RPSBLAST alignment for GI: 254780744 and conserved domain: PRK10070

>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional. Length = 400
 Score = 91.6 bits (227), Expect = 2e-19
 Identities = 63/212 (29%), Positives = 113/212 (53%), Gaps = 4/212 (1%)

Query: 41  VKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMP---MYRR 97
           VK   L ++ GEI  ++G +G+GK+T   ++  LI    G + IDG DI K+    +   
Sbjct: 44  VKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREV 103

Query: 98  ARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITKWRHVLAP 157
            R  I+ + Q  ++   +TV +N    +E+   + ++R EK    L++  +  + H    
Sbjct: 104 RRKKIAMVFQSFALMPHMTVLDNTAFGMELAGINAEERREKALDALRQVGLENYAHSYPD 163

Query: 158 LLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIH-VLIRDLASRGIGILITDH 216
            LSGG R+R+ +AR+L   P  +L+DE F+ +DP+  +++   L++  A     I+   H
Sbjct: 164 ELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISH 223

Query: 217 NVHEILTLIDRAYIIHAGGVLAHGTVQEIIDN 248
           ++ E + + DR  I+  G V+  GT  EI++N
Sbjct: 224 DLDEAMRIGDRIAIMQNGEVVQVGTPDEILNN 255