RPSBLAST alignment for GI: 254780744 and conserved domain: PRK11022

>gnl|CDD|182906 PRK11022, dppD, dipeptide transporter ATP-binding subunit; Provisional. Length = 326
 Score = 53.6 bits (129), Expect = 5e-08
 Identities = 52/214 (24%), Positives = 104/214 (48%), Gaps = 18/214 (8%)

Query: 48  VKPGEIVGLLGPNGAGKTTFFYMMTGLI------CADSGSIKIDGNDITKMPMYRRARL- 100
           VK GE+VG++G +G+GK+     + GLI       A+   ++ +G D+ ++    R  L 
Sbjct: 30  VKQGEVVGIVGESGSGKSVSSLAIMGLIDYPGRVMAEK--LEFNGQDLQRISEKERRNLV 87

Query: 101 --GISYLPQEA--SIFRGLTVEENILAVLEVYEK-DKKKRHEKLDSLLKEFNI---TKWR 152
              ++ + Q+   S+    TV   I+  ++V++  +KK R ++   LL +  I       
Sbjct: 88  GAEVAMIFQDPMTSLNPCYTVGFQIMEAIKVHQGGNKKTRRQRAIDLLNQVGIPDPASRL 147

Query: 153 HVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASR-GIGI 211
            V    LSGG  +R+ IA ++   P  ++ DEP   +D    + I  L+ +L  +  + +
Sbjct: 148 DVYPHQLSGGMSQRVMIAMAIACRPKLLIADEPTTALDVTIQAQIIELLLELQQKENMAL 207

Query: 212 LITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEI 245
           ++  H++  +     +  +++AG V+  G   +I
Sbjct: 208 VLITHDLALVAEAAHKIIVMYAGQVVETGKAHDI 241