RPSBLAST alignment for GI: 254780744 and conserved domain: PRK10851

>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional. Length = 353
 Score = 90.5 bits (225), Expect = 3e-19
 Identities = 64/221 (28%), Positives = 113/221 (51%), Gaps = 10/221 (4%)

Query: 31  LTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDIT 90
           + K +    V+  + L +  G++V LLGP+G+GKTT   ++ GL    SG I+  G D++
Sbjct: 8   IKKSFGRTQVLNDISLDIPSGQMVALLGPSGSGKTTLLRIIAGLEHQTSGHIRFHGTDVS 67

Query: 91  KMPMYRRARLGISYLPQEASIFRGLTVEENI---LAVLEVYEK-DKKKRHEKLDSLLKEF 146
           ++    R ++G  +  Q  ++FR +TV +NI   L VL   E+ +      K+  LL+  
Sbjct: 68  RLHARDR-KVGFVF--QHYALFRHMTVFDNIAFGLTVLPRRERPNAAAIKAKVTQLLEMV 124

Query: 147 NITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLAS 206
            +          LSGGQ++R+ +AR+L   P  +LLDEPF  +D     ++   +R L  
Sbjct: 125 QLAHLADRYPAQLSGGQKQRVALARALAVEPQILLLDEPFGALDAQVRKELRRWLRQLHE 184

Query: 207 --RGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEI 245
             +   + +T H+  E + + DR  ++  G +   GT  ++
Sbjct: 185 ELKFTSVFVT-HDQEEAMEVADRVVVMSQGNIEQAGTPDQV 224