RPSBLAST alignment for GI: 254780744 and conserved domain: PLN03232

>gnl|CDD|178771 PLN03232, PLN03232, ABC transporter C family member; Provisional. Length = 1495
 Score = 56.1 bits (135), Expect = 8e-09
 Identities = 55/212 (25%), Positives = 101/212 (47%), Gaps = 25/212 (11%)

Query: 44  VDLYVKPGEIVGLLGPNGAGKTTFFYMMTG-LICADSGSIKIDGNDITKMPMYRRARLGI 102
           ++L +  G +V ++G  G GKT+    M G L  A++ S+ I G+              +
Sbjct: 636 INLEIPVGSLVAIVGGTGEGKTSLISAMLGELSHAETSSVVIRGS--------------V 681

Query: 103 SYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITKWRHVL-----AP 157
           +Y+PQ + IF   TV ENIL   + +E ++  R   + +L  + ++   R +        
Sbjct: 682 AYVPQVSWIFNA-TVRENILFGSD-FESERYWRAIDVTALQHDLDLLPGRDLTEIGERGV 739

Query: 158 LLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDP-VAISDIHVLIRDLASRGIGILITDH 216
            +SGGQ++R+ +AR++ S     + D+P + +D  VA       ++D       +L+T  
Sbjct: 740 NISGGQKQRVSMARAVYSNSDIYIFDDPLSALDAHVAHQVFDSCMKDELKGKTRVLVT-- 797

Query: 217 NVHEILTLIDRAYIIHAGGVLAHGTVQEIIDN 248
           N    L L+DR  ++  G +   GT  E+  +
Sbjct: 798 NQLHFLPLMDRIILVSEGMIKEEGTFAELSKS 829