RPSBLAST alignment for GI: 254780744 and conserved domain: PRK09473

>gnl|CDD|181888 PRK09473, oppD, oligopeptide transporter ATP-binding component; Provisional. Length = 330
 Score = 55.1 bits (133), Expect = 2e-08
 Identities = 60/247 (24%), Positives = 122/247 (49%), Gaps = 19/247 (7%)

Query: 17  ENRASKDSLLSACSLTKKYNS----VYVVKGVDLYVKPGEIVGLLGPNGAGKT-TFFYMM 71
             +   D+LL    L   +++    V  V  ++  ++ GE +G++G +G+GK+ T F +M
Sbjct: 4   LAQQQADALLDVKDLRVTFSTPDGDVTAVNDLNFSLRAGETLGIVGESGSGKSQTAFALM 63

Query: 72  TGLICAD---SGSIKIDGNDITKMPMYRRARL---GISYLPQE--ASIFRGLTVEENILA 123
            GL+ A+    GS   +G +I  +P     +L    IS + Q+   S+   + V E ++ 
Sbjct: 64  -GLLAANGRIGGSATFNGREILNLPEKELNKLRAEQISMIFQDPMTSLNPYMRVGEQLME 122

Query: 124 VLEVYEK-DKKKRHEKLDSLLKEFNI--TKWRHVLAPL-LSGGQRRRLEIARSLVSFPSY 179
           VL +++   K +  E+   +L    +   + R  + P   SGG R+R+ IA +L+  P  
Sbjct: 123 VLMLHKGMSKAEAFEESVRMLDAVKMPEARKRMKMYPHEFSGGMRQRVMIAMALLCRPKL 182

Query: 180 ILLDEPFAGVDPVAISDIHVLIRDLASR-GIGILITDHNVHEILTLIDRAYIIHAGGVLA 238
           ++ DEP   +D    + I  L+ +L       I++  H++  +  + D+  +++AG  + 
Sbjct: 183 LIADEPTTALDVTVQAQIMTLLNELKREFNTAIIMITHDLGVVAGICDKVLVMYAGRTME 242

Query: 239 HGTVQEI 245
           +G  +++
Sbjct: 243 YGNARDV 249