC transport protein, ATP-binding component [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|62129460|gb|AAX67163.1| putative ABC superfamily (atp_bind) transport protein [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|160867465|gb|ABX24088.1| hypothetical protein SARI_04306 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161365693|gb|ABX69461.1| hypothetical protein SPAB_04137 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403460|gb|ACF63682.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194409756|gb|ACF69975.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194455558|gb|EDX44397.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194710693|gb|ACF89914.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|195633673|gb|EDX52087.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|197095655|emb|CAR61223.1| probable ABC transport protein, ATP-binding component [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
 gi|197215439|gb|ACH52836.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|197244309|gb|EDY26929.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|197289106|gb|EDY28475.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|197936761|gb|ACH74094.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|199605757|gb|EDZ04302.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|204319971|gb|EDZ05177.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|205274001|emb|CAR39007.1| probable ABC transport protein, ATP-binding component [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|205323206|gb|EDZ11045.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205327646|gb|EDZ14410.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205333722|gb|EDZ20486.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|205337743|gb|EDZ24507.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|205343458|gb|EDZ30222.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|205348394|gb|EDZ35025.1| lipopolysaccharide ABC transporter, ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|206710370|emb|CAR34728.1| probable ABC transport protein, ATP-binding component [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|224469644|gb|ACN47474.1| probable ABC transport protein, ATP-binding component [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|261248484|emb|CBG26321.1| probable ABC transport protein, ATP-binding component [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           D23580]
 gi|267995518|gb|ACY90403.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           14028S]
 gi|301159868|emb|CBW19387.1| probable ABC transport protein, ATP-binding component [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           SL1344]
 gi|312914346|dbj|BAJ38320.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           T000240]
 gi|321225258|gb|EFX50317.1| Lipopolysaccharide ABC transporter, ATP-binding protein LptB
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|322615323|gb|EFY12244.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315996572]
 gi|322618318|gb|EFY15209.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-1]
 gi|322622877|gb|EFY19721.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-3]
 gi|322626801|gb|EFY23598.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-4]
 gi|322631370|gb|EFY28130.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-1]
 gi|322635363|gb|EFY32077.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-2]
 gi|322643362|gb|EFY39926.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str. 531954]
 gi|322647066|gb|EFY43567.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322648869|gb|EFY45314.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           OH_2009072675]
 gi|322655061|gb|EFY51372.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322657664|gb|EFY53932.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str. 19N]
 gi|322664160|gb|EFY60358.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           81038-01]
 gi|322667443|gb|EFY63605.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MD_MDA09249507]
 gi|322674691|gb|EFY70783.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str. 414877]
 gi|322675676|gb|EFY71749.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str. 366867]
 gi|322682312|gb|EFY78335.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str. 413180]
 gi|322684915|gb|EFY80913.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str. 446600]
 gi|322716316|gb|EFZ07887.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Choleraesuis str. A50]
 gi|323131679|gb|ADX19109.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Typhimurium str. 4/74]
 gi|323195880|gb|EFZ81051.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           609458-1]
 gi|323198997|gb|EFZ84094.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           556150-1]
 gi|323204303|gb|EFZ89312.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str. 609460]
 gi|323207650|gb|EFZ92597.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           507440-20]
 gi|323211297|gb|EFZ96141.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str. 556152]
 gi|323214761|gb|EFZ99510.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB101509-0077]
 gi|323221241|gb|EGA05667.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB102109-0047]
 gi|323224017|gb|EGA08310.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB110209-0055]
 gi|323230333|gb|EGA14452.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB111609-0052]
 gi|323233309|gb|EGA17403.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009083312]
 gi|323239346|gb|EGA23396.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009085258]
 gi|323242403|gb|EGA26429.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315731156]
 gi|323246913|gb|EGA30879.1| lipopolysaccharide ABC transporter ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323254154|gb|EGA37974.1| lipopolysaccharide ABC transporter ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323255271|gb|EGA39048.1| lipopolysaccharide ABC transporter ATP-binding protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323262734|gb|EGA46290.1| putative ABC transporter ATP-binding protein YhbG [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008284]
 gi|323264044|gb|EGA47552.1| lipopolysaccharide ABC transporter ATP-binding protein [Salmonella