RPSBLAST alignment for GI: 254780744 and conserved domain: PRK09580

>gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed. Length = 248
 Score = 51.3 bits (123), Expect = 2e-07
 Identities = 41/165 (24%), Positives = 80/165 (48%), Gaps = 17/165 (10%)

Query: 40  VVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGL--ICADSGSIKIDGNDITKMPMYRR 97
           +++G++L V+PGE+  ++GPNG+GK+T    + G        G+++  G D+ ++    R
Sbjct: 16  ILRGLNLEVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLELSPEDR 75

Query: 98  ARLGI----SYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITKWRH 153
           A  GI     Y  +   +     ++  + AV     ++   R +  D + ++  + K   
Sbjct: 76  AGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQEPLDRFDFQDLMEEKIALLK--- 132

Query: 154 VLAPLL--------SGGQRRRLEIARSLVSFPSYILLDEPFAGVD 190
           +   LL        SGG+++R +I +  V  P   +LDE  +G+D
Sbjct: 133 MPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLD 177