RPSBLAST alignment for GI: 254780744 and conserved domain: PRK10247

>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional. Length = 225
 Score = 67.4 bits (165), Expect = 3e-12
 Identities = 50/193 (25%), Positives = 96/193 (49%), Gaps = 24/193 (12%)

Query: 40  VVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMP--MYRR 97
           ++  +   ++ GE   + GP+G GK+T   ++  LI   SG++  +G DI+ +   +YR+
Sbjct: 22  ILNNISFSLRAGEFKLITGPSGCGKSTLLKIVASLISPTSGTLLFEGEDISTLKPEIYRQ 81

Query: 98  ARLGISYLPQEASIFRGLTVEENILAVLEVYEK--DKKK------RHEKLDSLLKEFNIT 149
               +SY  Q  ++F G TV +N++   ++  +  D         R    D++L + NI 
Sbjct: 82  Q---VSYCAQTPTLF-GDTVYDNLIFPWQIRNQQPDPAIFLDDLERFALPDTILTK-NIA 136

Query: 150 KWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLAS-RG 208
           +        LSGG+++R+ + R+L   P  +LLDE  + +D     +++ +I      + 
Sbjct: 137 E--------LSGGEKQRISLIRNLQFMPKVLLLDEITSALDESNKHNVNEIIHRYVREQN 188

Query: 209 IGILITDHNVHEI 221
           I +L   H+  EI
Sbjct: 189 IAVLWVTHDKDEI 201