RPSBLAST alignment for GI: 254780744 and conserved domain: PRK11176

>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional. Length = 582
 Score = 57.0 bits (138), Expect = 5e-09
 Identities = 55/208 (26%), Positives = 100/208 (48%), Gaps = 22/208 (10%)

Query: 42  KGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYRRARL- 100
           + ++  +  G+ V L+G +G+GK+T   ++T     D G I +DG+D+     Y  A L 
Sbjct: 360 RNINFKIPAGKTVALVGRSGSGKSTIANLLTRFYDIDEGEILLDGHDLRD---YTLASLR 416

Query: 101 -GISYLPQEASIFRGLTVEENI-LAVLEVYEKDKKKRHEKLDSLLKEFNITKWRHVL--- 155
             ++ + Q   +F   T+  NI  A  E Y +++ +   ++   + +F I K  + L   
Sbjct: 417 NQVALVSQNVHLFND-TIANNIAYARTEQYSREQIEEAARMAYAM-DF-INKMDNGLDTV 473

Query: 156 ----APLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIGI 211
                 LLSGGQR+R+ IAR+L+     ++LDE  + +D  +   I   + +L      +
Sbjct: 474 IGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSL 533

Query: 212 LI-----TDHNVHEILTLIDRAYIIHAG 234
           +I     T     EIL +++   I+  G
Sbjct: 534 VIAHRLSTIEKADEIL-VVEDGEIVERG 560